2JT3A

Solution structure of f153w cardiac troponin c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
161
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEWLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A02
5BPJA 1ODBA 1SCMB 4QJ3B 3TDZA 1D1OA 1SW8A 1XVJA 2M3WA 2I2RE 4HRGA 5CSNA 1F4OA 1QV0A 1NCYA 1IGVA 2KI6D 3I5GC 2JT8A 3SJSA 3FWBA 2AAOA 3JTDC 1MR8A 1Y0VH 1G8IA 2JZIA 3KPXA 4YBHB 4GGFA 4JQ0D 2JOJA 5HLOA 1RECA 2V53A 5CPVA 2KQ6A 4IL1A 4WQ3A 1CNPA 1S6CA 1YR5A 3OP0A 1DJXA 2JXLA 1B1GA 1AHRA 4HREE 3AKBA 2PASA 1QTXA 3OB2B 1UHKA 1C7VA 1EG3A 3OB1B 1J7RA 4ZCVA 1IJ6A 1YX7A 2KI6C 3BOWA 3TUYC 2I7AA 2O5GA 2HF5A 3FIAA 4OR9B 1J7OA 1UHNA 2A4JA 1A4PA 1SPYA 3ZWHA 1NX0A 1MXLC 4YI9A 2K8MB 2WC8A 3SIAA 1AK8A 2BBNA 4D1EA 2KFGA 1B8LA 2FCDA 1NSHA 1NCZA 2LMUA 1IRJA 1BMOA 3D10A 1DT7B 4CPVA 5DKQA 1R6PA 1U5IA 2M1UA 3BYAA 1U5IB 3DF0B 1NIWA 3OX5A 4M2OA 1L7ZA 2SCPA 1M31A 1BR1B 2I18A 4PE4A 1OZOA 4JWQA 2OS8C 3BUNB 1DGVA 1SMGA 1CFDA 1FPWA 2Y4QA 4YGDB 1EL4A 1SRAA 1M46A 4CFRA 2HQ8A 1YUTA 1ZUZA 3NSOA 1DJYA 5B8IB 2KI4C 1SCVA 1CLLA 4DS7A 2EC6B 1JF2A 1S6JA 1N0YA 2KYFA 4WRIA 3IQQA 1F71A 1B7TZ 1WLMA 1CDNA 1PRWA 2AUCA 5HKWA 1UP5A 2G2BA 3HCMA 1M63B 1AUIB 1AJ4A 1CM1A 1PSRA 1QVIY 3OHMB 3VROA 1IJ5A 1KQMB 2RGIA 3PLFB 4C0JA 4MLWA 3DVKA 2EGDA 4GBAA 1J1DA 1TNXA 4CFQA 3H4SE 3I5IC 1KK7Z 5IBWA 4E68A 1QS7A 1Y6WA 1BJFA 3RM1A 4AQIA 2I94A 2Y1NA 3D0YB 2M49B 3PN7B 1FF1A 2ZRTA 3BUWB 3QRXA 2M29A 1OMDA 4PCWA 1TCOB 4WQ2A 4MZLA 1NP8A 1LKJA 2WORA 1F8HA 1K96A 1MQ1A 1TNQA 1MWNA 2ZNDA 5D7FA 2KSPA 3TZ1A 4PHMA 1UWOA 2Y5IA 1EXRA 4M2QA 1C7WA 1L2OC 2CBLA 2M97A 1YRUB 4DIRA 5AERA 5GQQC 2K7CA 1G4YR 2MHHA 3IF7A 2MAZA 4ETOA 1EH2A 2KOTA 3O6BA 1DGUA 2NCOA 2COLB 5KTYA 1AJ5A 1B8CA 1QJTA 3EK7A 2LLSA 1XK4A 3CZTX 1K95A 2KAXA 4C0KA 2ZN8A 1J7PA 1MXEA 1S5GY 2M9GA 4NDBA 3LK1A 4PALA 1JWDA 3I5HC 5HLVA 1DJZA 1WY9A 3BUOB 5I2LA 1X02A 1BT6A 1XFUO 1H4BA 3I5FB 2QPTA 4PE7A 1KFXS 3LLEA 2DOQA 5HKZA 1PSBA 2L50A 4NDCA 4N5XA 1TRFA 2PRUA 2JNXA 2KYCA 4OCIA 4YGEB 2K2AA 4MSPA 1RJVA 3CR2A 4PE0A 1TTXA 5I2OA 2KHNA 2BCXA 4YGCB 2LE9B 1SY9A 1F70A 2G9BA 1WDCC 4GNKB 3EKJA 2M0RA 5ER5A 1C07A 2L0PA 4I5LB 3DVMA 2JU0A 1JFKA 3CR5X 5AANA 1H8BA 3GK4X 2L51A 4NDDA 2Q4UA 1JBAA 2LP2A 1BG1A 1W7IB 1CDMA 2F3ZA 1CLMA 2OTGB 1KWOB 3KO0A 1QATA 5HYDA 1DVIA 1A29A 1SNLA 2LMVA 1NYAA 1CFFA 1JFJA 1SL8A 2ZFDA 3BOWB 1V1FA 3E3RA 1XFVO 3O78A 2F2OA 1FBVA 1B4CA 2EHBA 2H2KA 1YX8A 1MF8B 1PALA 2PSRA 2GV5A 3GK1A 1RWYA 3IQOA 4YGAA 4BY5A 3CTNA 1OZSA 3TS5C 4PE1A 1Y1XA 1K94A 2CNPA 1UURA 1DJGA 4M2PA 1KFUL 2MLEC 3WHTB 2LVKA 5DKRA 2KBIA 3RLZA 3EK4A 3I5GB 1HT9A 3JTDB 5F6TA 2K0JA 1OOJA 1S26D 2M7NA 1A75A 3EVUA 3KHEA 4PDZA 2KGBC 2MBXA 1A75B 2F2PA 5PALA 1WLZA 4CIDA 2M1KB 1FI5A 4I5KA 3AAJA 4HRHA 1MUXA 1XYDA 2F3YA 2JWWA 3K21A 3SG6A 2JT3A 4GUKA 4MZJA 4OVNF 2WOSA 2M7LA 1GGZA 4PHJA 3PFVA 1YRTB 2MLFC 1JF0A 1ZFSA 3KF9A 1N65A 2JNFA 4I5JA 4QJ5B 4GPLB 1KQMC 2FOTA 3SG2A 1K9UA 3AAKA 1IQ3A 2JPTA 2KQYA 3CLNA 3SG5A 3TUYB 4UPGA 1K9PA 2F33A 4NQGA 2LVIA 4YRUA 1K2HA 1TIZA 3BQ3A 2K61A 5AFPA 1PK0D 2O60A 1S6IA 3A4UB 2KAYA 2JT0A 2H61C 3NSIA 2LUXA 1SKTA 5ER4X 5K89A 4GAOA 5DKNA 2WCEA 4I5NB 2CXJA 1MHOA 5FYXA 2BKIB 2PALA 2FCEA 3PATA 4HSZA 1AVSA 1XFZO 1QX2A 1K90D 1SR6C 5KSZA 1KK8C 2L98A 3BUMB 2CCMA 1KQVA 1UHHA 3DVEA 1CB1A 1DJIA 2NLNA 1XO5A 2OS8B 3JVTC 4ORCB 3FWCA 1QX5B 1R2UA 1NX3A 1IQ5A 1W7JB 2L5XB 1XFYO 3C1VA 1LA3A 3O4YA 5CSFA 5D69A 4AQJA 3LK0A 4L9MA 1QV1A 3BUXB 3I5FC 1WRZA 2BL0C 4MVFA 1YTZC 2E30A 1BU3A 3WXAA 1SCMC 3DVJA 4QJ4B 1WRLA 4Q04A 4R1EA 1DJHA 1LXFC 4U8DA 2H61A 2KFFA 1A03A 1B7TY 4YI8A 3VRPA 5JJGA 2L2EA 3PSRA 2L4IA 5I8NA 4GGFC 4ZCUA 1XA5A 3AKAA 3PALA 4PHNA 1BOCA 3I5IB 4YGBB 1ALVA 2ZNEA 4N1FA 1CMFA 3SG3A 1GGWA 1DTLA 1KWOC 1KK7Y 1ZACA 1ZMZA 2LC5A 2LHLA 1OMRA 2JULA 1NPQA 2Y1MA 1RTP1 2Q91A 1J7QA 1PULA 2SASA 1QLKA 2ZKMX 2BE4A 4A4CA 5HKYA 3NSKA 1F55A 2WCBA 3MSEB 4XJKA 4BY4A 1BR4B 1L2OB 3FS7A 4CLNA 1DF0A 3NXAA 1JUOA 3VGOA 1DF0B 1ZOTB 3TDIA 2K7OA 2P6BB 5KU1A 3GOFA 3EVRA 2OPOA 3GK2A 4OKHA 3WHUB 2MRDA 1M39A 2GGZA 1E8AA 3SG4A 2TN4A 2KNEA 5CSIA 4FQOA 1B8RA 2M8UA 1CKKA 3I5HB 1S36A 2NCPA 2LANA 1NCXA 2LVJA 3NSLA 4MRXA 2LVVA 1LINA 2HETA 4DUQA 1UUSA 1DJWA 1HQVA 2K2FA 2K7BA 3ZNIA 2NXQA 1CFPA 1BODA 1CLBA 5G08A 1K9KA 3EVVA 1CDLA 2KFHA 2LNKA 3EKHA 1G33A 3CWGA 1QXPA 2KGRA 4DRWA 4TNCA 1WDCB 1YURA 2CT9A 1YVHA 2JTTA 3OX6A 1GJYA 5TNCA 2EC6C 4ICBA 1QIWA 1QIVA 2BCAA 1A2XA 1Y1AA 2E6WA 4P5OE 1NWDA 1QVIZ 2JRFA 1KCYA 3TDUA 1QLSA 1WRKA 1V1GA 4A4BA 1IKUA 1EG4A 1YVLA 1CMGA 4PHKA 2R2IA 1CTRA 3VRNA 1M45A 4P2YB 3SIBA 1XFXO 1J1EA 3VRRA 1TNWA 1DMOA 1KSMA 1OE9B 2LAPA 3DF0A 2PVBA 1S1EA 1IH0A 1FW4A 3PN7C 1OMVA 2MJWB 1TNPA 3LCPC 3O2PA 3LL8B 3KEVA 3TS5B 2CTNA 1ALWA 1B9AA 2B1UA 1YUUA 1OSAA 1KFUS 1NX2A 2LLUA 1OQPA 3HX4A 3F45A 3CR4X 1CM4A 2K7DA 1IWQA 4DCKA 1KSOA 2MA2A 3M0WA 2LV7A 2LM5A 2JXCA 1PVAA 2HPSA 1K8UA 3WNXB 1Y1UA 1NX1A 2QACA 4XYNA 1QX7A 1S5GZ 1EJ3A 3SG7A 1F54A 1XK4C 3CS1A 1LVCD 1N2DA 2WNDA 1LA0A 2JQ6A 1YUSA 1JSAA 4ORAB 1SL9A 3BXKA 5CSJA 2KAVA 1RK9A 1BLQA 3ICBA 2D8NA 3EK8A 2ISDA 5J3XA 2L4HA 2KI4B 1KFXL 1SK6D 1SBJA 4GFTA 1TN4A 3PM8A 1F4QA 1S3PA 2BECA 1VRKA 4N1GA 3DD4A 4OV2A 4AOMA 1QASA 2LMTA 3D0YA 2PMYA 2LLTA 2KBMA 2ZRSA 2BBMA 1GQMA 4MBEA 1UHJA 2KDHA 2LCPA 2JTZA 2JC2A 2AMIA 1XFWO 2ZN9A 4MZKA 1TCFA 1CDPA 2NZ0A 1AP4A 1CFCA 2BE6A 1SL7A 5AXIA 1IG5A 1RROA 3CGAA 4GGNA 3A8RA 4USLA 4MEWA 1JC2A 1J55A 2HQWA 2VRGA 1K93D 1SR6B 1BF5A 1KK8B 2F8PA 5AEQA 1TOPA 1UHIA 5I2QA 2GGMA 2OTGC 4MN0A 3VRQA 4C0LA 1PVBA 3JVTB 1FI6A 2IS9A 1NUBA 2BCBA 5JOLA 2LHIA 4MRYA 4XJKB 1Q80A 2LUCA 4F0ZB 2WCFA 4JPZB 2LP3A 4ORBB 1B47A 1SYMA 2BL0B 1RFJA 4FTGA 2FJUB 2BKHB
chains in the Genus database with same CATH superfamily
5BPJA 1ODBA 1OW4A 1SCMB 4QJ3B 3TDZA 1D1OA 1SW8A 1XVJA 2M3WA 2I2RE 4HRGA 4OZDA 5CSNA 3S0BA 1F4OA 1QV0A 1NCYA 1IGVA 2KI6D 3I5GC 2JT8A 1TUZA 3FWBA 3SJSA 2AAOA 3JTDC 1MR8A 1Y0VH 1G8IA 2JZIA 3KPXA 4YBHB 4GGFA 4JQ0D 2JOJA 5HLOA 1RECA 2V53A 5CPVA 3FE8A 2KQ6A 4IL1A 4WQ3A 1CNPA 2GTEA 1S6CA 1YR5A 3OP0A 1DJXA 2JXLA 1B1GA 1AHRA 4HREE 3O4XA 3AKBA 2PASA 1QTXA 3OB2B 1UHKA 1C7VA 1EG3A 3OB1B 1J7RA 4ZCVA 1IJ6A 1YX7A 2KI6C 3BOWA 3TUYC 2I7AA 5DICA 2O5GA 2HF5A 3FIAA 4OR9B 1J7OA 1UHNA 2A4JA 3CDNA 1A4PA 1SPYA 2L5YA 1NX0A 1MXLC 4YI9A 2K8MB 3ZWHA 2WC8A 3PM2A 3SIAA 1AK8A 2BBNA 4D1EA 2KFGA 3SS5A 3UO9A 1B8LA 2FCDA 1NSHA 1NCZA 2LMUA 1IRJA 1BMOA 3D10A 1DT7B 4CPVA 5DKQA 2KLDA 1R6PA 1U5IA 2M1UA 3BYAA 1U5IB 3DF0B 1NIWA 3OX5A 4M2OA 1L7ZA 2SCPA 1M31A 3CZ1A 1BR1B 2I18A 4PE4A 1OZOA 4JWQA 2OS8C 2BNXA 3BUNB 1DGVA 1SMGA 1CFDA 1J7QA 1FPWA 2Y4QA 4YGDB 1EL4A 1SRAA 1M46A 4CFRA 2HQ8A 1YUTA 1DELA 1ZUZA 1C3YA 3NSOA 1DJYA 5B8IB 2KI4C 1SCVA 1CLLA 4DS7A 2EC6B 1JF2A 1S6JA 1N0YA 2KYFA 4WRIA 3IQQA 1F71A 1B7TZ 1WLMA 2PQLA 1CDNA 1PRWA 2AUCA 4INWA 5HKWA 1UP5A 2G2BA 3HCMA 2P71A 4JKTA 3DY9A 3CYZA 1M63B 1AUIB 1AJ4A 1CM1A 1PSRA 1QVIY 3OHMB 3VROA 1IJ5A 1KQMB 2RGIA 3PLFB 4C0JA 1IIOA 4MLWA 3DVKA 2EGDA 4GBAA 1J1DA 1TNXA 4CFQA 3H4SE 3I5IC 1KK7Z 5IBWA 3B86A 1QS7A 1Y6WA 3FE6A 4E68A 1BJFA 3RM1A 4AQIA 2I94A 2Y1NA 3D0YB 2M49B 3PN7B 1FF1A 2ZRTA 1TWOA 3BUWB 3QRXA 2M29A 1OMDA 4PCWA 1TCOB 4WQ2A 4MZLA 1NP8A 1LKJA 2WORA 1F8HA 1K96A 1MQ1A 1TNQA 1MWNA 2ZNDA 5D7FA 2KSPA 3TZ1A 4PHMA 1UWOA 2Y5IA 1EXRA 4M2QA 1C7WA 1L2OC 2CBLA 2M97A 1YRUB 4DIRA 5AERA 5GQQC 2K7CA 1G4YR 2MHHA 3IF7A 1OOHA 2MAZA 4ETOA 2KOTA 1EH2A 3O6BA 1DGUA 2NCOA 1T14A 2COLB 5KTYA 1AJ5A 1B8CA 1QJTA 2QEHA 3EK7A 2LLSA 1XK4A 3CZTX 1K95A 1ORGA 2KAXA 4C0KA 2ZN8A 1J7PA 3S0AA 3OGNA 1MXEA 1S5GY 2M9GA 2WCLA 3LK1A 4NDBA 4PALA 1JWDA 3I5HC 5HLVA 1DJZA 1WY9A 3BUOB 5I2LA 1X02A 1BT6A 1XFUO 1H4BA 3I5FB 3DYEA 2QPTA 4PE7A 1KFXS 3LLEA 2DOQA 5HKZA 1PSBA 2L50A 2WCHA 4NDCA 4N5XA 1TRFA 2PRUA 2JNXA 2KYCA 3CABA 4OCIA 4YGEB 2K2AA 4MSPA 1RJVA 3R72A 3CR2A 4PE0A 1TTXA 5I2OA 2KHNA 2BCXA 4YGCB 2LE9B 1SY9A 1F70A 2BAPA 2G9BA 1WDCC 4GNKB 3EKJA 2M0RA 5ER5A 1C07A 2L0PA 4I5LB 3DVMA 2JU0A 1JFKA 3CR5X 5AANA 3PJIA 1H8BA 3GK4X 2L51A 4NDDA 2Q4UA 1JBAA 3BFBA 2LP2A 3FE9A 1BG1A 1W7IB 1CDMA 2F3ZA 1CLMA 1XFRA 2OTGB 1KWOB 1SSEB 3KO0A 1QATA 2PYQA 2QDIA 5HYDA 1DVIA 1A29A 1SNLA 2LMVA 1NYAA 1CFFA 1JFJA 1SL8A 2ZFDA 3BOWB 1V1FA 3CZ0A 3E3RA 3SS4A 1XFVO 3O78A 2F2OA 1FBVA 3D77A 1B4CA 2EHBA 2H2KA 3B88A 1YX8A 1MF8B 3RZSA 1PALA 2PSRA 2GV5A 3GK1A 1RWYA 2WCMA 3IQOA 4INXA 4YGAA 3CTNA 1OZSA 3TS5C 4PE1A 2QEBA 1Y1XA 1K94A 1UURA 2CNPA 1OOFA 1DJGA 3B7AA 1KFUL 2MLEC 4M2PA 2LVKA 3WHTB 5DKRA 2KBIA 3BJHA 3RLZA 3UNWA 3EK4A 3I5GB 2FJYA 1HT9A 3JTDB 5F6TA 2K0JA 1OOJA 1S26D 2M7NA 1A75A 3EVUA 3KHEA 4PDZA 2KGBC 2MBXA 1A75B 2F2PA 5PALA 1WLZA 4CIDA 2M1KB 1FI5A 4I5KA 3AAJA 4HRHA 1MUXA 1XYDA 2F3YA 2JWWA 3K21A 3SG6A 2JT3A 3OBVA 4GUKA 4MZJA 4OVNF 2WOSA 2M7LA 1GGZA 4PHJA 3D78A 3PFVA 1YRTB 2MLFC 1JF0A 1ZFSA 3KF9A 1N65A 2JNFA 4I5JA 4QJ5B 4GPLB 1DQEA 1KQMC 2FOTA 3SG2A 1K9UA 3AAKA 4JD9A 2P70A 1IQ3A 2JPTA 2KQYA 3CLNA 3SG5A 3TUYB 4UPGA 1K9PA 2F33A 4NQGA 2LVIA 4YRUA 1K2HA 1TIZA 3BQ3A 2K61A 5AFPA 1PK0D 2O60A 1S6IA 3A4UB 5FI6A 2KAYA 2JT0A 2H61C 3NSIA 2LUXA 1SKTA 5ER4X 5K89A 4GAOA 5DKNA 2WCEA 4I5NB 2CXJA 1MHOA 5FYXA 2BKIB 2PALA 1DC1A 2FCEA 3PATA 4HSZA 1AVSA 1XFZO 1QX2A 1K90D 5HL1A 1SR6C 5KSZA 1KK8C 2L98A 3BUMB 2CCMA 1KQVA 1UHHA 4F7FA 3DVEA 3SS3A 3D73A 1CB1A 1DJIA 2NLNA 1XO5A 2OS8B 3JVTC 3DZTA 3FWCA 4ORCB 1QX5B 1R2UA 1NX3A 1IQ5A 1W7JB 2L5XB 1XFYO 1Z4HA 3B6XA 3R1OA 3C1VA 1LA3A 3O4YA 3R1VA 5CSFA 5D69A 4AQJA 3LK0A 4L9MA 1QV1A 3BUXB 3I5FC 1WRZA 2BL0C 4MVFA 1YTZC 2E30A 1BU3A 2L2CA 3WXAA 1SCMC 3DVJA 4QJ4B 1WRLA 4Q04A 4R1EA 1DJHA 1LXFC 4U8DA 2H61A 2K60A 2KFFA 1A03A 1B7TY 2QEOA 4YI8A 3VRPA 5JJGA 2L2EA 3PSRA 2L4IA 5I8NA 4GGFC 3L47A 4FQTA 4ZCUA 1XA5A 3AKAA 3PALA 4PHNA 1BOCA 3I5IB 4YGBB 1ALVA 2ZNEA 4N1FA 1CMFA 3SG3A 1GGWA 1DTLA 1KWOC 1KK7Y 1ZACA 1ZMZA 2LC5A 2LHLA 1OMRA 2KPHA 2JULA 1NPQA 2Y1MA 3S0DA 1QWVA 1RTP1 2Q91A 3S0FA 4PT1A 1PULA 2SASA 1QLKA 2ZKMX 2BE4A 4A4CA 5HKYA 3NSKA 1F55A 2WCBA 3MSEB 4XJKA 2WCJA 4BY4A 1BR4B 1L2OB 3FS7A 4CLNA 1DF0A 3D75A 1JUOA 3NXAA 3VGOA 1DF0B 1ZOTB 3QMEA 2K7OA 2P6BB 3TDIA 5KU1A 3GOFA 3EVRA 5EL2A 2OPOA 2ERBA 3GK2A 4OKHA 3WHUB 2MRDA 1M39A 2GGZA 1E8AA 3SG4A 2TN4A 2KNEA 5CSIA 4FQOA 1W9ZA 1B8RA 2M8UA 1CKKA 3I5HB 3V2LA 1S36A 1P28A 2NCPA 2LANA 1Z2CB 1NCXA 1OOIX 2LVJA 3NSLA 4MRXA 5I94A 2LVVA 4IJ7A 1LINA 2HETA 4DUQA 1UUSA 1DJWA 1HQVA 2K2FA 2K7BA 3ZNIA 2NXQA 1CFPA 1BODA 1CLBA 5G08A 1K9KA 3EVVA 2QEVA 3IVTA 1CDLA 2KFHA 3K1EA 2LNKA 3EKHA 1G33A 3CWGA 3EG5B 1QXPA 2KGRA 4DRWA 4TNCA 1WDCB 1YURA 2CT9A 1YVHA 2JTTA 3OX6A 1GJYA 5TNCA 2EC6C 4ICBA 1QIWA 1QIVA 2BCAA 1A2XA 1DEKA 1Y1AA 2E6WA 4P5OE 1NWDA 1QVIZ 2JRFA 1KCYA 3TDUA 1QLSA 1WRKA 1V1GA 4A4BA 1IKUA 1EG4A 1YVLA 3S0GA 1CMGA 4PHKA 2R2IA 1CTRA 3VRNA 1M45A 4P2YB 3SIBA 1XFXO 1J1EA 3VRRA 1TNWA 1DMOA 1KSMA 1OE9B 2LAPA 3DF0A 2PVBA 1S1EA 1IH0A 1FW4A 3PN7C 1OMVA 2MJWB 1TNPA 3LCPC 3O2PA 3LL8B 3KEVA 3TS5B 2CTNA 1ALWA 1TUJA 3B87A 1B9AA 2WC5A 2B1UA 1YUUA 1OSAA 1KFUS 3BFAA 1NX2A 2LLUA 1OQPA 3HX4A 3F45A 3CR4X 1CM4A 2K7DA 1IWQA 3DXLA 1LS8A 4DCKA 1KSOA 2MA2A 3M0WA 2LV7A 2LM5A 2H8VA 1PVAA 2JXCA 2HPSA 1K8UA 2YGUA 3WNXB 1Y1UA 1NX1A 2QACA 4XYNA 1QX7A 1S5GZ 1EJ3A 3SG7A 1F54A 1XK4C 3CS1A 1LVCD 1N2DA 2WNDA 1LA0A 2JQ6A 2WC6A 1YUSA 1JSAA 4ORAB 1SL9A 3BXKA 5CSJA 1C3ZA 2KAVA 5FI7A 1RK9A 2KLEA 3ICBA 2D8NA 3EK8A 2ISDA 1BLQA 5J3XA 2L4HA 2KI4B 1KFXL 1SK6D 1SBJA 3Q8IA 4GFTA 1TN4A 3PM8A 1F4QA 1S3PA 2BECA 1VRKA 4N1GA 3DD4A 3L4LA 4OV2A 1QASA 2LMTA 4AOMA 3D0YA 2PMYA 2LLTA 2KBMA 2ZRSA 3L4AA 2BBMA 1GQMA 4MBEA 3VB1A 1UHJA 2KDHA 2LCPA 2JTZA 2JC2A 3NHIA 4KYNA 2AMIA 3CZ2A 1XFWO 2ZN9A 3D76A 4MZKA 1TCFA 1CDPA 2NZ0A 3S0EA 1AP4A 1CFCA 2BE6A 1SL7A 5AXIA 1IG5A 1RROA 3CGAA 3N7HA 3R1PA 4GGNA 3A8RA 3NGVA 4MEWA 4USLA 1JC2A 1J55A 2HQWA 2VRGA 1K93D 1SR6B 1BF5A 1KK8B 2F8PA 5AEQA 1TOPA 5D3OA 1UHIA 5I2QA 2GGMA 2OTGC 4MN0A 3D74A 3VRQA 4C0LA 2WCKA 1PVBA 3JVTB 1FI6A 1OOGA 4BY5A 2IS9A 1NUBA 2BCBA 5JOLA 3NHTA 2LHIA 4MRYA 4XJKB 1Q80A 2LUCA 4F0ZB 2WCFA 4JPZB 2LP3A 1GM0A 4ORBB 2JPOA 1B47A 1SYMA 2BL0B 3BFHA 1RFJA 4FTGA 2FJUB 2BKHB 5FI2A
chains in the Genus database with same CATH topology
5BPJA 1ODBA 1SCMB 4QJ3B 3TDZA 1D1OA 1SW8A 1XVJA 2M3WA 2I2RE 4HRGA 5CSNA 1F4OA 1QV0A 1NCYA 1IGVA 2KI6D 3I5GC 2JT8A 3SJSA 3FWBA 2AAOA 3JTDC 1MR8A 1Y0VH 1G8IA 2JZIA 3KPXA 4YBHB 4GGFA 4JQ0D 2JOJA 5HLOA 1RECA 2V53A 5CPVA 2KQ6A 4IL1A 4WQ3A 1CNPA 1S6CA 1YR5A 3OP0A 1DJXA 2JXLA 1B1GA 1AHRA 4HREE 3AKBA 2PASA 1QTXA 3OB2B 1UHKA 1C7VA 1EG3A 3OB1B 1J7RA 4ZCVA 1IJ6A 1YX7A 2KI6C 3BOWA 3TUYC 2I7AA 2O5GA 2HF5A 3FIAA 4OR9B 1J7OA 1UHNA 2A4JA 1A4PA 1SPYA 3ZWHA 1NX0A 1MXLC 4YI9A 2K8MB 2WC8A 3SIAA 1AK8A 2BBNA 4D1EA 2KFGA 1B8LA 2FCDA 1NSHA 1NCZA 2LMUA 1IRJA 1BMOA 3D10A 1DT7B 4CPVA 5DKQA 1R6PA 1U5IA 2M1UA 3BYAA 1U5IB 3DF0B 1NIWA 3OX5A 4M2OA 1L7ZA 2SCPA 1M31A 1BR1B 2I18A 4PE4A 1OZOA 4JWQA 2OS8C 3BUNB 1DGVA 1SMGA 1CFDA 1FPWA 2Y4QA 4YGDB 1EL4A 1SRAA 1M46A 4CFRA 2HQ8A 1YUTA 1ZUZA 3NSOA 1DJYA 5B8IB 2KI4C 1SCVA 1CLLA 4DS7A 2EC6B 1JF2A 1S6JA 1N0YA 2KYFA 4WRIA 3IQQA 1F71A 1B7TZ 1WLMA 1CDNA 1PRWA 2AUCA 5HKWA 1UP5A 2G2BA 3HCMA 1M63B 1AUIB 1AJ4A 1CM1A 1PSRA 1QVIY 3OHMB 3VROA 1IJ5A 1KQMB 2RGIA 3PLFB 4C0JA 4MLWA 3DVKA 2EGDA 4GBAA 1J1DA 1TNXA 4CFQA 3H4SE 3I5IC 1KK7Z 5IBWA 4E68A 1QS7A 1Y6WA 1BJFA 3RM1A 4AQIA 2I94A 2Y1NA 3D0YB 2M49B 3PN7B 1FF1A 2ZRTA 3BUWB 3QRXA 2M29A 1OMDA 4PCWA 1TCOB 4WQ2A 4MZLA 1NP8A 1LKJA 2WORA 1F8HA 1K96A 1MQ1A 1TNQA 1MWNA 2ZNDA 5D7FA 2KSPA 3TZ1A 4PHMA 1UWOA 2Y5IA 1EXRA 4M2QA 1C7WA 1L2OC 2CBLA 2M97A 1YRUB 4DIRA 5AERA 5GQQC 2K7CA 1G4YR 2MHHA 3IF7A 2MAZA 4ETOA 1EH2A 2KOTA 3O6BA 1DGUA 2NCOA 2COLB 5KTYA 1AJ5A 1B8CA 1QJTA 3EK7A 2LLSA 1XK4A 3CZTX 1K95A 2KAXA 4C0KA 2ZN8A 1J7PA 1MXEA 1S5GY 2M9GA 4NDBA 3LK1A 4PALA 1JWDA 3I5HC 5HLVA 1DJZA 1WY9A 3BUOB 5I2LA 1X02A 1BT6A 1XFUO 1H4BA 3I5FB 2QPTA 4PE7A 1KFXS 3LLEA 2DOQA 5HKZA 1PSBA 2L50A 4NDCA 4N5XA 1TRFA 2PRUA 2JNXA 2KYCA 4OCIA 4YGEB 2K2AA 4MSPA 1RJVA 3CR2A 4PE0A 1TTXA 5I2OA 2KHNA 2BCXA 4YGCB 2LE9B 1SY9A 1F70A 2G9BA 1WDCC 4GNKB 3EKJA 2M0RA 5ER5A 1C07A 2L0PA 4I5LB 3DVMA 2JU0A 1JFKA 3CR5X 5AANA 1H8BA 3GK4X 2L51A 4NDDA 2Q4UA 1JBAA 2LP2A 1BG1A 1W7IB 1CDMA 2F3ZA 1CLMA 2OTGB 1KWOB 3KO0A 1QATA 5HYDA 1DVIA 1A29A 1SNLA 2LMVA 1NYAA 1CFFA 1JFJA 1SL8A 2ZFDA 3BOWB 1V1FA 3E3RA 1XFVO 3O78A 2F2OA 1FBVA 1B4CA 2EHBA 2H2KA 1YX8A 1MF8B 1PALA 2PSRA 2GV5A 3GK1A 1RWYA 3IQOA 4YGAA 4BY5A 3CTNA 1OZSA 3TS5C 4PE1A 1Y1XA 1K94A 2CNPA 1UURA 1DJGA 4M2PA 1KFUL 2MLEC 3WHTB 2LVKA 5DKRA 2KBIA 3RLZA 3EK4A 3I5GB 1HT9A 3JTDB 5F6TA 2K0JA 1OOJA 1S26D 2M7NA 1A75A 3EVUA 3KHEA 4PDZA 2KGBC 2MBXA 1A75B 2F2PA 5PALA 1WLZA 4CIDA 2M1KB 1FI5A 4I5KA 3AAJA 4HRHA 1MUXA 1XYDA 2F3YA 2JWWA 3K21A 3SG6A 2JT3A 4GUKA 4MZJA 4OVNF 2WOSA 2M7LA 1GGZA 4PHJA 3PFVA 1YRTB 2MLFC 1JF0A 1ZFSA 3KF9A 1N65A 2JNFA 4I5JA 4QJ5B 4GPLB 1KQMC 2FOTA 3SG2A 1K9UA 3AAKA 1IQ3A 2JPTA 2KQYA 3CLNA 3SG5A 3TUYB 4UPGA 1K9PA 2F33A 4NQGA 2LVIA 4YRUA 1K2HA 1TIZA 3BQ3A 2K61A 5AFPA 1PK0D 2O60A 1S6IA 3A4UB 2KAYA 2JT0A 2H61C 3NSIA 2LUXA 1SKTA 5ER4X 5K89A 4GAOA 5DKNA 2WCEA 4I5NB 2CXJA 1MHOA 5FYXA 2BKIB 2PALA 2FCEA 3PATA 4HSZA 1AVSA 1XFZO 1QX2A 1K90D 1SR6C 5KSZA 1KK8C 2L98A 3BUMB 2CCMA 1KQVA 1UHHA 3DVEA 1CB1A 1DJIA 2NLNA 1XO5A 2OS8B 3JVTC 4ORCB 3FWCA 1QX5B 1R2UA 1NX3A 1IQ5A 1W7JB 2L5XB 1XFYO 3C1VA 1LA3A 3O4YA 5CSFA 5D69A 4AQJA 3LK0A 4L9MA 1QV1A 3BUXB 3I5FC 1WRZA 2BL0C 4MVFA 1YTZC 2E30A 1BU3A 3WXAA 1SCMC 3DVJA 4QJ4B 1WRLA 4Q04A 4R1EA 1DJHA 1LXFC 4U8DA 2H61A 2KFFA 1A03A 1B7TY 4YI8A 3VRPA 5JJGA 2L2EA 3PSRA 2L4IA 5I8NA 4GGFC 4ZCUA 1XA5A 3AKAA 3PALA 4PHNA 1BOCA 3I5IB 4YGBB 1ALVA 2ZNEA 4N1FA 1CMFA 3SG3A 1GGWA 1DTLA 1KWOC 1KK7Y 1ZACA 1ZMZA 2LC5A 2LHLA 1OMRA 2JULA 1NPQA 2Y1MA 1RTP1 2Q91A 1J7QA 1PULA 2SASA 1QLKA 2ZKMX 2BE4A 4A4CA 5HKYA 3NSKA 1F55A 2WCBA 3MSEB 4XJKA 4BY4A 1BR4B 1L2OB 3FS7A 4CLNA 1DF0A 3NXAA 1JUOA 3VGOA 1DF0B 1ZOTB 3TDIA 2K7OA 2P6BB 5KU1A 3GOFA 3EVRA 2OPOA 3GK2A 4OKHA 3WHUB 2MRDA 1M39A 2GGZA 1E8AA 3SG4A 2TN4A 2KNEA 5CSIA 4FQOA 1B8RA 2M8UA 1CKKA 3I5HB 1S36A 2NCPA 2LANA 1NCXA 2LVJA 3NSLA 4MRXA 2LVVA 1LINA 2HETA 4DUQA 1UUSA 1DJWA 1HQVA 2K2FA 2K7BA 3ZNIA 2NXQA 1CFPA 1BODA 1CLBA 5G08A 1K9KA 3EVVA 1CDLA 2KFHA 2LNKA 3EKHA 1G33A 3CWGA 1QXPA 2KGRA 4DRWA 4TNCA 1WDCB 1YURA 2CT9A 1YVHA 2JTTA 3OX6A 1GJYA 5TNCA 2EC6C 4ICBA 1QIWA 1QIVA 2BCAA 1A2XA 1Y1AA 2E6WA 4P5OE 1NWDA 1QVIZ 2JRFA 1KCYA 3TDUA 1QLSA 1WRKA 1V1GA 4A4BA 1IKUA 1EG4A 1YVLA 1CMGA 4PHKA 2R2IA 1CTRA 3VRNA 1M45A 4P2YB 3SIBA 1XFXO 1J1EA 3VRRA 1TNWA 1DMOA 1KSMA 1OE9B 2LAPA 3DF0A 2PVBA 1S1EA 1IH0A 1FW4A 3PN7C 1OMVA 2MJWB 1TNPA 3LCPC 3O2PA 3LL8B 3KEVA 3TS5B 2CTNA 1ALWA 1B9AA 2B1UA 1YUUA 1OSAA 1KFUS 1NX2A 2LLUA 1OQPA 3HX4A 3F45A 3CR4X 1CM4A 2K7DA 1IWQA 4DCKA 1KSOA 2MA2A 3M0WA 2LV7A 2LM5A 2JXCA 1PVAA 2HPSA 1K8UA 3WNXB 1Y1UA 1NX1A 2QACA 4XYNA 1QX7A 1S5GZ 1EJ3A 3SG7A 1F54A 1XK4C 3CS1A 1LVCD 1N2DA 2WNDA 1LA0A 2JQ6A 1YUSA 1JSAA 4ORAB 1SL9A 3BXKA 5CSJA 2KAVA 1RK9A 1BLQA 3ICBA 2D8NA 3EK8A 2ISDA 5J3XA 2L4HA 2KI4B 1KFXL 1SK6D 1SBJA 4GFTA 1TN4A 3PM8A 1F4QA 1S3PA 2BECA 1VRKA 4N1GA 3DD4A 4OV2A 4AOMA 1QASA 2LMTA 3D0YA 2PMYA 2LLTA 2KBMA 2ZRSA 2BBMA 1GQMA 4MBEA 1UHJA 2KDHA 2LCPA 2JTZA 2JC2A 2AMIA 1XFWO 2ZN9A 4MZKA 1TCFA 1CDPA 2NZ0A 1AP4A 1CFCA 2BE6A 1SL7A 5AXIA 1IG5A 1RROA 3CGAA 4GGNA 3A8RA 4USLA 4MEWA 1JC2A 1J55A 2HQWA 2VRGA 1K93D 1SR6B 1BF5A 1KK8B 2F8PA 5AEQA 1TOPA 1UHIA 5I2QA 2GGMA 2OTGC 4MN0A 3VRQA 4C0LA 1PVBA 3JVTB 1FI6A 2IS9A 1NUBA 2BCBA 5JOLA 2LHIA 4MRYA 4XJKB 1Q80A 2LUCA 4F0ZB 2WCFA 4JPZB 2LP3A 4ORBB 1B47A 1SYMA 2BL0B 1RFJA 4FTGA 2FJUB 2BKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPJ A;  1ODB A;  1SCM B;  4QJ3 B;  3TDZ A;  1D1O A;  1SW8 A;  1XVJ A;  2M3W A;  2I2R E;  4HRG A;  5CSN A;  1F4O A;  1QV0 A;  1NCY A;  1IGV A;  2KI6 D;  3I5G C;  2JT8 A;  3SJS A;  3FWB A;  2AAO A;  3JTD C;  1MR8 A;  1Y0V H;  1G8I A;  2JZI A;  3KPX A;  4YBH B;  4GGF A;  4JQ0 D;  2JOJ A;  5HLO A;  1REC A;  2V53 A;  5CPV A;  2KQ6 A;  4IL1 A;  4WQ3 A;  1CNP A;  1S6C A;  1YR5 A;  3OP0 A;  1DJX A;  2JXL A;  1B1G A;  1AHR A;  4HRE E;  3AKB A;  2PAS A;  1QTX A;  3OB2 B;  1UHK A;  1C7V A;  1EG3 A;  3OB1 B;  1J7R A;  4ZCV A;  1IJ6 A;  1YX7 A;  2KI6 C;  3BOW A;  3TUY C;  2I7A A;  2O5G A;  2HF5 A;  3FIA A;  4OR9 B;  1J7O A;  1UHN A;  2A4J A;  1A4P A;  1SPY A;  3ZWH A;  1NX0 A;  1MXL C;  4YI9 A;  2K8M B;  2WC8 A;  3SIA A;  1AK8 A;  2BBN A;  4D1E A;  2KFG A;  1B8L A;  2FCD A;  1NSH A;  1NCZ A;  2LMU A;  1IRJ A;  1BMO A;  3D10 A;  1DT7 B;  4CPV A;  5DKQ A;  1R6P A;  1U5I A;  2M1U A;  3BYA A;  1U5I B;  3DF0 B;  1NIW A;  3OX5 A;  4M2O A;  1L7Z A;  2SCP A;  1M31 A;  1BR1 B;  2I18 A;  4PE4 A;  1OZO A;  4JWQ A;  2OS8 C;  3BUN B;  1DGV A;  1SMG A;  1CFD A;  1FPW A;  2Y4Q A;  4YGD B;  1EL4 A;  1SRA A;  1M46 A;  4CFR A;  2HQ8 A;  1YUT A;  1ZUZ A;  3NSO A;  1DJY A;  5B8I B;  2KI4 C;  1SCV A;  1CLL A;  4DS7 A;  2EC6 B;  1JF2 A;  1S6J A;  1N0Y A;  2KYF A;  4WRI A;  3IQQ A;  1F71 A;  1B7T Z;  1WLM A;  1CDN A;  1PRW A;  2AUC A;  5HKW A;  1UP5 A;  2G2B A;  3HCM A;  1M63 B;  1AUI B;  1AJ4 A;  1CM1 A;  1PSR A;  1QVI Y;  3OHM B;  3VRO A;  1IJ5 A;  1KQM B;  2RGI A;  3PLF B;  4C0J A;  4MLW A;  3DVK A;  2EGD A;  4GBA A;  1J1D A;  1TNX A;  4CFQ A;  3H4S E;  3I5I C;  1KK7 Z;  5IBW A;  4E68 A;  1QS7 A;  1Y6W A;  1BJF A;  3RM1 A;  4AQI A;  2I94 A;  2Y1N A;  3D0Y B;  2M49 B;  3PN7 B;  1FF1 A;  2ZRT A;  3BUW B;  3QRX A;  2M29 A;  1OMD A;  4PCW A;  1TCO B;  4WQ2 A;  4MZL A;  1NP8 A;  1LKJ A;  2WOR A;  1F8H A;  1K96 A;  1MQ1 A;  1TNQ A;  1MWN A;  2ZND A;  5D7F A;  2KSP A;  3TZ1 A;  4PHM A;  1UWO A;  2Y5I A;  1EXR A;  4M2Q A;  1C7W A;  1L2O C;  2CBL A;  2M97 A;  1YRU B;  4DIR A;  5AER A;  5GQQ C;  2K7C A;  1G4Y R;  2MHH A;  3IF7 A;  2MAZ A;  4ETO A;  1EH2 A;  2KOT A;  3O6B A;  1DGU A;  2NCO A;  2COL B;  5KTY A;  1AJ5 A;  1B8C A;  1QJT A;  3EK7 A;  2LLS A;  1XK4 A;  3CZT X;  1K95 A;  2KAX A;  4C0K A;  2ZN8 A;  1J7P A;  1MXE A;  1S5G Y;  2M9G A;  4NDB A;  3LK1 A;  4PAL A;  1JWD A;  3I5H C;  5HLV A;  1DJZ A;  1WY9 A;  3BUO B;  5I2L A;  1X02 A;  1BT6 A;  1XFU O;  1H4B A;  3I5F B;  2QPT A;  4PE7 A;  1KFX S;  3LLE A;  2DOQ A;  5HKZ A;  1PSB A;  2L50 A;  4NDC A;  4N5X A;  1TRF A;  2PRU A;  2JNX A;  2KYC A;  4OCI A;  4YGE B;  2K2A A;  4MSP A;  1RJV A;  3CR2 A;  4PE0 A;  1TTX A;  5I2O A;  2KHN A;  2BCX A;  4YGC B;  2LE9 B;  1SY9 A;  1F70 A;  2G9B A;  1WDC C;  4GNK B;  3EKJ A;  2M0R A;  5ER5 A;  1C07 A;  2L0P A;  4I5L B;  3DVM A;  2JU0 A;  1JFK A;  3CR5 X;  5AAN A;  1H8B A;  3GK4 X;  2L51 A;  4NDD A;  2Q4U A;  1JBA A;  2LP2 A;  1BG1 A;  1W7I B;  1CDM A;  2F3Z A;  1CLM A;  2OTG B;  1KWO B;  3KO0 A;  1QAT A;  5HYD A;  1DVI A;  1A29 A;  1SNL A;  2LMV A;  1NYA A;  1CFF A;  1JFJ A;  1SL8 A;  2ZFD A;  3BOW B;  1V1F A;  3E3R A;  1XFV O;  3O78 A;  2F2O A;  1FBV A;  1B4C A;  2EHB A;  2H2K A;  1YX8 A;  1MF8 B;  1PAL A;  2PSR A;  2GV5 A;  3GK1 A;  1RWY A;  3IQO A;  4YGA A;  4BY5 A;  3CTN A;  1OZS A;  3TS5 C;  4PE1 A;  1Y1X A;  1K94 A;  2CNP A;  1UUR A;  1DJG A;  4M2P A;  1KFU L;  2MLE C;  3WHT B;  2LVK A;  5DKR A;  2KBI A;  3RLZ A;  3EK4 A;  3I5G B;  1HT9 A;  3JTD B;  5F6T A;  2K0J A;  1OOJ A;  1S26 D;  2M7N A;  1A75 A;  3EVU A;  3KHE A;  4PDZ A;  2KGB C;  2MBX A;  1A75 B;  2F2P A;  5PAL A;  1WLZ A;  4CID A;  2M1K B;  1FI5 A;  4I5K A;  3AAJ A;  4HRH A;  1MUX A;  1XYD A;  2F3Y A;  2JWW A;  3K21 A;  3SG6 A;  2JT3 A;  4GUK A;  4MZJ A;  4OVN F;  2WOS A;  2M7L A;  1GGZ A;  4PHJ A;  3PFV A;  1YRT B;  2MLF C;  1JF0 A;  1ZFS A;  3KF9 A;  1N65 A;  2JNF A;  4I5J A;  4QJ5 B;  4GPL B;  1KQM C;  2FOT A;  3SG2 A;  1K9U A;  3AAK A;  1IQ3 A;  2JPT A;  2KQY A;  3CLN A;  3SG5 A;  3TUY B;  4UPG A;  1K9P A;  2F33 A;  4NQG A;  2LVI A;  4YRU A;  1K2H A;  1TIZ A;  3BQ3 A;  2K61 A;  5AFP A;  1PK0 D;  2O60 A;  1S6I A;  3A4U B;  2KAY A;  2JT0 A;  2H61 C;  3NSI A;  2LUX A;  1SKT A;  5ER4 X;  5K89 A;  4GAO A;  5DKN A;  2WCE A;  4I5N B;  2CXJ A;  1MHO A;  5FYX A;  2BKI B;  2PAL A;  2FCE A;  3PAT A;  4HSZ A;  1AVS A;  1XFZ O;  1QX2 A;  1K90 D;  1SR6 C;  5KSZ A;  1KK8 C;  2L98 A;  3BUM B;  2CCM A;  1KQV A;  1UHH A;  3DVE A;  1CB1 A;  1DJI A;  2NLN A;  1XO5 A;  2OS8 B;  3JVT C;  4ORC B;  3FWC A;  1QX5 B;  1R2U A;  1NX3 A;  1IQ5 A;  1W7J B;  2L5X B;  1XFY O;  3C1V A;  1LA3 A;  3O4Y A;  5CSF A;  5D69 A;  4AQJ A;  3LK0 A;  4L9M A;  1QV1 A;  3BUX B;  3I5F C;  1WRZ A;  2BL0 C;  4MVF A;  1YTZ C;  2E30 A;  1BU3 A;  3WXA A;  1SCM C;  3DVJ A;  4QJ4 B;  1WRL A;  4Q04 A;  4R1E A;  1DJH A;  1LXF C;  4U8D A;  2H61 A;  2KFF A;  1A03 A;  1B7T Y;  4YI8 A;  3VRP A;  5JJG A;  2L2E A;  3PSR A;  2L4I A;  5I8N A;  4GGF C;  4ZCU A;  1XA5 A;  3AKA A;  3PAL A;  4PHN A;  1BOC A;  3I5I B;  4YGB B;  1ALV A;  2ZNE A;  4N1F A;  1CMF A;  3SG3 A;  1GGW A;  1DTL A;  1KWO C;  1KK7 Y;  1ZAC A;  1ZMZ A;  2LC5 A;  2LHL A;  1OMR A;  2JUL A;  1NPQ A;  2Y1M A;  1RTP 1;  2Q91 A;  1J7Q A;  1PUL A;  2SAS A;  1QLK A;  2ZKM X;  2BE4 A;  4A4C A;  5HKY A;  3NSK A;  1F55 A;  2WCB A;  3MSE B;  4XJK A;  4BY4 A;  1BR4 B;  1L2O B;  3FS7 A;  4CLN A;  1DF0 A;  3NXA A;  1JUO A;  3VGO A;  1DF0 B;  1ZOT B;  3TDI A;  2K7O A;  2P6B B;  5KU1 A;  3GOF A;  3EVR A;  2OPO A;  3GK2 A;  4OKH A;  3WHU B;  2MRD A;  1M39 A;  2GGZ A;  1E8A A;  3SG4 A;  2TN4 A;  2KNE A;  5CSI A;  4FQO A;  1B8R A;  2M8U A;  1CKK A;  3I5H B;  1S36 A;  2NCP A;  2LAN A;  1NCX A;  2LVJ A;  3NSL A;  4MRX A;  2LVV A;  1LIN A;  2HET A;  4DUQ A;  1UUS A;  1DJW A;  1HQV A;  2K2F A;  2K7B A;  3ZNI A;  2NXQ A;  1CFP A;  1BOD A;  1CLB A;  5G08 A;  1K9K A;  3EVV A;  1CDL A;  2KFH A;  2LNK A;  3EKH A;  1G33 A;  3CWG A;  1QXP A;  2KGR A;  4DRW A;  4TNC A;  1WDC B;  1YUR A;  2CT9 A;  1YVH A;  2JTT A;  3OX6 A;  1GJY A;  5TNC A;  2EC6 C;  4ICB A;  1QIW A;  1QIV A;  2BCA A;  1A2X A;  1Y1A A;  2E6W A;  4P5O E;  1NWD A;  1QVI Z;  2JRF A;  1KCY A;  3TDU A;  1QLS A;  1WRK A;  1V1G A;  4A4B A;  1IKU A;  1EG4 A;  1YVL A;  1CMG A;  4PHK A;  2R2I A;  1CTR A;  3VRN A;  1M45 A;  4P2Y B;  3SIB A;  1XFX O;  1J1E A;  3VRR A;  1TNW A;  1DMO A;  1KSM A;  1OE9 B;  2LAP A;  3DF0 A;  2PVB A;  1S1E A;  1IH0 A;  1FW4 A;  3PN7 C;  1OMV A;  2MJW B;  1TNP A;  3LCP C;  3O2P A;  3LL8 B;  3KEV A;  3TS5 B;  2CTN A;  1ALW A;  1B9A A;  2B1U A;  1YUU A;  1OSA A;  1KFU S;  1NX2 A;  2LLU A;  1OQP A;  3HX4 A;  3F45 A;  3CR4 X;  1CM4 A;  2K7D A;  1IWQ A;  4DCK A;  1KSO A;  2MA2 A;  3M0W A;  2LV7 A;  2LM5 A;  2JXC A;  1PVA A;  2HPS A;  1K8U A;  3WNX B;  1Y1U A;  1NX1 A;  2QAC A;  4XYN A;  1QX7 A;  1S5G Z;  1EJ3 A;  3SG7 A;  1F54 A;  1XK4 C;  3CS1 A;  1LVC D;  1N2D A;  2WND A;  1LA0 A;  2JQ6 A;  1YUS A;  1JSA A;  4ORA B;  1SL9 A;  3BXK A;  5CSJ A;  2KAV A;  1RK9 A;  1BLQ A;  3ICB A;  2D8N A;  3EK8 A;  2ISD A;  5J3X A;  2L4H A;  2KI4 B;  1KFX L;  1SK6 D;  1SBJ A;  4GFT A;  1TN4 A;  3PM8 A;  1F4Q A;  1S3P A;  2BEC A;  1VRK A;  4N1G A;  3DD4 A;  4OV2 A;  4AOM A;  1QAS A;  2LMT A;  3D0Y A;  2PMY A;  2LLT A;  2KBM A;  2ZRS A;  2BBM A;  1GQM A;  4MBE A;  1UHJ A;  2KDH A;  2LCP A;  2JTZ A;  2JC2 A;  2AMI A;  1XFW O;  2ZN9 A;  4MZK A;  1TCF A;  1CDP A;  2NZ0 A;  1AP4 A;  1CFC A;  2BE6 A;  1SL7 A;  5AXI A;  1IG5 A;  1RRO A;  3CGA A;  4GGN A;  3A8R A;  4USL A;  4MEW A;  1JC2 A;  1J55 A;  2HQW A;  2VRG A;  1K93 D;  1SR6 B;  1BF5 A;  1KK8 B;  2F8P A;  5AEQ A;  1TOP A;  1UHI A;  5I2Q A;  2GGM A;  2OTG C;  4MN0 A;  3VRQ A;  4C0L A;  1PVB A;  3JVT B;  1FI6 A;  2IS9 A;  1NUB A;  2BCB A;  5JOL A;  2LHI A;  4MRY A;  4XJK B;  1Q80 A;  2LUC A;  4F0Z B;  2WCF A;  4JPZ B;  2LP3 A;  4ORB B;  1B47 A;  1SYM A;  2BL0 B;  1RFJ A;  4FTG A;  2FJU B;  2BKH B; 
#chains in the Genus database with same CATH topology
 5BPJ A;  1ODB A;  1OW4 A;  1SCM B;  4QJ3 B;  3TDZ A;  1D1O A;  1SW8 A;  1XVJ A;  2M3W A;  2I2R E;  4HRG A;  4OZD A;  5CSN A;  3S0B A;  1F4O A;  1QV0 A;  1NCY A;  1IGV A;  2KI6 D;  3I5G C;  2JT8 A;  1TUZ A;  3FWB A;  3SJS A;  2AAO A;  3JTD C;  1MR8 A;  1Y0V H;  1G8I A;  2JZI A;  3KPX A;  4YBH B;  4GGF A;  4JQ0 D;  2JOJ A;  5HLO A;  1REC A;  2V53 A;  5CPV A;  3FE8 A;  2KQ6 A;  4IL1 A;  4WQ3 A;  1CNP A;  2GTE A;  1S6C A;  1YR5 A;  3OP0 A;  1DJX A;  2JXL A;  1B1G A;  1AHR A;  4HRE E;  3O4X A;  3AKB A;  2PAS A;  1QTX A;  3OB2 B;  1UHK A;  1C7V A;  1EG3 A;  3OB1 B;  1J7R A;  4ZCV A;  1IJ6 A;  1YX7 A;  2KI6 C;  3BOW A;  3TUY C;  2I7A A;  5DIC A;  2O5G A;  2HF5 A;  3FIA A;  4OR9 B;  1J7O A;  1UHN A;  2A4J A;  3CDN A;  1A4P A;  1SPY A;  2L5Y A;  1NX0 A;  1MXL C;  4YI9 A;  2K8M B;  3ZWH A;  2WC8 A;  3PM2 A;  3SIA A;  1AK8 A;  2BBN A;  4D1E A;  2KFG A;  3SS5 A;  3UO9 A;  1B8L A;  2FCD A;  1NSH A;  1NCZ A;  2LMU A;  1IRJ A;  1BMO A;  3D10 A;  1DT7 B;  4CPV A;  5DKQ A;  2KLD A;  1R6P A;  1U5I A;  2M1U A;  3BYA A;  1U5I B;  3DF0 B;  1NIW A;  3OX5 A;  4M2O A;  1L7Z A;  2SCP A;  1M31 A;  3CZ1 A;  1BR1 B;  2I18 A;  4PE4 A;  1OZO A;  4JWQ A;  2OS8 C;  2BNX A;  3BUN B;  1DGV A;  1SMG A;  1CFD A;  1J7Q A;  1FPW A;  2Y4Q A;  4YGD B;  1EL4 A;  1SRA A;  1M46 A;  4CFR A;  2HQ8 A;  1YUT A;  1DEL A;  1ZUZ A;  1C3Y A;  3NSO A;  1DJY A;  5B8I B;  2KI4 C;  1SCV A;  1CLL A;  4DS7 A;  2EC6 B;  1JF2 A;  1S6J A;  1N0Y A;  2KYF A;  4WRI A;  3IQQ A;  1F71 A;  1B7T Z;  1WLM A;  2PQL A;  1CDN A;  1PRW A;  2AUC A;  4INW A;  5HKW A;  1UP5 A;  2G2B A;  3HCM A;  2P71 A;  4JKT A;  3DY9 A;  3CYZ A;  1M63 B;  1AUI B;  1AJ4 A;  1CM1 A;  1PSR A;  1QVI Y;  3OHM B;  3VRO A;  1IJ5 A;  1KQM B;  2RGI A;  3PLF B;  4C0J A;  1IIO A;  4MLW A;  3DVK A;  2EGD A;  4GBA A;  1J1D A;  1TNX A;  4CFQ A;  3H4S E;  3I5I C;  1KK7 Z;  5IBW A;  3B86 A;  1QS7 A;  1Y6W A;  3FE6 A;  4E68 A;  1BJF A;  3RM1 A;  4AQI A;  2I94 A;  2Y1N A;  3D0Y B;  2M49 B;  3PN7 B;  1FF1 A;  2ZRT A;  1TWO A;  3BUW B;  3QRX A;  2M29 A;  1OMD A;  4PCW A;  1TCO B;  4WQ2 A;  4MZL A;  1NP8 A;  1LKJ A;  2WOR A;  1F8H A;  1K96 A;  1MQ1 A;  1TNQ A;  1MWN A;  2ZND A;  5D7F A;  2KSP A;  3TZ1 A;  4PHM A;  1UWO A;  2Y5I A;  1EXR A;  4M2Q A;  1C7W A;  1L2O C;  2CBL A;  2M97 A;  1YRU B;  4DIR A;  5AER A;  5GQQ C;  2K7C A;  1G4Y R;  2MHH A;  3IF7 A;  1OOH A;  2MAZ A;  4ETO A;  2KOT A;  1EH2 A;  3O6B A;  1DGU A;  2NCO A;  1T14 A;  2COL B;  5KTY A;  1AJ5 A;  1B8C A;  1QJT A;  2QEH A;  3EK7 A;  2LLS A;  1XK4 A;  3CZT X;  1K95 A;  1ORG A;  2KAX A;  4C0K A;  2ZN8 A;  1J7P A;  3S0A A;  3OGN A;  1MXE A;  1S5G Y;  2M9G A;  2WCL A;  3LK1 A;  4NDB A;  4PAL A;  1JWD A;  3I5H C;  5HLV A;  1DJZ A;  1WY9 A;  3BUO B;  5I2L A;  1X02 A;  1BT6 A;  1XFU O;  1H4B A;  3I5F B;  3DYE A;  2QPT A;  4PE7 A;  1KFX S;  3LLE A;  2DOQ A;  5HKZ A;  1PSB A;  2L50 A;  2WCH A;  4NDC A;  4N5X A;  1TRF A;  2PRU A;  2JNX A;  2KYC A;  3CAB A;  4OCI A;  4YGE B;  2K2A A;  4MSP A;  1RJV A;  3R72 A;  3CR2 A;  4PE0 A;  1TTX A;  5I2O A;  2KHN A;  2BCX A;  4YGC B;  2LE9 B;  1SY9 A;  1F70 A;  2BAP A;  2G9B A;  1WDC C;  4GNK B;  3EKJ A;  2M0R A;  5ER5 A;  1C07 A;  2L0P A;  4I5L B;  3DVM A;  2JU0 A;  1JFK A;  3CR5 X;  5AAN A;  3PJI A;  1H8B A;  3GK4 X;  2L51 A;  4NDD A;  2Q4U A;  1JBA A;  3BFB A;  2LP2 A;  3FE9 A;  1BG1 A;  1W7I B;  1CDM A;  2F3Z A;  1CLM A;  1XFR A;  2OTG B;  1KWO B;  1SSE B;  3KO0 A;  1QAT A;  2PYQ A;  2QDI A;  5HYD A;  1DVI A;  1A29 A;  1SNL A;  2LMV A;  1NYA A;  1CFF A;  1JFJ A;  1SL8 A;  2ZFD A;  3BOW B;  1V1F A;  3CZ0 A;  3E3R A;  3SS4 A;  1XFV O;  3O78 A;  2F2O A;  1FBV A;  3D77 A;  1B4C A;  2EHB A;  2H2K A;  3B88 A;  1YX8 A;  1MF8 B;  3RZS A;  1PAL A;  2PSR A;  2GV5 A;  3GK1 A;  1RWY A;  2WCM A;  3IQO A;  4INX A;  4YGA A;  3CTN A;  1OZS A;  3TS5 C;  4PE1 A;  2QEB A;  1Y1X A;  1K94 A;  1UUR A;  2CNP A;  1OOF A;  1DJG A;  3B7A A;  1KFU L;  2MLE C;  4M2P A;  2LVK A;  3WHT B;  5DKR A;  2KBI A;  3BJH A;  3RLZ A;  3UNW A;  3EK4 A;  3I5G B;  2FJY A;  1HT9 A;  3JTD B;  5F6T A;  2K0J A;  1OOJ A;  1S26 D;  2M7N A;  1A75 A;  3EVU A;  3KHE A;  4PDZ A;  2KGB C;  2MBX A;  1A75 B;  2F2P A;  5PAL A;  1WLZ A;  4CID A;  2M1K B;  1FI5 A;  4I5K A;  3AAJ A;  4HRH A;  1MUX A;  1XYD A;  2F3Y A;  2JWW A;  3K21 A;  3SG6 A;  2JT3 A;  3OBV A;  4GUK A;  4MZJ A;  4OVN F;  2WOS A;  2M7L A;  1GGZ A;  4PHJ A;  3D78 A;  3PFV A;  1YRT B;  2MLF C;  1JF0 A;  1ZFS A;  3KF9 A;  1N65 A;  2JNF A;  4I5J A;  4QJ5 B;  4GPL B;  1DQE A;  1KQM C;  2FOT A;  3SG2 A;  1K9U A;  3AAK A;  4JD9 A;  2P70 A;  1IQ3 A;  2JPT A;  2KQY A;  3CLN A;  3SG5 A;  3TUY B;  4UPG A;  1K9P A;  2F33 A;  4NQG A;  2LVI A;  4YRU A;  1K2H A;  1TIZ A;  3BQ3 A;  2K61 A;  5AFP A;  1PK0 D;  2O60 A;  1S6I A;  3A4U B;  5FI6 A;  2KAY A;  2JT0 A;  2H61 C;  3NSI A;  2LUX A;  1SKT A;  5ER4 X;  5K89 A;  4GAO A;  5DKN A;  2WCE A;  4I5N B;  2CXJ A;  1MHO A;  5FYX A;  2BKI B;  2PAL A;  1DC1 A;  2FCE A;  3PAT A;  4HSZ A;  1AVS A;  1XFZ O;  1QX2 A;  1K90 D;  5HL1 A;  1SR6 C;  5KSZ A;  1KK8 C;  2L98 A;  3BUM B;  2CCM A;  1KQV A;  1UHH A;  4F7F A;  3DVE A;  3SS3 A;  3D73 A;  1CB1 A;  1DJI A;  2NLN A;  1XO5 A;  2OS8 B;  3JVT C;  3DZT A;  3FWC A;  4ORC B;  1QX5 B;  1R2U A;  1NX3 A;  1IQ5 A;  1W7J B;  2L5X B;  1XFY O;  1Z4H A;  3B6X A;  3R1O A;  3C1V A;  1LA3 A;  3O4Y A;  3R1V A;  5CSF A;  5D69 A;  4AQJ A;  3LK0 A;  4L9M A;  1QV1 A;  3BUX B;  3I5F C;  1WRZ A;  2BL0 C;  4MVF A;  1YTZ C;  2E30 A;  1BU3 A;  2L2C A;  3WXA A;  1SCM C;  3DVJ A;  4QJ4 B;  1WRL A;  4Q04 A;  4R1E A;  1DJH A;  1LXF C;  4U8D A;  2H61 A;  2K60 A;  2KFF A;  1A03 A;  1B7T Y;  2QEO A;  4YI8 A;  3VRP A;  5JJG A;  2L2E A;  3PSR A;  2L4I A;  5I8N A;  4GGF C;  3L47 A;  4FQT A;  4ZCU A;  1XA5 A;  3AKA A;  3PAL A;  4PHN A;  1BOC A;  3I5I B;  4YGB B;  1ALV A;  2ZNE A;  4N1F A;  1CMF A;  3SG3 A;  1GGW A;  1DTL A;  1KWO C;  1KK7 Y;  1ZAC A;  1ZMZ A;  2LC5 A;  2LHL A;  1OMR A;  2KPH A;  2JUL A;  1NPQ A;  2Y1M A;  3S0D A;  1QWV A;  1RTP 1;  2Q91 A;  3S0F A;  4PT1 A;  1PUL A;  2SAS A;  1QLK A;  2ZKM X;  2BE4 A;  4A4C A;  5HKY A;  3NSK A;  1F55 A;  2WCB A;  3MSE B;  4XJK A;  2WCJ A;  4BY4 A;  1BR4 B;  1L2O B;  3FS7 A;  4CLN A;  1DF0 A;  3D75 A;  1JUO A;  3NXA A;  3VGO A;  1DF0 B;  1ZOT B;  3QME A;  2K7O A;  2P6B B;  3TDI A;  5KU1 A;  3GOF A;  3EVR A;  5EL2 A;  2OPO A;  2ERB A;  3GK2 A;  4OKH A;  3WHU B;  2MRD A;  1M39 A;  2GGZ A;  1E8A A;  3SG4 A;  2TN4 A;  2KNE A;  5CSI A;  4FQO A;  1W9Z A;  1B8R A;  2M8U A;  1CKK A;  3I5H B;  3V2L A;  1S36 A;  1P28 A;  2NCP A;  2LAN A;  1Z2C B;  1NCX A;  1OOI X;  2LVJ A;  3NSL A;  4MRX A;  5I94 A;  2LVV A;  4IJ7 A;  1LIN A;  2HET A;  4DUQ A;  1UUS A;  1DJW A;  1HQV A;  2K2F A;  2K7B A;  3ZNI A;  2NXQ A;  1CFP A;  1BOD A;  1CLB A;  5G08 A;  1K9K A;  3EVV A;  2QEV A;  3IVT A;  1CDL A;  2KFH A;  3K1E A;  2LNK A;  3EKH A;  1G33 A;  3CWG A;  3EG5 B;  1QXP A;  2KGR A;  4DRW A;  4TNC A;  1WDC B;  1YUR A;  2CT9 A;  1YVH A;  2JTT A;  3OX6 A;  1GJY A;  5TNC A;  2EC6 C;  4ICB A;  1QIW A;  1QIV A;  2BCA A;  1A2X A;  1DEK A;  1Y1A A;  2E6W A;  4P5O E;  1NWD A;  1QVI Z;  2JRF A;  1KCY A;  3TDU A;  1QLS A;  1WRK A;  1V1G A;  4A4B A;  1IKU A;  1EG4 A;  1YVL A;  3S0G A;  1CMG A;  4PHK A;  2R2I A;  1CTR A;  3VRN A;  1M45 A;  4P2Y B;  3SIB A;  1XFX O;  1J1E A;  3VRR A;  1TNW A;  1DMO A;  1KSM A;  1OE9 B;  2LAP A;  3DF0 A;  2PVB A;  1S1E A;  1IH0 A;  1FW4 A;  3PN7 C;  1OMV A;  2MJW B;  1TNP A;  3LCP C;  3O2P A;  3LL8 B;  3KEV A;  3TS5 B;  2CTN A;  1ALW A;  1TUJ A;  3B87 A;  1B9A A;  2WC5 A;  2B1U A;  1YUU A;  1OSA A;  1KFU S;  3BFA A;  1NX2 A;  2LLU A;  1OQP A;  3HX4 A;  3F45 A;  3CR4 X;  1CM4 A;  2K7D A;  1IWQ A;  3DXL A;  1LS8 A;  4DCK A;  1KSO A;  2MA2 A;  3M0W A;  2LV7 A;  2LM5 A;  2H8V A;  1PVA A;  2JXC A;  2HPS A;  1K8U A;  2YGU A;  3WNX B;  1Y1U A;  1NX1 A;  2QAC A;  4XYN A;  1QX7 A;  1S5G Z;  1EJ3 A;  3SG7 A;  1F54 A;  1XK4 C;  3CS1 A;  1LVC D;  1N2D A;  2WND A;  1LA0 A;  2JQ6 A;  2WC6 A;  1YUS A;  1JSA A;  4ORA B;  1SL9 A;  3BXK A;  5CSJ A;  1C3Z A;  2KAV A;  5FI7 A;  1RK9 A;  2KLE A;  3ICB A;  2D8N A;  3EK8 A;  2ISD A;  1BLQ A;  5J3X A;  2L4H A;  2KI4 B;  1KFX L;  1SK6 D;  1SBJ A;  3Q8I A;  4GFT A;  1TN4 A;  3PM8 A;  1F4Q A;  1S3P A;  2BEC A;  1VRK A;  4N1G A;  3DD4 A;  3L4L A;  4OV2 A;  1QAS A;  2LMT A;  4AOM A;  3D0Y A;  2PMY A;  2LLT A;  2KBM A;  2ZRS A;  3L4A A;  2BBM A;  1GQM A;  4MBE A;  3VB1 A;  1UHJ A;  2KDH A;  2LCP A;  2JTZ A;  2JC2 A;  3NHI A;  4KYN A;  2AMI A;  3CZ2 A;  1XFW O;  2ZN9 A;  3D76 A;  4MZK A;  1TCF A;  1CDP A;  2NZ0 A;  3S0E A;  1AP4 A;  1CFC A;  2BE6 A;  1SL7 A;  5AXI A;  1IG5 A;  1RRO A;  3CGA A;  3N7H A;  3R1P A;  4GGN A;  3A8R A;  3NGV A;  4MEW A;  4USL A;  1JC2 A;  1J55 A;  2HQW A;  2VRG A;  1K93 D;  1SR6 B;  1BF5 A;  1KK8 B;  2F8P A;  5AEQ A;  1TOP A;  5D3O A;  1UHI A;  5I2Q A;  2GGM A;  2OTG C;  4MN0 A;  3D74 A;  3VRQ A;  4C0L A;  2WCK A;  1PVB A;  3JVT B;  1FI6 A;  1OOG A;  4BY5 A;  2IS9 A;  1NUB A;  2BCB A;  5JOL A;  3NHT A;  2LHI A;  4MRY A;  4XJK B;  1Q80 A;  2LUC A;  4F0Z B;  2WCF A;  4JPZ B;  2LP3 A;  1GM0 A;  4ORB B;  2JPO A;  1B47 A;  1SYM A;  2BL0 B;  3BFH A;  1RFJ A;  4FTG A;  2FJU B;  2BKH B;  5FI2 A; 
#chains in the Genus database with same CATH homology
 5BPJ A;  1ODB A;  1SCM B;  4QJ3 B;  3TDZ A;  1D1O A;  1SW8 A;  1XVJ A;  2M3W A;  2I2R E;  4HRG A;  5CSN A;  1F4O A;  1QV0 A;  1NCY A;  1IGV A;  2KI6 D;  3I5G C;  2JT8 A;  3SJS A;  3FWB A;  2AAO A;  3JTD C;  1MR8 A;  1Y0V H;  1G8I A;  2JZI A;  3KPX A;  4YBH B;  4GGF A;  4JQ0 D;  2JOJ A;  5HLO A;  1REC A;  2V53 A;  5CPV A;  2KQ6 A;  4IL1 A;  4WQ3 A;  1CNP A;  1S6C A;  1YR5 A;  3OP0 A;  1DJX A;  2JXL A;  1B1G A;  1AHR A;  4HRE E;  3AKB A;  2PAS A;  1QTX A;  3OB2 B;  1UHK A;  1C7V A;  1EG3 A;  3OB1 B;  1J7R A;  4ZCV A;  1IJ6 A;  1YX7 A;  2KI6 C;  3BOW A;  3TUY C;  2I7A A;  2O5G A;  2HF5 A;  3FIA A;  4OR9 B;  1J7O A;  1UHN A;  2A4J A;  1A4P A;  1SPY A;  3ZWH A;  1NX0 A;  1MXL C;  4YI9 A;  2K8M B;  2WC8 A;  3SIA A;  1AK8 A;  2BBN A;  4D1E A;  2KFG A;  1B8L A;  2FCD A;  1NSH A;  1NCZ A;  2LMU A;  1IRJ A;  1BMO A;  3D10 A;  1DT7 B;  4CPV A;  5DKQ A;  1R6P A;  1U5I A;  2M1U A;  3BYA A;  1U5I B;  3DF0 B;  1NIW A;  3OX5 A;  4M2O A;  1L7Z A;  2SCP A;  1M31 A;  1BR1 B;  2I18 A;  4PE4 A;  1OZO A;  4JWQ A;  2OS8 C;  3BUN B;  1DGV A;  1SMG A;  1CFD A;  1FPW A;  2Y4Q A;  4YGD B;  1EL4 A;  1SRA A;  1M46 A;  4CFR A;  2HQ8 A;  1YUT A;  1ZUZ A;  3NSO A;  1DJY A;  5B8I B;  2KI4 C;  1SCV A;  1CLL A;  4DS7 A;  2EC6 B;  1JF2 A;  1S6J A;  1N0Y A;  2KYF A;  4WRI A;  3IQQ A;  1F71 A;  1B7T Z;  1WLM A;  1CDN A;  1PRW A;  2AUC A;  5HKW A;  1UP5 A;  2G2B A;  3HCM A;  1M63 B;  1AUI B;  1AJ4 A;  1CM1 A;  1PSR A;  1QVI Y;  3OHM B;  3VRO A;  1IJ5 A;  1KQM B;  2RGI A;  3PLF B;  4C0J A;  4MLW A;  3DVK A;  2EGD A;  4GBA A;  1J1D A;  1TNX A;  4CFQ A;  3H4S E;  3I5I C;  1KK7 Z;  5IBW A;  4E68 A;  1QS7 A;  1Y6W A;  1BJF A;  3RM1 A;  4AQI A;  2I94 A;  2Y1N A;  3D0Y B;  2M49 B;  3PN7 B;  1FF1 A;  2ZRT A;  3BUW B;  3QRX A;  2M29 A;  1OMD A;  4PCW A;  1TCO B;  4WQ2 A;  4MZL A;  1NP8 A;  1LKJ A;  2WOR A;  1F8H A;  1K96 A;  1MQ1 A;  1TNQ A;  1MWN A;  2ZND A;  5D7F A;  2KSP A;  3TZ1 A;  4PHM A;  1UWO A;  2Y5I A;  1EXR A;  4M2Q A;  1C7W A;  1L2O C;  2CBL A;  2M97 A;  1YRU B;  4DIR A;  5AER A;  5GQQ C;  2K7C A;  1G4Y R;  2MHH A;  3IF7 A;  2MAZ A;  4ETO A;  1EH2 A;  2KOT A;  3O6B A;  1DGU A;  2NCO A;  2COL B;  5KTY A;  1AJ5 A;  1B8C A;  1QJT A;  3EK7 A;  2LLS A;  1XK4 A;  3CZT X;  1K95 A;  2KAX A;  4C0K A;  2ZN8 A;  1J7P A;  1MXE A;  1S5G Y;  2M9G A;  4NDB A;  3LK1 A;  4PAL A;  1JWD A;  3I5H C;  5HLV A;  1DJZ A;  1WY9 A;  3BUO B;  5I2L A;  1X02 A;  1BT6 A;  1XFU O;  1H4B A;  3I5F B;  2QPT A;  4PE7 A;  1KFX S;  3LLE A;  2DOQ A;  5HKZ A;  1PSB A;  2L50 A;  4NDC A;  4N5X A;  1TRF A;  2PRU A;  2JNX A;  2KYC A;  4OCI A;  4YGE B;  2K2A A;  4MSP A;  1RJV A;  3CR2 A;  4PE0 A;  1TTX A;  5I2O A;  2KHN A;  2BCX A;  4YGC B;  2LE9 B;  1SY9 A;  1F70 A;  2G9B A;  1WDC C;  4GNK B;  3EKJ A;  2M0R A;  5ER5 A;  1C07 A;  2L0P A;  4I5L B;  3DVM A;  2JU0 A;  1JFK A;  3CR5 X;  5AAN A;  1H8B A;  3GK4 X;  2L51 A;  4NDD A;  2Q4U A;  1JBA A;  2LP2 A;  1BG1 A;  1W7I B;  1CDM A;  2F3Z A;  1CLM A;  2OTG B;  1KWO B;  3KO0 A;  1QAT A;  5HYD A;  1DVI A;  1A29 A;  1SNL A;  2LMV A;  1NYA A;  1CFF A;  1JFJ A;  1SL8 A;  2ZFD A;  3BOW B;  1V1F A;  3E3R A;  1XFV O;  3O78 A;  2F2O A;  1FBV A;  1B4C A;  2EHB A;  2H2K A;  1YX8 A;  1MF8 B;  1PAL A;  2PSR A;  2GV5 A;  3GK1 A;  1RWY A;  3IQO A;  4YGA A;  4BY5 A;  3CTN A;  1OZS A;  3TS5 C;  4PE1 A;  1Y1X A;  1K94 A;  2CNP A;  1UUR A;  1DJG A;  4M2P A;  1KFU L;  2MLE C;  3WHT B;  2LVK A;  5DKR A;  2KBI A;  3RLZ A;  3EK4 A;  3I5G B;  1HT9 A;  3JTD B;  5F6T A;  2K0J A;  1OOJ A;  1S26 D;  2M7N A;  1A75 A;  3EVU A;  3KHE A;  4PDZ A;  2KGB C;  2MBX A;  1A75 B;  2F2P A;  5PAL A;  1WLZ A;  4CID A;  2M1K B;  1FI5 A;  4I5K A;  3AAJ A;  4HRH A;  1MUX A;  1XYD A;  2F3Y A;  2JWW A;  3K21 A;  3SG6 A;  2JT3 A;  4GUK A;  4MZJ A;  4OVN F;  2WOS A;  2M7L A;  1GGZ A;  4PHJ A;  3PFV A;  1YRT B;  2MLF C;  1JF0 A;  1ZFS A;  3KF9 A;  1N65 A;  2JNF A;  4I5J A;  4QJ5 B;  4GPL B;  1KQM C;  2FOT A;  3SG2 A;  1K9U A;  3AAK A;  1IQ3 A;  2JPT A;  2KQY A;  3CLN A;  3SG5 A;  3TUY B;  4UPG A;  1K9P A;  2F33 A;  4NQG A;  2LVI A;  4YRU A;  1K2H A;  1TIZ A;  3BQ3 A;  2K61 A;  5AFP A;  1PK0 D;  2O60 A;  1S6I A;  3A4U B;  2KAY A;  2JT0 A;  2H61 C;  3NSI A;  2LUX A;  1SKT A;  5ER4 X;  5K89 A;  4GAO A;  5DKN A;  2WCE A;  4I5N B;  2CXJ A;  1MHO A;  5FYX A;  2BKI B;  2PAL A;  2FCE A;  3PAT A;  4HSZ A;  1AVS A;  1XFZ O;  1QX2 A;  1K90 D;  1SR6 C;  5KSZ A;  1KK8 C;  2L98 A;  3BUM B;  2CCM A;  1KQV A;  1UHH A;  3DVE A;  1CB1 A;  1DJI A;  2NLN A;  1XO5 A;  2OS8 B;  3JVT C;  4ORC B;  3FWC A;  1QX5 B;  1R2U A;  1NX3 A;  1IQ5 A;  1W7J B;  2L5X B;  1XFY O;  3C1V A;  1LA3 A;  3O4Y A;  5CSF A;  5D69 A;  4AQJ A;  3LK0 A;  4L9M A;  1QV1 A;  3BUX B;  3I5F C;  1WRZ A;  2BL0 C;  4MVF A;  1YTZ C;  2E30 A;  1BU3 A;  3WXA A;  1SCM C;  3DVJ A;  4QJ4 B;  1WRL A;  4Q04 A;  4R1E A;  1DJH A;  1LXF C;  4U8D A;  2H61 A;  2KFF A;  1A03 A;  1B7T Y;  4YI8 A;  3VRP A;  5JJG A;  2L2E A;  3PSR A;  2L4I A;  5I8N A;  4GGF C;  4ZCU A;  1XA5 A;  3AKA A;  3PAL A;  4PHN A;  1BOC A;  3I5I B;  4YGB B;  1ALV A;  2ZNE A;  4N1F A;  1CMF A;  3SG3 A;  1GGW A;  1DTL A;  1KWO C;  1KK7 Y;  1ZAC A;  1ZMZ A;  2LC5 A;  2LHL A;  1OMR A;  2JUL A;  1NPQ A;  2Y1M A;  1RTP 1;  2Q91 A;  1J7Q A;  1PUL A;  2SAS A;  1QLK A;  2ZKM X;  2BE4 A;  4A4C A;  5HKY A;  3NSK A;  1F55 A;  2WCB A;  3MSE B;  4XJK A;  4BY4 A;  1BR4 B;  1L2O B;  3FS7 A;  4CLN A;  1DF0 A;  3NXA A;  1JUO A;  3VGO A;  1DF0 B;  1ZOT B;  3TDI A;  2K7O A;  2P6B B;  5KU1 A;  3GOF A;  3EVR A;  2OPO A;  3GK2 A;  4OKH A;  3WHU B;  2MRD A;  1M39 A;  2GGZ A;  1E8A A;  3SG4 A;  2TN4 A;  2KNE A;  5CSI A;  4FQO A;  1B8R A;  2M8U A;  1CKK A;  3I5H B;  1S36 A;  2NCP A;  2LAN A;  1NCX A;  2LVJ A;  3NSL A;  4MRX A;  2LVV A;  1LIN A;  2HET A;  4DUQ A;  1UUS A;  1DJW A;  1HQV A;  2K2F A;  2K7B A;  3ZNI A;  2NXQ A;  1CFP A;  1BOD A;  1CLB A;  5G08 A;  1K9K A;  3EVV A;  1CDL A;  2KFH A;  2LNK A;  3EKH A;  1G33 A;  3CWG A;  1QXP A;  2KGR A;  4DRW A;  4TNC A;  1WDC B;  1YUR A;  2CT9 A;  1YVH A;  2JTT A;  3OX6 A;  1GJY A;  5TNC A;  2EC6 C;  4ICB A;  1QIW A;  1QIV A;  2BCA A;  1A2X A;  1Y1A A;  2E6W A;  4P5O E;  1NWD A;  1QVI Z;  2JRF A;  1KCY A;  3TDU A;  1QLS A;  1WRK A;  1V1G A;  4A4B A;  1IKU A;  1EG4 A;  1YVL A;  1CMG A;  4PHK A;  2R2I A;  1CTR A;  3VRN A;  1M45 A;  4P2Y B;  3SIB A;  1XFX O;  1J1E A;  3VRR A;  1TNW A;  1DMO A;  1KSM A;  1OE9 B;  2LAP A;  3DF0 A;  2PVB A;  1S1E A;  1IH0 A;  1FW4 A;  3PN7 C;  1OMV A;  2MJW B;  1TNP A;  3LCP C;  3O2P A;  3LL8 B;  3KEV A;  3TS5 B;  2CTN A;  1ALW A;  1B9A A;  2B1U A;  1YUU A;  1OSA A;  1KFU S;  1NX2 A;  2LLU A;  1OQP A;  3HX4 A;  3F45 A;  3CR4 X;  1CM4 A;  2K7D A;  1IWQ A;  4DCK A;  1KSO A;  2MA2 A;  3M0W A;  2LV7 A;  2LM5 A;  2JXC A;  1PVA A;  2HPS A;  1K8U A;  3WNX B;  1Y1U A;  1NX1 A;  2QAC A;  4XYN A;  1QX7 A;  1S5G Z;  1EJ3 A;  3SG7 A;  1F54 A;  1XK4 C;  3CS1 A;  1LVC D;  1N2D A;  2WND A;  1LA0 A;  2JQ6 A;  1YUS A;  1JSA A;  4ORA B;  1SL9 A;  3BXK A;  5CSJ A;  2KAV A;  1RK9 A;  1BLQ A;  3ICB A;  2D8N A;  3EK8 A;  2ISD A;  5J3X A;  2L4H A;  2KI4 B;  1KFX L;  1SK6 D;  1SBJ A;  4GFT A;  1TN4 A;  3PM8 A;  1F4Q A;  1S3P A;  2BEC A;  1VRK A;  4N1G A;  3DD4 A;  4OV2 A;  4AOM A;  1QAS A;  2LMT A;  3D0Y A;  2PMY A;  2LLT A;  2KBM A;  2ZRS A;  2BBM A;  1GQM A;  4MBE A;  1UHJ A;  2KDH A;  2LCP A;  2JTZ A;  2JC2 A;  2AMI A;  1XFW O;  2ZN9 A;  4MZK A;  1TCF A;  1CDP A;  2NZ0 A;  1AP4 A;  1CFC A;  2BE6 A;  1SL7 A;  5AXI A;  1IG5 A;  1RRO A;  3CGA A;  4GGN A;  3A8R A;  4USL A;  4MEW A;  1JC2 A;  1J55 A;  2HQW A;  2VRG A;  1K93 D;  1SR6 B;  1BF5 A;  1KK8 B;  2F8P A;  5AEQ A;  1TOP A;  1UHI A;  5I2Q A;  2GGM A;  2OTG C;  4MN0 A;  3VRQ A;  4C0L A;  1PVB A;  3JVT B;  1FI6 A;  2IS9 A;  1NUB A;  2BCB A;  5JOL A;  2LHI A;  4MRY A;  4XJK B;  1Q80 A;  2LUC A;  4F0Z B;  2WCF A;  4JPZ B;  2LP3 A;  4ORB B;  1B47 A;  1SYM A;  2BL0 B;  1RFJ A;  4FTG A;  2FJU B;  2BKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...