2JT3A

Solution structure of f153w cardiac troponin c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
161
Chain Sequence
b'MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEWLEFMKGVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A02
2R2IA 5K89A 3SJSA 2KOTA 2KI4C 1DJYA 2LNKA 3RLZA 1AJ5A 2HQWA 4NQGA 2BCXA 1CLLA 5AEQA 1QX7A 3VRPA 5KTYA 1DJHA 1NCXA 1V1FA 1R2UA 2RGIA 1UURA 2EC6C 1KFXS 4DCKA 2JTTA 3DVMA 1MUXA 4YGAA 2H2KA 3NSKA 1WLMA 3SG6A 1YVLA 1KSOA 1QJTA 3EKHA 4I5KA 3EK8A 4QJ3B 1TNXA 1F55A 1XK4C 2PVBA 1TCOB 1SCMB 1AUIB 2LCPA 1SR6C 2V53A 1XFZO 2KSPA 3PATA 4AQJA 5B8IB 1H4BA 1RROA 1S36A 2KAYA 3NXAA 3PM8A 3EK7A 5CPVA 1C7VA 1KQVA 5AFPA 4Q04A 3WNXB 2F2PA 2I7AA 2K7DA 3NSOA 1NCYA 3H4SE 4MN0A 2LM5A 2PRUA 2NLNA 1AHRA 1Q80A 3JVTB 2KFHA 3C1VA 3LL8B 1YX7A 1U5IA 5G08A 1ZACA 1JFJA 1A29A 2L0PA 1FPWA 3GK2A 3GK1A 1XFWO 1K95A 3OHMB 2M29A 1WRKA 3WHUB 5CSIA 4C0LA 2LP2A 1S3PA 2AAOA 1CKKA 1S5GZ 3SG3A 3HX4A 1XA5A 3EK4A 4NDCA 1N0YA 4XYNA 2A4JA 4CLNA 1YX8A 1CB1A 1IH0A 2KQ6A 5ER4X 5FYXA 1BOCA 1SY9A 1M46A 1KQMB 2BL0B 1BR1B 1UUSA 2LLTA 1K9PA 2Q4UA 1YTZC 3BOWB 3OP0A 1QATA 2WCEA 4NDBA 3EKJA 3CS1A 1SNLA 3VRRA 4C0KA 4GGFC 2BE6A 1GGWA 1DMOA 1S6JA 4BY5A 1PVBA 3PALA 1L2OC 1ZOTB 1JBAA 1GQMA 3TS5B 1K93D 1ZMZA 5D7FA 1NIWA 1SCMC 1SCVA 4TNCA 4BY4A 4QJ4B 2LE9B 2Y4QA 5GQQC 1YURA 1VRKA 2PASA 2F8PA 2OS8C 2BCBA 3PSRA 2CXJA 2KYFA 1J55A 2H61A 2LMVA 1QS7A 2JC2A 2MAZA 2WC8A 3M0WA 2M3WA 3CZTX 1QVIY 1G8IA 2FJUB 3TDIA 1SW8A 1JC2A 3JVTC 3KPXA 3D0YB 1DT7B 2L98A 3BUOB 5CSJA 1KFUL 5DKNA 2BKIB 1CMGA 2LMTA 1WY9A 1RFJA 1WDCB 1WRLA 1XFVO 4YI8A 1EH2A 2L51A 3AAKA 1NYAA 1SR6B 2LLUA 3CR5X 1KK8B 4I5JA 1UHIA 2CBLA 3ZWHA 3HCMA 4WRIA 2K2AA 4GPLB 1SMGA 4M2OA 1RK9A 2BL0C 2COLB 4GNKB 3EVVA 1QX5B 2F3YA 1DVIA 3IQQA 5IBWA 1BF5A 1NSHA 4XJKB 1K8UA 4MBEA 1SBJA 2KAXA 3DVJA 2ZKMX 1A75B 5HKWA 4M2PA 4I5NB 1A2XA 1OMVA 1SL8A 4MRXA 1DJGA 5J3XA 2EHBA 4PALA 5I8NA 1YVHA 3FWCA 5F6TA 1PSBA 1DJZA 1DTLA 2AMIA 4MZKA 2OTGC 3EVRA 1IRJA 3I5GB 4MVFA 1KK7Y 3TUYB 2LV7A 1MR8A 2LHIA 1MQ1A 1RECA 2JULA 3LK0A 2BKHB 3BUXB 4IL1A 3BQ3A 1B8RA 4JPZB 4OKHA 1N65A 2GGZA 1LKJA 3FIAA 1ALWA 3BUNB 2LMUA 1RWYA 1UHHA 1QV1A 1BU3A 1QIWA 1CM1A 2CTNA 4OV2A 5HKZA 1Y1AA 2K7CA 1NPQA 1L2OB 2G2BA 3A4UB 1M63B 4ZCVA 5BPJA 2LVKA 5I2QA 1CLMA 4P5OE 3SG5A 1WDCC 4C0JA 2KAVA 1Y6WA 1FF1A 1KK8C 1QV0A 1CDMA 1DJXA 4HRGA 2OS8B 2MLEC 2JTZA 2ZNDA 1MHOA 2ZN8A 3KF9A 1IGVA 1H8BA 2I94A 1M39A 3ICBA 2FCDA 1TNWA 2G9BA 1PALA 1XFUO 1L7ZA 3TZ1A 1B9AA 1OZSA 3DF0B 5HLVA 2BCAA 2LUCA 3BXKA 4DS7A 1J7OA 1J1EA 3IF7A 1NUBA 1UHKA 3PN7B 3FS7A 3NSIA 3OB1B 1AJ4A 1KCYA 3PLFB 2KGRA 2M0RA 1NWDA 1BT6A 1IWQA 2D8NA 1FW4A 2JNFA 4JQ0D 1NX1A 3I5GC 3AKAA 2M1UA 3BOWA 3TUYC 1S6CA 1R6PA 2L50A 2L4IA 3WXAA 2B1UA 2JQ6A 3I5HB 4HRHA 2K7BA 1CFFA 1UP5A 1EG3A 1K90D 4YGCB 2DOQA 1OMRA 2AUCA 1Y1XA 2KHNA 1ZUZA 1TN4A 3BYAA 4USLA 2F2OA 1RJVA 2KQYA 2JWWA 2Y1MA 4MZLA 1BJFA 4DUQA 2HF5A 2I18A 2OTGB 1RTP1 5DKQA 3O78A 5AANA 1DF0A 1KWOC 2I2RE 1NX0A 3SG4A 5KSZA 1MXEA 1B8CA 1G33A 3AKBA 1YUSA 1KSMA 1TIZA 2ZNEA 2NCPA 1B7TY 4L9MA 4D1EA 1IJ5A 2FCEA 5AERA 1IQ5A 1F4OA 1KFXL 2BECA 4FTGA 2JOJA 1QASA 4MZJA 4PDZA 1LVCD 1ALVA 4PE1A 3RM1A 5JOLA 1ODBA 1QXPA 1SL7A 1OSAA 1XK4A 1FBVA 1SRAA 2PSRA 2E6WA 2IS9A 2JXCA 1BLQA 2KDHA 3PN7C 4PHJA 5D69A 2LVVA 2BBNA 4QJ5B 3CTNA 2PMYA 3WHTB 4YBHB 4ICBA 4DIRA 2Y1NA 1AK8A 1F8HA 2OPOA 1M31A 3JTDC 4N1FA 1F54A 1A75A 2BE4A 3I5HC 2CNPA 2GGMA 4OCIA 2MLFC 1XVJA 2QACA 3CWGA 4PCWA 3CLNA 1DJWA 2NXQA 2F33A 1YR5A 1CDPA 1J1DA 2M1KB 2WNDA 2ZFDA 3KHEA 3I5FB 4CIDA 4DRWA 4N5XA 1OOJA 1HQVA 1M45A 3D10A 1J7QA 4GGNA 1C7WA 3O4YA 3OX5A 2HETA 2Q91A 1MWNA 4MSPA 2ZRTA 4OR9B 1MXLC 3DVKA 3GK4X 4I5LB 1SL9A 1AVSA 4YGDB 4OVNF 1OE9B 2KNEA 2O5GA 2LLSA 3VRQA 1ZFSA 1D1OA 1QIVA 1S5GY 1JUOA 4GGFA 2KBIA 4YGBB 5HKYA 2TN4A 4FQOA 4PHKA 3O6BA 5ER5A 3SG2A 4GBAA 1CLBA 2JZIA 1QVIZ 1CFPA 3LK1A 4CPVA 1DGUA 1PSRA 3K21A 3O2PA 2L2EA 1NCZA 1IKUA 1BODA 1PULA 1QLSA 3KO0A 4A4CA 1PK0D 1KWOB 4YI9A 4E68A 1K2HA 2MJWB 3I5IC 3MSEB 3OX6A 2LANA 2L4HA 1N2DA 2KFGA 1CDNA 1IJ6A 1DGVA 1JSAA 3BUMB 4AQIA 4YRUA 1YRTB 1OZOA 2LHLA 2WOSA 1UHNA 2H61C 1J7RA 3DF0A 1CM4A 2K2FA 5CSNA 1MF8B 2M97A 2KYCA 2L5XB 3VROA 1KFUS 1EJ3A 3KEVA 1QLKA 2SCPA 3AAJA 5TNCA 1X02A 3PFVA 2KI6C 4ORAB 1S1EA 3I5FC 5DKRA 1PVAA 4F0ZB 1OQPA 1W7JB 2WCFA 1WRZA 3EVUA 1K9KA 1LA3A 1EL4A 4ZCUA 2MBXA 2BBMA 3F45A 3LLEA 2JT0A 2ZN9A 1K9UA 1NX3A 2LP3A 4CFQA 1NP8A 2M49B 5CSFA 3DVEA 1W7IB 5KU1A 2LC5A 3QRXA 3JTDB 4HSZA 1YRUB 3SIAA 1KK7Z 2KBMA 2KGBC 3FWBA 4MEWA 2CCMA 4MRYA 1CFCA 1K94A 1S26D 2KFFA 2SASA 3A8RA 3CR2A 4GFTA 5PALA 2M7NA 1U5IB 3DD4A 2F3ZA 2GV5A 1TOPA 4PHMA 1V1GA 3OB2B 2LUXA 1YUUA 2NZ0A 1JWDA 1JF0A 3NSLA 1B8LA 4UPGA 2VRGA 2E30A 1B47A 4MLWA 3SG7A 2P6BB 4HREE 1SPYA 1TNPA 4U8DA 1A4PA 3CGAA 1E8AA 1QTXA 4M2QA 2JXLA 3D0YA 1BG1A 1BMOA 1S6IA 2ZRSA 1YUTA 2WORA 1TTXA 1EG4A 1A03A 1LA0A 3ZNIA 4WQ3A 2ISDA 1GGZA 1BR4B 2M9GA 1LXFC 3VRNA 1IQ3A 1IG5A 2JT8A 2JU0A 2LVIA 1SKTA 2K8MB 2NCOA 1XFXO 4PE0A 1FI6A 1TCFA 2JRFA 1GJYA 5HLOA 1XFYO 2KI4B 2QPTA 5I2LA 3BUWB 4YGEB 2EGDA 4AOMA 1DF0B 4R1EA 1Y0VH 1JF2A 2Y5IA 3I5IB 1CFDA 2LAPA 4NDDA 4N1GA 4PHNA 4XJKA 3E3RA 2EC6B 4WQ2A 2MA2A 1F4QA 2JT3A 2PALA 4A4BA 1SK6D 5JJGA 1TRFA 3VGOA 3GOFA 2K61A 1UWOA 2JPTA 3CR4X 1C07A 2HPSA 1TNQA 4JWQA 1NX2A 1QX2A 1JFKA 4PE4A 2K7OA 2LVJA 1SYMA 2CT9A 1HT9A 2K0JA 1J7PA 1EXRA 3TDZA 2M7LA 1AP4A 1DJIA 1B4CA 1KQMC 2MHHA 5HYDA 2JNXA 2O60A 5I2OA 1XYDA 1OMDA 1PRWA 4P2YB 1G4YR 1WLZA 1XO5A 2FOTA 1Y1UA 2M8UA 4GAOA 4CFRA 5AXIA 4GUKA 1FI5A 2KI6D 2WCBA 4ORCB 4ETOA 3LCPC 1UHJA 3IQOA 1CTRA 2MRDA 4ORBB 1B7TZ 1CDLA 1F70A 3TDUA 1CNPA 1B1GA 4PE7A 3TS5C 1F71A 1K96A 2HQ8A 3SIBA 1LINA 1CMFA
chains in the Genus database with same CATH superfamily
2R2IA 5K89A 3SJSA 5HL1A 2KOTA 2KI4C 1DJYA 2LNKA 3RLZA 1AJ5A 2HQWA 4NQGA 2BCXA 1CLLA 5AEQA 1QX7A 3VRPA 5KTYA 1DJHA 1NCXA 1V1FA 1R2UA 2RGIA 1UURA 2EC6C 1KFXS 4DCKA 2JTTA 1W9ZA 3DVMA 1MUXA 4YGAA 2H2KA 3NSKA 1DEKA 3OGNA 1WLMA 3SG6A 1YVLA 3D78A 1KSOA 1QJTA 3EKHA 4I5KA 2BAPA 3EK8A 4QJ3B 1TNXA 1F55A 1XK4C 2PVBA 3L47A 1TCOB 1SCMB 1AUIB 2LCPA 1SR6C 2V53A 1XFZO 2KSPA 3PATA 4AQJA 5B8IB 1H4BA 1RROA 1S36A 2KAYA 3NXAA 3PM8A 3EK7A 5CPVA 1C7VA 1KQVA 5AFPA 4Q04A 3WNXB 2F2PA 2I7AA 2K7DA 3L4LA 3NSOA 1NCYA 3H4SE 1OOFA 4MN0A 2LM5A 2PRUA 2NLNA 1AHRA 1Q80A 3JVTB 2KFHA 3C1VA 3LL8B 1YX7A 1U5IA 5G08A 1P28A 1ZACA 1JFJA 1A29A 2L0PA 1QWVA 1FPWA 4JD9A 3GK2A 3GK1A 1XFWO 1K95A 3OHMB 2M29A 1WRKA 3WHUB 5CSIA 4C0LA 2LP2A 1S3PA 2AAOA 3PM2A 1CKKA 1S5GZ 3SG3A 3HX4A 1TUZA 1XA5A 3EK4A 4NDCA 1N0YA 4XYNA 3CDNA 2A4JA 4CLNA 1YX8A 1CB1A 1IH0A 2KQ6A 5ER4X 5FYXA 1BOCA 1SY9A 1M46A 1KQMB 1BR1B 1UUSA 2BL0B 2LLTA 3R1VA 1K9PA 2Q4UA 1YTZC 2YGUA 3BOWB 3OP0A 1QATA 2WCEA 4NDBA 2L5YA 3EKJA 3CS1A 1SNLA 3D73A 3VRRA 4C0KA 4GGFC 2BE6A 1GGWA 1DMOA 1S6JA 4BY5A 1PVBA 3PALA 1L2OC 1ZOTB 3DZTA 1SSEB 1JBAA 1GQMA 3TS5B 1K93D 1ZMZA 3QMEA 1NIWA 5D7FA 1SCMC 1SCVA 4TNCA 4BY4A 4QJ4B 2LE9B 2Y4QA 5GQQC 1YURA 1VRKA 2PASA 2F8PA 2OS8C 2BCBA 3PSRA 2CXJA 2KYFA 2KLDA 1J55A 2PYQA 3R72A 3SS4A 2H61A 2LMVA 1QS7A 2JC2A 2MAZA 2WC8A 3M0WA 2M3WA 2GTEA 1QVIY 1G8IA 2FJUB 3CZTX 1SW8A 3TDIA 3JVTC 1JC2A 3KPXA 3D0YB 1DT7B 2L98A 3BUOB 5CSJA 1KFUL 5DKNA 2BKIB 3S0GA 1CMGA 3RZSA 2LMTA 3OBVA 3CABA 1WY9A 1RFJA 1WDCB 1WRLA 1XFVO 4YI8A 1EH2A 2L51A 3AAKA 1NYAA 1SR6B 2LLUA 2WCHA 1KK8B 3CR5X 4I5JA 3SS3A 1UHIA 2CBLA 3ZWHA 3HCMA 3UNWA 4WRIA 2K2AA 4GPLB 1SMGA 4M2OA 1RK9A 2BL0C 2COLB 4GNKB 3EVVA 5DICA 1QX5B 2F3YA 1DVIA 3IQQA 5IBWA 1BF5A 1NSHA 1DQEA 4XJKB 1K8UA 4MBEA 3D77A 1SBJA 2KAXA 2QDIA 3DVJA 2ZKMX 1A75B 5HKWA 4M2PA 4I5NB 1A2XA 1OMVA 1SL8A 1DC1A 4MRXA 1DJGA 5J3XA 2EHBA 4PALA 3NHTA 5I8NA 3L4AA 1YVHA 3FWCA 5F6TA 3PJIA 1PSBA 1DJZA 1DTLA 2AMIA 4MZKA 2OTGC 3EVRA 1IRJA 3I5GB 4MVFA 1KK7Y 1OOHA 3CZ0A 3FE6A 3S0BA 3TUYB 2LV7A 1MR8A 2LHIA 1MQ1A 1RECA 2JULA 1Z2CB 2BKHB 3BUXB 3LK0A 3BQ3A 4IL1A 1B8RA 4JPZB 2QEHA 3VB1A 4OKHA 1N65A 2P70A 2GGZA 1LKJA 3FIAA 2K60A 3S0EA 1ALWA 3BUNB 2LMUA 1RWYA 1UHHA 1QV1A 3B7AA 3BFBA 1BU3A 1QIWA 1CM1A 2CTNA 4OV2A 5HKZA 1Y1AA 2K7CA 1NPQA 1L2OB 2G2BA 3A4UB 1M63B 3IVTA 4ZCVA 5BPJA 2LVKA 5I2QA 1CLMA 4P5OE 2JPOA 3SG5A 1WDCC 4C0JA 2KAVA 1Y6WA 1FF1A 1KK8C 1QV0A 1CDMA 1DJXA 4HRGA 2OS8B 2MLEC 2JTZA 2ZNDA 1MHOA 2ZN8A 3KF9A 1IGVA 1H8BA 2I94A 3R1OA 1M39A 5FI6A 3ICBA 2FCDA 1TNWA 2G9BA 1PALA 1XFUO 1GM0A 1L7ZA 3TZ1A 1C3ZA 1B9AA 1OZSA 3DF0B 5HLVA 2BCAA 3CYZA 2LUCA 3BXKA 4DS7A 1J7OA 1J1EA 3IF7A 1NUBA 1UHKA 3PN7B 3FS7A 3NSIA 3OB1B 1AJ4A 1KCYA 3PLFB 2KGRA 2M0RA 1NWDA 1BT6A 1IWQA 2D8NA 1FW4A 2JNFA 4JQ0D 2WC6A 1NX1A 3I5GC 3AKAA 1T14A 2M1UA 3BOWA 4JKTA 3TUYC 3R1PA 3DYEA 1S6CA 1R6PA 2L50A 2L4IA 3WXAA 2B1UA 2JQ6A 3I5HB 4HRHA 2K7BA 1CFFA 1UP5A 1EG3A 1K90D 2BNXA 4YGCB 2DOQA 1OMRA 2AUCA 1Y1XA 2KHNA 1ZUZA 1TN4A 3BYAA 4USLA 3RM1A 2F2OA 3D74A 3NGVA 1RJVA 2KQYA 2JWWA 2Y1MA 4MZLA 1BJFA 4DUQA 2HF5A 2I18A 2OTGB 1RTP1 5DKQA 3O78A 5AANA 1DF0A 1KWOC 2I2RE 3CZ2A 1NX0A 3SG4A 5KSZA 1MXEA 1B8CA 1G33A 3AKBA 1YUSA 1KSMA 1TIZA 2ZNEA 2KPHA 2NCPA 1B7TY 4L9MA 4D1EA 1IJ5A 2FCEA 1ORGA 5AERA 1IQ5A 1F4OA 1KFXL 2BECA 3BFHA 2JOJA 1QASA 4FTGA 4MZJA 1LVCD 1ALVA 4PDZA 4PE1A 5JOLA 1ODBA 1OOIX 1QXPA 1OSAA 1SL7A 1XK4A 1FBVA 1SRAA 2PSRA 2E6WA 2IS9A 2JXCA 1BLQA 2KDHA 3PN7C 4PHJA 5D69A 2LVVA 2BBNA 4QJ5B 3CTNA 2PMYA 3DXLA 3WHTB 4YBHB 2L2CA 4ICBA 4DIRA 4INXA 2Y1NA 3FE9A 1AK8A 1F8HA 2OPOA 1M31A 2QEOA 3JTDC 4N1FA 5EL2A 1F54A 1A75A 3DY9A 2BE4A 3I5HC 2CNPA 2GGMA 4OCIA 2MLFC 1XVJA 2QACA 3CWGA 4PCWA 3CLNA 1DJWA 2NXQA 2F33A 1YR5A 1CDPA 1J1DA 2M1KB 2WC5A 2WNDA 2ZFDA 3I5FB 3KHEA 4CIDA 4DRWA 3K1EA 3NHIA 1OOJA 4N5XA 1HQVA 1M45A 3D10A 1J7QA 1C3YA 4GGNA 1C7WA 3O4YA 3OX5A 2HETA 2Q91A 1MWNA 4MSPA 2ZRTA 4OR9B 1MXLC 3DVKA 3GK4X 4I5LB 1SL9A 1AVSA 4YGDB 2QEVA 4OVNF 1OE9B 2KNEA 2O5GA 3S0DA 2LLSA 3VRQA 3BJHA 1ZFSA 3FE8A 1D1OA 1QIVA 1S5GY 1JUOA 4GGFA 2KBIA 2WCJA 4YGBB 5HKYA 1IIOA 2TN4A 4FQOA 4PHKA 3O6BA 5ER5A 3SG2A 3SS5A 4GBAA 1CLBA 2JZIA 1QVIZ 1CFPA 3LK1A 4CPVA 1DGUA 1PSRA 3K21A 3O2PA 2L2EA 1NCZA 1IKUA 1BODA 1PULA 1QLSA 3KO0A 4A4CA 1PK0D 1KWOB 4YI9A 4E68A 1K2HA 2MJWB 3I5IC 3MSEB 3OX6A 2LANA 2L4HA 3D76A 1N2DA 2KFGA 5FI7A 1CDNA 1IJ6A 1DGVA 1JSAA 3BUMB 4AQIA 4YRUA 1YRTB 1OZOA 2LHLA 2P71A 1UHNA 2H61C 1J7RA 2WOSA 3B88A 3DF0A 1CM4A 2K2FA 5CSNA 1MF8B 2M97A 2KYCA 2L5XB 3VROA 1KFUS 1EJ3A 3KEVA 1QLKA 2SCPA 3AAJA 5TNCA 1X02A 3PFVA 2KI6C 4ORAB 1S1EA 3I5FC 5DKRA 1PVAA 4F0ZB 1OQPA 1W7JB 2WCFA 1WRZA 3EVUA 1K9KA 1LA3A 1EL4A 4ZCUA 2MBXA 2BBMA 3F45A 3B87A 2JT0A 3LLEA 2ZN9A 1K9UA 1NX3A 2LP3A 4CFQA 1NP8A 2M49B 5CSFA 3DVEA 1W7IB 2H8VA 5KU1A 5I94A 2LC5A 3QRXA 3JTDB 4PT1A 1DELA 4HSZA 1YRUB 3SIAA 1KK7Z 2KBMA 2KGBC 3FWBA 4KYNA 2CCMA 4MEWA 3O4XA 4MRYA 1CFCA 1K94A 1S26D 2KFFA 2SASA 3A8RA 3CR2A 4GFTA 5FI2A 2KLEA 2M7NA 2WCKA 1U5IB 3DD4A 5PALA 2F3ZA 2GV5A 1TOPA 3CZ1A 4PHMA 3BFAA 1V1GA 3OB2B 2LUXA 1YUUA 2NZ0A 1JWDA 1JF0A 3NSLA 4INWA 1B8LA 4UPGA 2VRGA 2E30A 1B47A 4MLWA 3SG7A 2P6BB 4HREE 1SPYA 1TNPA 4U8DA 1A4PA 3CGAA 1E8AA 1QTXA 4M2QA 2JXLA 3D0YA 1BG1A 1BMOA 4F7FA 1S6IA 2ZRSA 1YUTA 2WORA 1TTXA 3D75A 1EG4A 1TWOA 1A03A 1LA0A 3ZNIA 3S0AA 4WQ3A 2ISDA 1GGZA 1BR4B 2M9GA 1LXFC 3VRNA 1IQ3A 1IG5A 2JT8A 2JU0A 2LVIA 1SKTA 1XFRA 2K8MB 2NCOA 1XFXO 4PE0A 1FI6A 2WCMA 1TCFA 2JRFA 1GJYA 3UO9A 5HLOA 1XFYO 2KI4B 2QPTA 5I2LA 3BUWB 4YGEB 2EGDA 4AOMA 1OOGA 1DF0B 4R1EA 1Y0VH 1JF2A 2Y5IA 3I5IB 1CFDA 2LAPA 4NDDA 4N1GA 4PHNA 4XJKA 3E3RA 3EG5B 2ERBA 2EC6B 4WQ2A 1OW4A 2MA2A 1F4QA 2WCLA 2JT3A 2PALA 4OZDA 4A4BA 1SK6D 5JJGA 1TRFA 3VGOA 2PQLA 3GOFA 2K61A 1UWOA 2JPTA 3CR4X 1C07A 2HPSA 1TNQA 3B6XA 3N7HA 4JWQA 3V2LA 1NX2A 1QX2A 1JFKA 4PE4A 2K7OA 2LVJA 3Q8IA 1SYMA 4IJ7A 1TUJA 2CT9A 1HT9A 2K0JA 1J7PA 1EXRA 3TDZA 2M7LA 1AP4A 1DJIA 1B4CA 1KQMC 2MHHA 5HYDA 2JNXA 2O60A 5I2OA 1LS8A 1XYDA 1OMDA 1PRWA 4P2YB 1G4YR 1WLZA 1XO5A 2FOTA 1Y1UA 2M8UA 2FJYA 4GAOA 5AXIA 4CFRA 4GUKA 1FI5A 2KI6D 2QEBA 2WCBA 4ORCB 4ETOA 3LCPC 5D3OA 1Z4HA 1UHJA 3IQOA 1CTRA 2MRDA 4ORBB 1B7TZ 1CDLA 1F70A 3TDUA 3B86A 1CNPA 1B1GA 4PE7A 3TS5C 1F71A 1K96A 2HQ8A 4FQTA 3SIBA 1LINA 3S0FA 1CMFA
chains in the Genus database with same CATH topology
2R2IA 5K89A 3SJSA 2KOTA 2KI4C 1DJYA 2LNKA 3RLZA 1AJ5A 2HQWA 4NQGA 2BCXA 1CLLA 5AEQA 1QX7A 3VRPA 5KTYA 1DJHA 1NCXA 1V1FA 1R2UA 2RGIA 1UURA 2EC6C 1KFXS 4DCKA 2JTTA 3DVMA 1MUXA 4YGAA 2H2KA 3NSKA 1WLMA 3SG6A 1YVLA 1KSOA 1QJTA 3EKHA 4I5KA 3EK8A 4QJ3B 1TNXA 1F55A 1XK4C 2PVBA 1TCOB 1SCMB 1AUIB 2LCPA 1SR6C 2V53A 1XFZO 2KSPA 3PATA 4AQJA 5B8IB 1H4BA 1RROA 1S36A 2KAYA 3NXAA 3PM8A 3EK7A 5CPVA 1C7VA 1KQVA 5AFPA 4Q04A 3WNXB 2F2PA 2I7AA 2K7DA 3NSOA 1NCYA 3H4SE 4MN0A 2LM5A 2PRUA 2NLNA 1AHRA 1Q80A 3JVTB 2KFHA 3C1VA 3LL8B 1YX7A 1U5IA 5G08A 1ZACA 1JFJA 1A29A 2L0PA 1FPWA 3GK2A 3GK1A 1XFWO 1K95A 3OHMB 2M29A 1WRKA 3WHUB 5CSIA 4C0LA 2LP2A 1S3PA 2AAOA 1CKKA 1S5GZ 3SG3A 3HX4A 1XA5A 3EK4A 4NDCA 1N0YA 4XYNA 2A4JA 4CLNA 1YX8A 1CB1A 1IH0A 2KQ6A 5ER4X 5FYXA 1BOCA 1SY9A 1M46A 1KQMB 2BL0B 1BR1B 1UUSA 2LLTA 1K9PA 2Q4UA 1YTZC 3BOWB 3OP0A 1QATA 2WCEA 4NDBA 3EKJA 3CS1A 1SNLA 3VRRA 4C0KA 4GGFC 2BE6A 1GGWA 1DMOA 1S6JA 4BY5A 1PVBA 3PALA 1L2OC 1ZOTB 1JBAA 1GQMA 3TS5B 1K93D 1ZMZA 5D7FA 1NIWA 1SCMC 1SCVA 4TNCA 4BY4A 4QJ4B 2LE9B 2Y4QA 5GQQC 1YURA 1VRKA 2PASA 2F8PA 2OS8C 2BCBA 3PSRA 2CXJA 2KYFA 1J55A 2H61A 2LMVA 1QS7A 2JC2A 2MAZA 2WC8A 3M0WA 2M3WA 3CZTX 1QVIY 1G8IA 2FJUB 3TDIA 1SW8A 1JC2A 3JVTC 3KPXA 3D0YB 1DT7B 2L98A 3BUOB 5CSJA 1KFUL 5DKNA 2BKIB 1CMGA 2LMTA 1WY9A 1RFJA 1WDCB 1WRLA 1XFVO 4YI8A 1EH2A 2L51A 3AAKA 1NYAA 1SR6B 2LLUA 3CR5X 1KK8B 4I5JA 1UHIA 2CBLA 3ZWHA 3HCMA 4WRIA 2K2AA 4GPLB 1SMGA 4M2OA 1RK9A 2BL0C 2COLB 4GNKB 3EVVA 1QX5B 2F3YA 1DVIA 3IQQA 5IBWA 1BF5A 1NSHA 4XJKB 1K8UA 4MBEA 1SBJA 2KAXA 3DVJA 2ZKMX 1A75B 5HKWA 4M2PA 4I5NB 1A2XA 1OMVA 1SL8A 4MRXA 1DJGA 5J3XA 2EHBA 4PALA 5I8NA 1YVHA 3FWCA 5F6TA 1PSBA 1DJZA 1DTLA 2AMIA 4MZKA 2OTGC 3EVRA 1IRJA 3I5GB 4MVFA 1KK7Y 3TUYB 2LV7A 1MR8A 2LHIA 1MQ1A 1RECA 2JULA 3LK0A 2BKHB 3BUXB 4IL1A 3BQ3A 1B8RA 4JPZB 4OKHA 1N65A 2GGZA 1LKJA 3FIAA 1ALWA 3BUNB 2LMUA 1RWYA 1UHHA 1QV1A 1BU3A 1QIWA 1CM1A 2CTNA 4OV2A 5HKZA 1Y1AA 2K7CA 1NPQA 1L2OB 2G2BA 3A4UB 1M63B 4ZCVA 5BPJA 2LVKA 5I2QA 1CLMA 4P5OE 3SG5A 1WDCC 4C0JA 2KAVA 1Y6WA 1FF1A 1KK8C 1QV0A 1CDMA 1DJXA 4HRGA 2OS8B 2MLEC 2JTZA 2ZNDA 1MHOA 2ZN8A 3KF9A 1IGVA 1H8BA 2I94A 1M39A 3ICBA 2FCDA 1TNWA 2G9BA 1PALA 1XFUO 1L7ZA 3TZ1A 1B9AA 1OZSA 3DF0B 5HLVA 2BCAA 2LUCA 3BXKA 4DS7A 1J7OA 1J1EA 3IF7A 1NUBA 1UHKA 3PN7B 3FS7A 3NSIA 3OB1B 1AJ4A 1KCYA 3PLFB 2KGRA 2M0RA 1NWDA 1BT6A 1IWQA 2D8NA 1FW4A 2JNFA 4JQ0D 1NX1A 3I5GC 3AKAA 2M1UA 3BOWA 3TUYC 1S6CA 1R6PA 2L50A 2L4IA 3WXAA 2B1UA 2JQ6A 3I5HB 4HRHA 2K7BA 1CFFA 1UP5A 1EG3A 1K90D 4YGCB 2DOQA 1OMRA 2AUCA 1Y1XA 2KHNA 1ZUZA 1TN4A 3BYAA 4USLA 2F2OA 1RJVA 2KQYA 2JWWA 2Y1MA 4MZLA 1BJFA 4DUQA 2HF5A 2I18A 2OTGB 1RTP1 5DKQA 3O78A 5AANA 1DF0A 1KWOC 2I2RE 1NX0A 3SG4A 5KSZA 1MXEA 1B8CA 1G33A 3AKBA 1YUSA 1KSMA 1TIZA 2ZNEA 2NCPA 1B7TY 4L9MA 4D1EA 1IJ5A 2FCEA 5AERA 1IQ5A 1F4OA 1KFXL 2BECA 4FTGA 2JOJA 1QASA 4MZJA 4PDZA 1LVCD 1ALVA 4PE1A 3RM1A 5JOLA 1ODBA 1QXPA 1SL7A 1OSAA 1XK4A 1FBVA 1SRAA 2PSRA 2E6WA 2IS9A 2JXCA 1BLQA 2KDHA 3PN7C 4PHJA 5D69A 2LVVA 2BBNA 4QJ5B 3CTNA 2PMYA 3WHTB 4YBHB 4ICBA 4DIRA 2Y1NA 1AK8A 1F8HA 2OPOA 1M31A 3JTDC 4N1FA 1F54A 1A75A 2BE4A 3I5HC 2CNPA 2GGMA 4OCIA 2MLFC 1XVJA 2QACA 3CWGA 4PCWA 3CLNA 1DJWA 2NXQA 2F33A 1YR5A 1CDPA 1J1DA 2M1KB 2WNDA 2ZFDA 3KHEA 3I5FB 4CIDA 4DRWA 4N5XA 1OOJA 1HQVA 1M45A 3D10A 1J7QA 4GGNA 1C7WA 3O4YA 3OX5A 2HETA 2Q91A 1MWNA 4MSPA 2ZRTA 4OR9B 1MXLC 3DVKA 3GK4X 4I5LB 1SL9A 1AVSA 4YGDB 4OVNF 1OE9B 2KNEA 2O5GA 2LLSA 3VRQA 1ZFSA 1D1OA 1QIVA 1S5GY 1JUOA 4GGFA 2KBIA 4YGBB 5HKYA 2TN4A 4FQOA 4PHKA 3O6BA 5ER5A 3SG2A 4GBAA 1CLBA 2JZIA 1QVIZ 1CFPA 3LK1A 4CPVA 1DGUA 1PSRA 3K21A 3O2PA 2L2EA 1NCZA 1IKUA 1BODA 1PULA 1QLSA 3KO0A 4A4CA 1PK0D 1KWOB 4YI9A 4E68A 1K2HA 2MJWB 3I5IC 3MSEB 3OX6A 2LANA 2L4HA 1N2DA 2KFGA 1CDNA 1IJ6A 1DGVA 1JSAA 3BUMB 4AQIA 4YRUA 1YRTB 1OZOA 2LHLA 2WOSA 1UHNA 2H61C 1J7RA 3DF0A 1CM4A 2K2FA 5CSNA 1MF8B 2M97A 2KYCA 2L5XB 3VROA 1KFUS 1EJ3A 3KEVA 1QLKA 2SCPA 3AAJA 5TNCA 1X02A 3PFVA 2KI6C 4ORAB 1S1EA 3I5FC 5DKRA 1PVAA 4F0ZB 1OQPA 1W7JB 2WCFA 1WRZA 3EVUA 1K9KA 1LA3A 1EL4A 4ZCUA 2MBXA 2BBMA 3F45A 3LLEA 2JT0A 2ZN9A 1K9UA 1NX3A 2LP3A 4CFQA 1NP8A 2M49B 5CSFA 3DVEA 1W7IB 5KU1A 2LC5A 3QRXA 3JTDB 4HSZA 1YRUB 3SIAA 1KK7Z 2KBMA 2KGBC 3FWBA 4MEWA 2CCMA 4MRYA 1CFCA 1K94A 1S26D 2KFFA 2SASA 3A8RA 3CR2A 4GFTA 5PALA 2M7NA 1U5IB 3DD4A 2F3ZA 2GV5A 1TOPA 4PHMA 1V1GA 3OB2B 2LUXA 1YUUA 2NZ0A 1JWDA 1JF0A 3NSLA 1B8LA 4UPGA 2VRGA 2E30A 1B47A 4MLWA 3SG7A 2P6BB 4HREE 1SPYA 1TNPA 4U8DA 1A4PA 3CGAA 1E8AA 1QTXA 4M2QA 2JXLA 3D0YA 1BG1A 1BMOA 1S6IA 2ZRSA 1YUTA 2WORA 1TTXA 1EG4A 1A03A 1LA0A 3ZNIA 4WQ3A 2ISDA 1GGZA 1BR4B 2M9GA 1LXFC 3VRNA 1IQ3A 1IG5A 2JT8A 2JU0A 2LVIA 1SKTA 2K8MB 2NCOA 1XFXO 4PE0A 1FI6A 1TCFA 2JRFA 1GJYA 5HLOA 1XFYO 2KI4B 2QPTA 5I2LA 3BUWB 4YGEB 2EGDA 4AOMA 1DF0B 4R1EA 1Y0VH 1JF2A 2Y5IA 3I5IB 1CFDA 2LAPA 4NDDA 4N1GA 4PHNA 4XJKA 3E3RA 2EC6B 4WQ2A 2MA2A 1F4QA 2JT3A 2PALA 4A4BA 1SK6D 5JJGA 1TRFA 3VGOA 3GOFA 2K61A 1UWOA 2JPTA 3CR4X 1C07A 2HPSA 1TNQA 4JWQA 1NX2A 1QX2A 1JFKA 4PE4A 2K7OA 2LVJA 1SYMA 2CT9A 1HT9A 2K0JA 1J7PA 1EXRA 3TDZA 2M7LA 1AP4A 1DJIA 1B4CA 1KQMC 2MHHA 5HYDA 2JNXA 2O60A 5I2OA 1XYDA 1OMDA 1PRWA 4P2YB 1G4YR 1WLZA 1XO5A 2FOTA 1Y1UA 2M8UA 4GAOA 4CFRA 5AXIA 4GUKA 1FI5A 2KI6D 2WCBA 4ORCB 4ETOA 3LCPC 1UHJA 3IQOA 1CTRA 2MRDA 4ORBB 1B7TZ 1CDLA 1F70A 3TDUA 1CNPA 1B1GA 4PE7A 3TS5C 1F71A 1K96A 2HQ8A 3SIBA 1LINA 1CMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2I A;  5K89 A;  3SJS A;  2KOT A;  2KI4 C;  1DJY A;  2LNK A;  3RLZ A;  1AJ5 A;  2HQW A;  4NQG A;  2BCX A;  1CLL A;  5AEQ A;  1QX7 A;  3VRP A;  5KTY A;  1DJH A;  1NCX A;  1V1F A;  1R2U A;  2RGI A;  1UUR A;  2EC6 C;  1KFX S;  4DCK A;  2JTT A;  3DVM A;  1MUX A;  4YGA A;  2H2K A;  3NSK A;  1WLM A;  3SG6 A;  1YVL A;  1KSO A;  1QJT A;  3EKH A;  4I5K A;  3EK8 A;  4QJ3 B;  1TNX A;  1F55 A;  1XK4 C;  2PVB A;  1TCO B;  1SCM B;  1AUI B;  2LCP A;  1SR6 C;  2V53 A;  1XFZ O;  2KSP A;  3PAT A;  4AQJ A;  5B8I B;  1H4B A;  1RRO A;  1S36 A;  2KAY A;  3NXA A;  3PM8 A;  3EK7 A;  5CPV A;  1C7V A;  1KQV A;  5AFP A;  4Q04 A;  3WNX B;  2F2P A;  2I7A A;  2K7D A;  3NSO A;  1NCY A;  3H4S E;  4MN0 A;  2LM5 A;  2PRU A;  2NLN A;  1AHR A;  1Q80 A;  3JVT B;  2KFH A;  3C1V A;  3LL8 B;  1YX7 A;  1U5I A;  5G08 A;  1ZAC A;  1JFJ A;  1A29 A;  2L0P A;  1FPW A;  3GK2 A;  3GK1 A;  1XFW O;  1K95 A;  3OHM B;  2M29 A;  1WRK A;  3WHU B;  5CSI A;  4C0L A;  2LP2 A;  1S3P A;  2AAO A;  1CKK A;  1S5G Z;  3SG3 A;  3HX4 A;  1XA5 A;  3EK4 A;  4NDC A;  1N0Y A;  4XYN A;  2A4J A;  4CLN A;  1YX8 A;  1CB1 A;  1IH0 A;  2KQ6 A;  5ER4 X;  5FYX A;  1BOC A;  1SY9 A;  1M46 A;  1KQM B;  2BL0 B;  1BR1 B;  1UUS A;  2LLT A;  1K9P A;  2Q4U A;  1YTZ C;  3BOW B;  3OP0 A;  1QAT A;  2WCE A;  4NDB A;  3EKJ A;  3CS1 A;  1SNL A;  3VRR A;  4C0K A;  4GGF C;  2BE6 A;  1GGW A;  1DMO A;  1S6J A;  4BY5 A;  1PVB A;  3PAL A;  1L2O C;  1ZOT B;  1JBA A;  1GQM A;  3TS5 B;  1K93 D;  1ZMZ A;  5D7F A;  1NIW A;  1SCM C;  1SCV A;  4TNC A;  4BY4 A;  4QJ4 B;  2LE9 B;  2Y4Q A;  5GQQ C;  1YUR A;  1VRK A;  2PAS A;  2F8P A;  2OS8 C;  2BCB A;  3PSR A;  2CXJ A;  2KYF A;  1J55 A;  2H61 A;  2LMV A;  1QS7 A;  2JC2 A;  2MAZ A;  2WC8 A;  3M0W A;  2M3W A;  3CZT X;  1QVI Y;  1G8I A;  2FJU B;  3TDI A;  1SW8 A;  1JC2 A;  3JVT C;  3KPX A;  3D0Y B;  1DT7 B;  2L98 A;  3BUO B;  5CSJ A;  1KFU L;  5DKN A;  2BKI B;  1CMG A;  2LMT A;  1WY9 A;  1RFJ A;  1WDC B;  1WRL A;  1XFV O;  4YI8 A;  1EH2 A;  2L51 A;  3AAK A;  1NYA A;  1SR6 B;  2LLU A;  3CR5 X;  1KK8 B;  4I5J A;  1UHI A;  2CBL A;  3ZWH A;  3HCM A;  4WRI A;  2K2A A;  4GPL B;  1SMG A;  4M2O A;  1RK9 A;  2BL0 C;  2COL B;  4GNK B;  3EVV A;  1QX5 B;  2F3Y A;  1DVI A;  3IQQ A;  5IBW A;  1BF5 A;  1NSH A;  4XJK B;  1K8U A;  4MBE A;  1SBJ A;  2KAX A;  3DVJ A;  2ZKM X;  1A75 B;  5HKW A;  4M2P A;  4I5N B;  1A2X A;  1OMV A;  1SL8 A;  4MRX A;  1DJG A;  5J3X A;  2EHB A;  4PAL A;  5I8N A;  1YVH A;  3FWC A;  5F6T A;  1PSB A;  1DJZ A;  1DTL A;  2AMI A;  4MZK A;  2OTG C;  3EVR A;  1IRJ A;  3I5G B;  4MVF A;  1KK7 Y;  3TUY B;  2LV7 A;  1MR8 A;  2LHI A;  1MQ1 A;  1REC A;  2JUL A;  3LK0 A;  2BKH B;  3BUX B;  4IL1 A;  3BQ3 A;  1B8R A;  4JPZ B;  4OKH A;  1N65 A;  2GGZ A;  1LKJ A;  3FIA A;  1ALW A;  3BUN B;  2LMU A;  1RWY A;  1UHH A;  1QV1 A;  1BU3 A;  1QIW A;  1CM1 A;  2CTN A;  4OV2 A;  5HKZ A;  1Y1A A;  2K7C A;  1NPQ A;  1L2O B;  2G2B A;  3A4U B;  1M63 B;  4ZCV A;  5BPJ A;  2LVK A;  5I2Q A;  1CLM A;  4P5O E;  3SG5 A;  1WDC C;  4C0J A;  2KAV A;  1Y6W A;  1FF1 A;  1KK8 C;  1QV0 A;  1CDM A;  1DJX A;  4HRG A;  2OS8 B;  2MLE C;  2JTZ A;  2ZND A;  1MHO A;  2ZN8 A;  3KF9 A;  1IGV A;  1H8B A;  2I94 A;  1M39 A;  3ICB A;  2FCD A;  1TNW A;  2G9B A;  1PAL A;  1XFU O;  1L7Z A;  3TZ1 A;  1B9A A;  1OZS A;  3DF0 B;  5HLV A;  2BCA A;  2LUC A;  3BXK A;  4DS7 A;  1J7O A;  1J1E A;  3IF7 A;  1NUB A;  1UHK A;  3PN7 B;  3FS7 A;  3NSI A;  3OB1 B;  1AJ4 A;  1KCY A;  3PLF B;  2KGR A;  2M0R A;  1NWD A;  1BT6 A;  1IWQ A;  2D8N A;  1FW4 A;  2JNF A;  4JQ0 D;  1NX1 A;  3I5G C;  3AKA A;  2M1U A;  3BOW A;  3TUY C;  1S6C A;  1R6P A;  2L50 A;  2L4I A;  3WXA A;  2B1U A;  2JQ6 A;  3I5H B;  4HRH A;  2K7B A;  1CFF A;  1UP5 A;  1EG3 A;  1K90 D;  4YGC B;  2DOQ A;  1OMR A;  2AUC A;  1Y1X A;  2KHN A;  1ZUZ A;  1TN4 A;  3BYA A;  4USL A;  2F2O A;  1RJV A;  2KQY A;  2JWW A;  2Y1M A;  4MZL A;  1BJF A;  4DUQ A;  2HF5 A;  2I18 A;  2OTG B;  1RTP 1;  5DKQ A;  3O78 A;  5AAN A;  1DF0 A;  1KWO C;  2I2R E;  1NX0 A;  3SG4 A;  5KSZ A;  1MXE A;  1B8C A;  1G33 A;  3AKB A;  1YUS A;  1KSM A;  1TIZ A;  2ZNE A;  2NCP A;  1B7T Y;  4L9M A;  4D1E A;  1IJ5 A;  2FCE A;  5AER A;  1IQ5 A;  1F4O A;  1KFX L;  2BEC A;  4FTG A;  2JOJ A;  1QAS A;  4MZJ A;  4PDZ A;  1LVC D;  1ALV A;  4PE1 A;  3RM1 A;  5JOL A;  1ODB A;  1QXP A;  1SL7 A;  1OSA A;  1XK4 A;  1FBV A;  1SRA A;  2PSR A;  2E6W A;  2IS9 A;  2JXC A;  1BLQ A;  2KDH A;  3PN7 C;  4PHJ A;  5D69 A;  2LVV A;  2BBN A;  4QJ5 B;  3CTN A;  2PMY A;  3WHT B;  4YBH B;  4ICB A;  4DIR A;  2Y1N A;  1AK8 A;  1F8H A;  2OPO A;  1M31 A;  3JTD C;  4N1F A;  1F54 A;  1A75 A;  2BE4 A;  3I5H C;  2CNP A;  2GGM A;  4OCI A;  2MLF C;  1XVJ A;  2QAC A;  3CWG A;  4PCW A;  3CLN A;  1DJW A;  2NXQ A;  2F33 A;  1YR5 A;  1CDP A;  1J1D A;  2M1K B;  2WND A;  2ZFD A;  3KHE A;  3I5F B;  4CID A;  4DRW A;  4N5X A;  1OOJ A;  1HQV A;  1M45 A;  3D10 A;  1J7Q A;  4GGN A;  1C7W A;  3O4Y A;  3OX5 A;  2HET A;  2Q91 A;  1MWN A;  4MSP A;  2ZRT A;  4OR9 B;  1MXL C;  3DVK A;  3GK4 X;  4I5L B;  1SL9 A;  1AVS A;  4YGD B;  4OVN F;  1OE9 B;  2KNE A;  2O5G A;  2LLS A;  3VRQ A;  1ZFS A;  1D1O A;  1QIV A;  1S5G Y;  1JUO A;  4GGF A;  2KBI A;  4YGB B;  5HKY A;  2TN4 A;  4FQO A;  4PHK A;  3O6B A;  5ER5 A;  3SG2 A;  4GBA A;  1CLB A;  2JZI A;  1QVI Z;  1CFP A;  3LK1 A;  4CPV A;  1DGU A;  1PSR A;  3K21 A;  3O2P A;  2L2E A;  1NCZ A;  1IKU A;  1BOD A;  1PUL A;  1QLS A;  3KO0 A;  4A4C A;  1PK0 D;  1KWO B;  4YI9 A;  4E68 A;  1K2H A;  2MJW B;  3I5I C;  3MSE B;  3OX6 A;  2LAN A;  2L4H A;  1N2D A;  2KFG A;  1CDN A;  1IJ6 A;  1DGV A;  1JSA A;  3BUM B;  4AQI A;  4YRU A;  1YRT B;  1OZO A;  2LHL A;  2WOS A;  1UHN A;  2H61 C;  1J7R A;  3DF0 A;  1CM4 A;  2K2F A;  5CSN A;  1MF8 B;  2M97 A;  2KYC A;  2L5X B;  3VRO A;  1KFU S;  1EJ3 A;  3KEV A;  1QLK A;  2SCP A;  3AAJ A;  5TNC A;  1X02 A;  3PFV A;  2KI6 C;  4ORA B;  1S1E A;  3I5F C;  5DKR A;  1PVA A;  4F0Z B;  1OQP A;  1W7J B;  2WCF A;  1WRZ A;  3EVU A;  1K9K A;  1LA3 A;  1EL4 A;  4ZCU A;  2MBX A;  2BBM A;  3F45 A;  3LLE A;  2JT0 A;  2ZN9 A;  1K9U A;  1NX3 A;  2LP3 A;  4CFQ A;  1NP8 A;  2M49 B;  5CSF A;  3DVE A;  1W7I B;  5KU1 A;  2LC5 A;  3QRX A;  3JTD B;  4HSZ A;  1YRU B;  3SIA A;  1KK7 Z;  2KBM A;  2KGB C;  3FWB A;  4MEW A;  2CCM A;  4MRY A;  1CFC A;  1K94 A;  1S26 D;  2KFF A;  2SAS A;  3A8R A;  3CR2 A;  4GFT A;  5PAL A;  2M7N A;  1U5I B;  3DD4 A;  2F3Z A;  2GV5 A;  1TOP A;  4PHM A;  1V1G A;  3OB2 B;  2LUX A;  1YUU A;  2NZ0 A;  1JWD A;  1JF0 A;  3NSL A;  1B8L A;  4UPG A;  2VRG A;  2E30 A;  1B47 A;  4MLW A;  3SG7 A;  2P6B B;  4HRE E;  1SPY A;  1TNP A;  4U8D A;  1A4P A;  3CGA A;  1E8A A;  1QTX A;  4M2Q A;  2JXL A;  3D0Y A;  1BG1 A;  1BMO A;  1S6I A;  2ZRS A;  1YUT A;  2WOR A;  1TTX A;  1EG4 A;  1A03 A;  1LA0 A;  3ZNI A;  4WQ3 A;  2ISD A;  1GGZ A;  1BR4 B;  2M9G A;  1LXF C;  3VRN A;  1IQ3 A;  1IG5 A;  2JT8 A;  2JU0 A;  2LVI A;  1SKT A;  2K8M B;  2NCO A;  1XFX O;  4PE0 A;  1FI6 A;  1TCF A;  2JRF A;  1GJY A;  5HLO A;  1XFY O;  2KI4 B;  2QPT A;  5I2L A;  3BUW B;  4YGE B;  2EGD A;  4AOM A;  1DF0 B;  4R1E A;  1Y0V H;  1JF2 A;  2Y5I A;  3I5I B;  1CFD A;  2LAP A;  4NDD A;  4N1G A;  4PHN A;  4XJK A;  3E3R A;  2EC6 B;  4WQ2 A;  2MA2 A;  1F4Q A;  2JT3 A;  2PAL A;  4A4B A;  1SK6 D;  5JJG A;  1TRF A;  3VGO A;  3GOF A;  2K61 A;  1UWO A;  2JPT A;  3CR4 X;  1C07 A;  2HPS A;  1TNQ A;  4JWQ A;  1NX2 A;  1QX2 A;  1JFK A;  4PE4 A;  2K7O A;  2LVJ A;  1SYM A;  2CT9 A;  1HT9 A;  2K0J A;  1J7P A;  1EXR A;  3TDZ A;  2M7L A;  1AP4 A;  1DJI A;  1B4C A;  1KQM C;  2MHH A;  5HYD A;  2JNX A;  2O60 A;  5I2O A;  1XYD A;  1OMD A;  1PRW A;  4P2Y B;  1G4Y R;  1WLZ A;  1XO5 A;  2FOT A;  1Y1U A;  2M8U A;  4GAO A;  4CFR A;  5AXI A;  4GUK A;  1FI5 A;  2KI6 D;  2WCB A;  4ORC B;  4ETO A;  3LCP C;  1UHJ A;  3IQO A;  1CTR A;  2MRD A;  4ORB B;  1B7T Z;  1CDL A;  1F70 A;  3TDU A;  1CNP A;  1B1G A;  4PE7 A;  3TS5 C;  1F71 A;  1K96 A;  2HQ8 A;  3SIB A;  1LIN A;  1CMF A; 
#chains in the Genus database with same CATH topology
 2R2I A;  5K89 A;  3SJS A;  5HL1 A;  2KOT A;  2KI4 C;  1DJY A;  2LNK A;  3RLZ A;  1AJ5 A;  2HQW A;  4NQG A;  2BCX A;  1CLL A;  5AEQ A;  1QX7 A;  3VRP A;  5KTY A;  1DJH A;  1NCX A;  1V1F A;  1R2U A;  2RGI A;  1UUR A;  2EC6 C;  1KFX S;  4DCK A;  2JTT A;  1W9Z A;  3DVM A;  1MUX A;  4YGA A;  2H2K A;  3NSK A;  1DEK A;  3OGN A;  1WLM A;  3SG6 A;  1YVL A;  3D78 A;  1KSO A;  1QJT A;  3EKH A;  4I5K A;  2BAP A;  3EK8 A;  4QJ3 B;  1TNX A;  1F55 A;  1XK4 C;  2PVB A;  3L47 A;  1TCO B;  1SCM B;  1AUI B;  2LCP A;  1SR6 C;  2V53 A;  1XFZ O;  2KSP A;  3PAT A;  4AQJ A;  5B8I B;  1H4B A;  1RRO A;  1S36 A;  2KAY A;  3NXA A;  3PM8 A;  3EK7 A;  5CPV A;  1C7V A;  1KQV A;  5AFP A;  4Q04 A;  3WNX B;  2F2P A;  2I7A A;  2K7D A;  3L4L A;  3NSO A;  1NCY A;  3H4S E;  1OOF A;  4MN0 A;  2LM5 A;  2PRU A;  2NLN A;  1AHR A;  1Q80 A;  3JVT B;  2KFH A;  3C1V A;  3LL8 B;  1YX7 A;  1U5I A;  5G08 A;  1P28 A;  1ZAC A;  1JFJ A;  1A29 A;  2L0P A;  1QWV A;  1FPW A;  4JD9 A;  3GK2 A;  3GK1 A;  1XFW O;  1K95 A;  3OHM B;  2M29 A;  1WRK A;  3WHU B;  5CSI A;  4C0L A;  2LP2 A;  1S3P A;  2AAO A;  3PM2 A;  1CKK A;  1S5G Z;  3SG3 A;  3HX4 A;  1TUZ A;  1XA5 A;  3EK4 A;  4NDC A;  1N0Y A;  4XYN A;  3CDN A;  2A4J A;  4CLN A;  1YX8 A;  1CB1 A;  1IH0 A;  2KQ6 A;  5ER4 X;  5FYX A;  1BOC A;  1SY9 A;  1M46 A;  1KQM B;  1BR1 B;  1UUS A;  2BL0 B;  2LLT A;  3R1V A;  1K9P A;  2Q4U A;  1YTZ C;  2YGU A;  3BOW B;  3OP0 A;  1QAT A;  2WCE A;  4NDB A;  2L5Y A;  3EKJ A;  3CS1 A;  1SNL A;  3D73 A;  3VRR A;  4C0K A;  4GGF C;  2BE6 A;  1GGW A;  1DMO A;  1S6J A;  4BY5 A;  1PVB A;  3PAL A;  1L2O C;  1ZOT B;  3DZT A;  1SSE B;  1JBA A;  1GQM A;  3TS5 B;  1K93 D;  1ZMZ A;  3QME A;  1NIW A;  5D7F A;  1SCM C;  1SCV A;  4TNC A;  4BY4 A;  4QJ4 B;  2LE9 B;  2Y4Q A;  5GQQ C;  1YUR A;  1VRK A;  2PAS A;  2F8P A;  2OS8 C;  2BCB A;  3PSR A;  2CXJ A;  2KYF A;  2KLD A;  1J55 A;  2PYQ A;  3R72 A;  3SS4 A;  2H61 A;  2LMV A;  1QS7 A;  2JC2 A;  2MAZ A;  2WC8 A;  3M0W A;  2M3W A;  2GTE A;  1QVI Y;  1G8I A;  2FJU B;  3CZT X;  1SW8 A;  3TDI A;  3JVT C;  1JC2 A;  3KPX A;  3D0Y B;  1DT7 B;  2L98 A;  3BUO B;  5CSJ A;  1KFU L;  5DKN A;  2BKI B;  3S0G A;  1CMG A;  3RZS A;  2LMT A;  3OBV A;  3CAB A;  1WY9 A;  1RFJ A;  1WDC B;  1WRL A;  1XFV O;  4YI8 A;  1EH2 A;  2L51 A;  3AAK A;  1NYA A;  1SR6 B;  2LLU A;  2WCH A;  1KK8 B;  3CR5 X;  4I5J A;  3SS3 A;  1UHI A;  2CBL A;  3ZWH A;  3HCM A;  3UNW A;  4WRI A;  2K2A A;  4GPL B;  1SMG A;  4M2O A;  1RK9 A;  2BL0 C;  2COL B;  4GNK B;  3EVV A;  5DIC A;  1QX5 B;  2F3Y A;  1DVI A;  3IQQ A;  5IBW A;  1BF5 A;  1NSH A;  1DQE A;  4XJK B;  1K8U A;  4MBE A;  3D77 A;  1SBJ A;  2KAX A;  2QDI A;  3DVJ A;  2ZKM X;  1A75 B;  5HKW A;  4M2P A;  4I5N B;  1A2X A;  1OMV A;  1SL8 A;  1DC1 A;  4MRX A;  1DJG A;  5J3X A;  2EHB A;  4PAL A;  3NHT A;  5I8N A;  3L4A A;  1YVH A;  3FWC A;  5F6T A;  3PJI A;  1PSB A;  1DJZ A;  1DTL A;  2AMI A;  4MZK A;  2OTG C;  3EVR A;  1IRJ A;  3I5G B;  4MVF A;  1KK7 Y;  1OOH A;  3CZ0 A;  3FE6 A;  3S0B A;  3TUY B;  2LV7 A;  1MR8 A;  2LHI A;  1MQ1 A;  1REC A;  2JUL A;  1Z2C B;  2BKH B;  3BUX B;  3LK0 A;  3BQ3 A;  4IL1 A;  1B8R A;  4JPZ B;  2QEH A;  3VB1 A;  4OKH A;  1N65 A;  2P70 A;  2GGZ A;  1LKJ A;  3FIA A;  2K60 A;  3S0E A;  1ALW A;  3BUN B;  2LMU A;  1RWY A;  1UHH A;  1QV1 A;  3B7A A;  3BFB A;  1BU3 A;  1QIW A;  1CM1 A;  2CTN A;  4OV2 A;  5HKZ A;  1Y1A A;  2K7C A;  1NPQ A;  1L2O B;  2G2B A;  3A4U B;  1M63 B;  3IVT A;  4ZCV A;  5BPJ A;  2LVK A;  5I2Q A;  1CLM A;  4P5O E;  2JPO A;  3SG5 A;  1WDC C;  4C0J A;  2KAV A;  1Y6W A;  1FF1 A;  1KK8 C;  1QV0 A;  1CDM A;  1DJX A;  4HRG A;  2OS8 B;  2MLE C;  2JTZ A;  2ZND A;  1MHO A;  2ZN8 A;  3KF9 A;  1IGV A;  1H8B A;  2I94 A;  3R1O A;  1M39 A;  5FI6 A;  3ICB A;  2FCD A;  1TNW A;  2G9B A;  1PAL A;  1XFU O;  1GM0 A;  1L7Z A;  3TZ1 A;  1C3Z A;  1B9A A;  1OZS A;  3DF0 B;  5HLV A;  2BCA A;  3CYZ A;  2LUC A;  3BXK A;  4DS7 A;  1J7O A;  1J1E A;  3IF7 A;  1NUB A;  1UHK A;  3PN7 B;  3FS7 A;  3NSI A;  3OB1 B;  1AJ4 A;  1KCY A;  3PLF B;  2KGR A;  2M0R A;  1NWD A;  1BT6 A;  1IWQ A;  2D8N A;  1FW4 A;  2JNF A;  4JQ0 D;  2WC6 A;  1NX1 A;  3I5G C;  3AKA A;  1T14 A;  2M1U A;  3BOW A;  4JKT A;  3TUY C;  3R1P A;  3DYE A;  1S6C A;  1R6P A;  2L50 A;  2L4I A;  3WXA A;  2B1U A;  2JQ6 A;  3I5H B;  4HRH A;  2K7B A;  1CFF A;  1UP5 A;  1EG3 A;  1K90 D;  2BNX A;  4YGC B;  2DOQ A;  1OMR A;  2AUC A;  1Y1X A;  2KHN A;  1ZUZ A;  1TN4 A;  3BYA A;  4USL A;  3RM1 A;  2F2O A;  3D74 A;  3NGV A;  1RJV A;  2KQY A;  2JWW A;  2Y1M A;  4MZL A;  1BJF A;  4DUQ A;  2HF5 A;  2I18 A;  2OTG B;  1RTP 1;  5DKQ A;  3O78 A;  5AAN A;  1DF0 A;  1KWO C;  2I2R E;  3CZ2 A;  1NX0 A;  3SG4 A;  5KSZ A;  1MXE A;  1B8C A;  1G33 A;  3AKB A;  1YUS A;  1KSM A;  1TIZ A;  2ZNE A;  2KPH A;  2NCP A;  1B7T Y;  4L9M A;  4D1E A;  1IJ5 A;  2FCE A;  1ORG A;  5AER A;  1IQ5 A;  1F4O A;  1KFX L;  2BEC A;  3BFH A;  2JOJ A;  1QAS A;  4FTG A;  4MZJ A;  1LVC D;  1ALV A;  4PDZ A;  4PE1 A;  5JOL A;  1ODB A;  1OOI X;  1QXP A;  1OSA A;  1SL7 A;  1XK4 A;  1FBV A;  1SRA A;  2PSR A;  2E6W A;  2IS9 A;  2JXC A;  1BLQ A;  2KDH A;  3PN7 C;  4PHJ A;  5D69 A;  2LVV A;  2BBN A;  4QJ5 B;  3CTN A;  2PMY A;  3DXL A;  3WHT B;  4YBH B;  2L2C A;  4ICB A;  4DIR A;  4INX A;  2Y1N A;  3FE9 A;  1AK8 A;  1F8H A;  2OPO A;  1M31 A;  2QEO A;  3JTD C;  4N1F A;  5EL2 A;  1F54 A;  1A75 A;  3DY9 A;  2BE4 A;  3I5H C;  2CNP A;  2GGM A;  4OCI A;  2MLF C;  1XVJ A;  2QAC A;  3CWG A;  4PCW A;  3CLN A;  1DJW A;  2NXQ A;  2F33 A;  1YR5 A;  1CDP A;  1J1D A;  2M1K B;  2WC5 A;  2WND A;  2ZFD A;  3I5F B;  3KHE A;  4CID A;  4DRW A;  3K1E A;  3NHI A;  1OOJ A;  4N5X A;  1HQV A;  1M45 A;  3D10 A;  1J7Q A;  1C3Y A;  4GGN A;  1C7W A;  3O4Y A;  3OX5 A;  2HET A;  2Q91 A;  1MWN A;  4MSP A;  2ZRT A;  4OR9 B;  1MXL C;  3DVK A;  3GK4 X;  4I5L B;  1SL9 A;  1AVS A;  4YGD B;  2QEV A;  4OVN F;  1OE9 B;  2KNE A;  2O5G A;  3S0D A;  2LLS A;  3VRQ A;  3BJH A;  1ZFS A;  3FE8 A;  1D1O A;  1QIV A;  1S5G Y;  1JUO A;  4GGF A;  2KBI A;  2WCJ A;  4YGB B;  5HKY A;  1IIO A;  2TN4 A;  4FQO A;  4PHK A;  3O6B A;  5ER5 A;  3SG2 A;  3SS5 A;  4GBA A;  1CLB A;  2JZI A;  1QVI Z;  1CFP A;  3LK1 A;  4CPV A;  1DGU A;  1PSR A;  3K21 A;  3O2P A;  2L2E A;  1NCZ A;  1IKU A;  1BOD A;  1PUL A;  1QLS A;  3KO0 A;  4A4C A;  1PK0 D;  1KWO B;  4YI9 A;  4E68 A;  1K2H A;  2MJW B;  3I5I C;  3MSE B;  3OX6 A;  2LAN A;  2L4H A;  3D76 A;  1N2D A;  2KFG A;  5FI7 A;  1CDN A;  1IJ6 A;  1DGV A;  1JSA A;  3BUM B;  4AQI A;  4YRU A;  1YRT B;  1OZO A;  2LHL A;  2P71 A;  1UHN A;  2H61 C;  1J7R A;  2WOS A;  3B88 A;  3DF0 A;  1CM4 A;  2K2F A;  5CSN A;  1MF8 B;  2M97 A;  2KYC A;  2L5X B;  3VRO A;  1KFU S;  1EJ3 A;  3KEV A;  1QLK A;  2SCP A;  3AAJ A;  5TNC A;  1X02 A;  3PFV A;  2KI6 C;  4ORA B;  1S1E A;  3I5F C;  5DKR A;  1PVA A;  4F0Z B;  1OQP A;  1W7J B;  2WCF A;  1WRZ A;  3EVU A;  1K9K A;  1LA3 A;  1EL4 A;  4ZCU A;  2MBX A;  2BBM A;  3F45 A;  3B87 A;  2JT0 A;  3LLE A;  2ZN9 A;  1K9U A;  1NX3 A;  2LP3 A;  4CFQ A;  1NP8 A;  2M49 B;  5CSF A;  3DVE A;  1W7I B;  2H8V A;  5KU1 A;  5I94 A;  2LC5 A;  3QRX A;  3JTD B;  4PT1 A;  1DEL A;  4HSZ A;  1YRU B;  3SIA A;  1KK7 Z;  2KBM A;  2KGB C;  3FWB A;  4KYN A;  2CCM A;  4MEW A;  3O4X A;  4MRY A;  1CFC A;  1K94 A;  1S26 D;  2KFF A;  2SAS A;  3A8R A;  3CR2 A;  4GFT A;  5FI2 A;  2KLE A;  2M7N A;  2WCK A;  1U5I B;  3DD4 A;  5PAL A;  2F3Z A;  2GV5 A;  1TOP A;  3CZ1 A;  4PHM A;  3BFA A;  1V1G A;  3OB2 B;  2LUX A;  1YUU A;  2NZ0 A;  1JWD A;  1JF0 A;  3NSL A;  4INW A;  1B8L A;  4UPG A;  2VRG A;  2E30 A;  1B47 A;  4MLW A;  3SG7 A;  2P6B B;  4HRE E;  1SPY A;  1TNP A;  4U8D A;  1A4P A;  3CGA A;  1E8A A;  1QTX A;  4M2Q A;  2JXL A;  3D0Y A;  1BG1 A;  1BMO A;  4F7F A;  1S6I A;  2ZRS A;  1YUT A;  2WOR A;  1TTX A;  3D75 A;  1EG4 A;  1TWO A;  1A03 A;  1LA0 A;  3ZNI A;  3S0A A;  4WQ3 A;  2ISD A;  1GGZ A;  1BR4 B;  2M9G A;  1LXF C;  3VRN A;  1IQ3 A;  1IG5 A;  2JT8 A;  2JU0 A;  2LVI A;  1SKT A;  1XFR A;  2K8M B;  2NCO A;  1XFX O;  4PE0 A;  1FI6 A;  2WCM A;  1TCF A;  2JRF A;  1GJY A;  3UO9 A;  5HLO A;  1XFY O;  2KI4 B;  2QPT A;  5I2L A;  3BUW B;  4YGE B;  2EGD A;  4AOM A;  1OOG A;  1DF0 B;  4R1E A;  1Y0V H;  1JF2 A;  2Y5I A;  3I5I B;  1CFD A;  2LAP A;  4NDD A;  4N1G A;  4PHN A;  4XJK A;  3E3R A;  3EG5 B;  2ERB A;  2EC6 B;  4WQ2 A;  1OW4 A;  2MA2 A;  1F4Q A;  2WCL A;  2JT3 A;  2PAL A;  4OZD A;  4A4B A;  1SK6 D;  5JJG A;  1TRF A;  3VGO A;  2PQL A;  3GOF A;  2K61 A;  1UWO A;  2JPT A;  3CR4 X;  1C07 A;  2HPS A;  1TNQ A;  3B6X A;  3N7H A;  4JWQ A;  3V2L A;  1NX2 A;  1QX2 A;  1JFK A;  4PE4 A;  2K7O A;  2LVJ A;  3Q8I A;  1SYM A;  4IJ7 A;  1TUJ A;  2CT9 A;  1HT9 A;  2K0J A;  1J7P A;  1EXR A;  3TDZ A;  2M7L A;  1AP4 A;  1DJI A;  1B4C A;  1KQM C;  2MHH A;  5HYD A;  2JNX A;  2O60 A;  5I2O A;  1LS8 A;  1XYD A;  1OMD A;  1PRW A;  4P2Y B;  1G4Y R;  1WLZ A;  1XO5 A;  2FOT A;  1Y1U A;  2M8U A;  2FJY A;  4GAO A;  5AXI A;  4CFR A;  4GUK A;  1FI5 A;  2KI6 D;  2QEB A;  2WCB A;  4ORC B;  4ETO A;  3LCP C;  5D3O A;  1Z4H A;  1UHJ A;  3IQO A;  1CTR A;  2MRD A;  4ORB B;  1B7T Z;  1CDL A;  1F70 A;  3TDU A;  3B86 A;  1CNP A;  1B1G A;  4PE7 A;  3TS5 C;  1F71 A;  1K96 A;  2HQ8 A;  4FQT A;  3SIB A;  1LIN A;  3S0F A;  1CMF A; 
#chains in the Genus database with same CATH homology
 2R2I A;  5K89 A;  3SJS A;  2KOT A;  2KI4 C;  1DJY A;  2LNK A;  3RLZ A;  1AJ5 A;  2HQW A;  4NQG A;  2BCX A;  1CLL A;  5AEQ A;  1QX7 A;  3VRP A;  5KTY A;  1DJH A;  1NCX A;  1V1F A;  1R2U A;  2RGI A;  1UUR A;  2EC6 C;  1KFX S;  4DCK A;  2JTT A;  3DVM A;  1MUX A;  4YGA A;  2H2K A;  3NSK A;  1WLM A;  3SG6 A;  1YVL A;  1KSO A;  1QJT A;  3EKH A;  4I5K A;  3EK8 A;  4QJ3 B;  1TNX A;  1F55 A;  1XK4 C;  2PVB A;  1TCO B;  1SCM B;  1AUI B;  2LCP A;  1SR6 C;  2V53 A;  1XFZ O;  2KSP A;  3PAT A;  4AQJ A;  5B8I B;  1H4B A;  1RRO A;  1S36 A;  2KAY A;  3NXA A;  3PM8 A;  3EK7 A;  5CPV A;  1C7V A;  1KQV A;  5AFP A;  4Q04 A;  3WNX B;  2F2P A;  2I7A A;  2K7D A;  3NSO A;  1NCY A;  3H4S E;  4MN0 A;  2LM5 A;  2PRU A;  2NLN A;  1AHR A;  1Q80 A;  3JVT B;  2KFH A;  3C1V A;  3LL8 B;  1YX7 A;  1U5I A;  5G08 A;  1ZAC A;  1JFJ A;  1A29 A;  2L0P A;  1FPW A;  3GK2 A;  3GK1 A;  1XFW O;  1K95 A;  3OHM B;  2M29 A;  1WRK A;  3WHU B;  5CSI A;  4C0L A;  2LP2 A;  1S3P A;  2AAO A;  1CKK A;  1S5G Z;  3SG3 A;  3HX4 A;  1XA5 A;  3EK4 A;  4NDC A;  1N0Y A;  4XYN A;  2A4J A;  4CLN A;  1YX8 A;  1CB1 A;  1IH0 A;  2KQ6 A;  5ER4 X;  5FYX A;  1BOC A;  1SY9 A;  1M46 A;  1KQM B;  2BL0 B;  1BR1 B;  1UUS A;  2LLT A;  1K9P A;  2Q4U A;  1YTZ C;  3BOW B;  3OP0 A;  1QAT A;  2WCE A;  4NDB A;  3EKJ A;  3CS1 A;  1SNL A;  3VRR A;  4C0K A;  4GGF C;  2BE6 A;  1GGW A;  1DMO A;  1S6J A;  4BY5 A;  1PVB A;  3PAL A;  1L2O C;  1ZOT B;  1JBA A;  1GQM A;  3TS5 B;  1K93 D;  1ZMZ A;  5D7F A;  1NIW A;  1SCM C;  1SCV A;  4TNC A;  4BY4 A;  4QJ4 B;  2LE9 B;  2Y4Q A;  5GQQ C;  1YUR A;  1VRK A;  2PAS A;  2F8P A;  2OS8 C;  2BCB A;  3PSR A;  2CXJ A;  2KYF A;  1J55 A;  2H61 A;  2LMV A;  1QS7 A;  2JC2 A;  2MAZ A;  2WC8 A;  3M0W A;  2M3W A;  3CZT X;  1QVI Y;  1G8I A;  2FJU B;  3TDI A;  1SW8 A;  1JC2 A;  3JVT C;  3KPX A;  3D0Y B;  1DT7 B;  2L98 A;  3BUO B;  5CSJ A;  1KFU L;  5DKN A;  2BKI B;  1CMG A;  2LMT A;  1WY9 A;  1RFJ A;  1WDC B;  1WRL A;  1XFV O;  4YI8 A;  1EH2 A;  2L51 A;  3AAK A;  1NYA A;  1SR6 B;  2LLU A;  3CR5 X;  1KK8 B;  4I5J A;  1UHI A;  2CBL A;  3ZWH A;  3HCM A;  4WRI A;  2K2A A;  4GPL B;  1SMG A;  4M2O A;  1RK9 A;  2BL0 C;  2COL B;  4GNK B;  3EVV A;  1QX5 B;  2F3Y A;  1DVI A;  3IQQ A;  5IBW A;  1BF5 A;  1NSH A;  4XJK B;  1K8U A;  4MBE A;  1SBJ A;  2KAX A;  3DVJ A;  2ZKM X;  1A75 B;  5HKW A;  4M2P A;  4I5N B;  1A2X A;  1OMV A;  1SL8 A;  4MRX A;  1DJG A;  5J3X A;  2EHB A;  4PAL A;  5I8N A;  1YVH A;  3FWC A;  5F6T A;  1PSB A;  1DJZ A;  1DTL A;  2AMI A;  4MZK A;  2OTG C;  3EVR A;  1IRJ A;  3I5G B;  4MVF A;  1KK7 Y;  3TUY B;  2LV7 A;  1MR8 A;  2LHI A;  1MQ1 A;  1REC A;  2JUL A;  3LK0 A;  2BKH B;  3BUX B;  4IL1 A;  3BQ3 A;  1B8R A;  4JPZ B;  4OKH A;  1N65 A;  2GGZ A;  1LKJ A;  3FIA A;  1ALW A;  3BUN B;  2LMU A;  1RWY A;  1UHH A;  1QV1 A;  1BU3 A;  1QIW A;  1CM1 A;  2CTN A;  4OV2 A;  5HKZ A;  1Y1A A;  2K7C A;  1NPQ A;  1L2O B;  2G2B A;  3A4U B;  1M63 B;  4ZCV A;  5BPJ A;  2LVK A;  5I2Q A;  1CLM A;  4P5O E;  3SG5 A;  1WDC C;  4C0J A;  2KAV A;  1Y6W A;  1FF1 A;  1KK8 C;  1QV0 A;  1CDM A;  1DJX A;  4HRG A;  2OS8 B;  2MLE C;  2JTZ A;  2ZND A;  1MHO A;  2ZN8 A;  3KF9 A;  1IGV A;  1H8B A;  2I94 A;  1M39 A;  3ICB A;  2FCD A;  1TNW A;  2G9B A;  1PAL A;  1XFU O;  1L7Z A;  3TZ1 A;  1B9A A;  1OZS A;  3DF0 B;  5HLV A;  2BCA A;  2LUC A;  3BXK A;  4DS7 A;  1J7O A;  1J1E A;  3IF7 A;  1NUB A;  1UHK A;  3PN7 B;  3FS7 A;  3NSI A;  3OB1 B;  1AJ4 A;  1KCY A;  3PLF B;  2KGR A;  2M0R A;  1NWD A;  1BT6 A;  1IWQ A;  2D8N A;  1FW4 A;  2JNF A;  4JQ0 D;  1NX1 A;  3I5G C;  3AKA A;  2M1U A;  3BOW A;  3TUY C;  1S6C A;  1R6P A;  2L50 A;  2L4I A;  3WXA A;  2B1U A;  2JQ6 A;  3I5H B;  4HRH A;  2K7B A;  1CFF A;  1UP5 A;  1EG3 A;  1K90 D;  4YGC B;  2DOQ A;  1OMR A;  2AUC A;  1Y1X A;  2KHN A;  1ZUZ A;  1TN4 A;  3BYA A;  4USL A;  2F2O A;  1RJV A;  2KQY A;  2JWW A;  2Y1M A;  4MZL A;  1BJF A;  4DUQ A;  2HF5 A;  2I18 A;  2OTG B;  1RTP 1;  5DKQ A;  3O78 A;  5AAN A;  1DF0 A;  1KWO C;  2I2R E;  1NX0 A;  3SG4 A;  5KSZ A;  1MXE A;  1B8C A;  1G33 A;  3AKB A;  1YUS A;  1KSM A;  1TIZ A;  2ZNE A;  2NCP A;  1B7T Y;  4L9M A;  4D1E A;  1IJ5 A;  2FCE A;  5AER A;  1IQ5 A;  1F4O A;  1KFX L;  2BEC A;  4FTG A;  2JOJ A;  1QAS A;  4MZJ A;  4PDZ A;  1LVC D;  1ALV A;  4PE1 A;  3RM1 A;  5JOL A;  1ODB A;  1QXP A;  1SL7 A;  1OSA A;  1XK4 A;  1FBV A;  1SRA A;  2PSR A;  2E6W A;  2IS9 A;  2JXC A;  1BLQ A;  2KDH A;  3PN7 C;  4PHJ A;  5D69 A;  2LVV A;  2BBN A;  4QJ5 B;  3CTN A;  2PMY A;  3WHT B;  4YBH B;  4ICB A;  4DIR A;  2Y1N A;  1AK8 A;  1F8H A;  2OPO A;  1M31 A;  3JTD C;  4N1F A;  1F54 A;  1A75 A;  2BE4 A;  3I5H C;  2CNP A;  2GGM A;  4OCI A;  2MLF C;  1XVJ A;  2QAC A;  3CWG A;  4PCW A;  3CLN A;  1DJW A;  2NXQ A;  2F33 A;  1YR5 A;  1CDP A;  1J1D A;  2M1K B;  2WND A;  2ZFD A;  3KHE A;  3I5F B;  4CID A;  4DRW A;  4N5X A;  1OOJ A;  1HQV A;  1M45 A;  3D10 A;  1J7Q A;  4GGN A;  1C7W A;  3O4Y A;  3OX5 A;  2HET A;  2Q91 A;  1MWN A;  4MSP A;  2ZRT A;  4OR9 B;  1MXL C;  3DVK A;  3GK4 X;  4I5L B;  1SL9 A;  1AVS A;  4YGD B;  4OVN F;  1OE9 B;  2KNE A;  2O5G A;  2LLS A;  3VRQ A;  1ZFS A;  1D1O A;  1QIV A;  1S5G Y;  1JUO A;  4GGF A;  2KBI A;  4YGB B;  5HKY A;  2TN4 A;  4FQO A;  4PHK A;  3O6B A;  5ER5 A;  3SG2 A;  4GBA A;  1CLB A;  2JZI A;  1QVI Z;  1CFP A;  3LK1 A;  4CPV A;  1DGU A;  1PSR A;  3K21 A;  3O2P A;  2L2E A;  1NCZ A;  1IKU A;  1BOD A;  1PUL A;  1QLS A;  3KO0 A;  4A4C A;  1PK0 D;  1KWO B;  4YI9 A;  4E68 A;  1K2H A;  2MJW B;  3I5I C;  3MSE B;  3OX6 A;  2LAN A;  2L4H A;  1N2D A;  2KFG A;  1CDN A;  1IJ6 A;  1DGV A;  1JSA A;  3BUM B;  4AQI A;  4YRU A;  1YRT B;  1OZO A;  2LHL A;  2WOS A;  1UHN A;  2H61 C;  1J7R A;  3DF0 A;  1CM4 A;  2K2F A;  5CSN A;  1MF8 B;  2M97 A;  2KYC A;  2L5X B;  3VRO A;  1KFU S;  1EJ3 A;  3KEV A;  1QLK A;  2SCP A;  3AAJ A;  5TNC A;  1X02 A;  3PFV A;  2KI6 C;  4ORA B;  1S1E A;  3I5F C;  5DKR A;  1PVA A;  4F0Z B;  1OQP A;  1W7J B;  2WCF A;  1WRZ A;  3EVU A;  1K9K A;  1LA3 A;  1EL4 A;  4ZCU A;  2MBX A;  2BBM A;  3F45 A;  3LLE A;  2JT0 A;  2ZN9 A;  1K9U A;  1NX3 A;  2LP3 A;  4CFQ A;  1NP8 A;  2M49 B;  5CSF A;  3DVE A;  1W7I B;  5KU1 A;  2LC5 A;  3QRX A;  3JTD B;  4HSZ A;  1YRU B;  3SIA A;  1KK7 Z;  2KBM A;  2KGB C;  3FWB A;  4MEW A;  2CCM A;  4MRY A;  1CFC A;  1K94 A;  1S26 D;  2KFF A;  2SAS A;  3A8R A;  3CR2 A;  4GFT A;  5PAL A;  2M7N A;  1U5I B;  3DD4 A;  2F3Z A;  2GV5 A;  1TOP A;  4PHM A;  1V1G A;  3OB2 B;  2LUX A;  1YUU A;  2NZ0 A;  1JWD A;  1JF0 A;  3NSL A;  1B8L A;  4UPG A;  2VRG A;  2E30 A;  1B47 A;  4MLW A;  3SG7 A;  2P6B B;  4HRE E;  1SPY A;  1TNP A;  4U8D A;  1A4P A;  3CGA A;  1E8A A;  1QTX A;  4M2Q A;  2JXL A;  3D0Y A;  1BG1 A;  1BMO A;  1S6I A;  2ZRS A;  1YUT A;  2WOR A;  1TTX A;  1EG4 A;  1A03 A;  1LA0 A;  3ZNI A;  4WQ3 A;  2ISD A;  1GGZ A;  1BR4 B;  2M9G A;  1LXF C;  3VRN A;  1IQ3 A;  1IG5 A;  2JT8 A;  2JU0 A;  2LVI A;  1SKT A;  2K8M B;  2NCO A;  1XFX O;  4PE0 A;  1FI6 A;  1TCF A;  2JRF A;  1GJY A;  5HLO A;  1XFY O;  2KI4 B;  2QPT A;  5I2L A;  3BUW B;  4YGE B;  2EGD A;  4AOM A;  1DF0 B;  4R1E A;  1Y0V H;  1JF2 A;  2Y5I A;  3I5I B;  1CFD A;  2LAP A;  4NDD A;  4N1G A;  4PHN A;  4XJK A;  3E3R A;  2EC6 B;  4WQ2 A;  2MA2 A;  1F4Q A;  2JT3 A;  2PAL A;  4A4B A;  1SK6 D;  5JJG A;  1TRF A;  3VGO A;  3GOF A;  2K61 A;  1UWO A;  2JPT A;  3CR4 X;  1C07 A;  2HPS A;  1TNQ A;  4JWQ A;  1NX2 A;  1QX2 A;  1JFK A;  4PE4 A;  2K7O A;  2LVJ A;  1SYM A;  2CT9 A;  1HT9 A;  2K0J A;  1J7P A;  1EXR A;  3TDZ A;  2M7L A;  1AP4 A;  1DJI A;  1B4C A;  1KQM C;  2MHH A;  5HYD A;  2JNX A;  2O60 A;  5I2O A;  1XYD A;  1OMD A;  1PRW A;  4P2Y B;  1G4Y R;  1WLZ A;  1XO5 A;  2FOT A;  1Y1U A;  2M8U A;  4GAO A;  4CFR A;  5AXI A;  4GUK A;  1FI5 A;  2KI6 D;  2WCB A;  4ORC B;  4ETO A;  3LCP C;  1UHJ A;  3IQO A;  1CTR A;  2MRD A;  4ORB B;  1B7T Z;  1CDL A;  1F70 A;  3TDU A;  1CNP A;  1B1G A;  4PE7 A;  3TS5 C;  1F71 A;  1K96 A;  2HQ8 A;  3SIB A;  1LIN A;  1CMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...