2JT3A

Solution structure of f153w cardiac troponin c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
161
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEWLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Troponin C
publication title Effects of Phe-to-Trp mutation and fluorotryptophan incorporation on the solution structure of cardiac troponin C, and analysis of its suitability as a potential probe for in situ NMR studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jt3A02
2E6WA 3FWCA 5ER4X 1AUIB 3SG2A 1LA3A 2M29A 2M8UA 3BUWB 3QRXA 2KBIA 1KWOB 1NCZA 1TOPA 2FCEA 2JNXA 2D8NA 2K7DA 4YGEB 4NDBA 3EK8A 5B8IB 1D1OA 3IQOA 1DJHA 2PALA 1MWNA 1NCXA 3I5GB 4MEWA 1B8LA 1NPQA 2HQ8A 1C7VA 2M97A 2KFHA 2KFFA 2KI4B 4PHKA 1CTRA 3WHUB 5D7FA 1XFVO 4WQ3A 3TDZA 3FIAA 4HRHA 4FQOA 3TS5B 1FBVA 1X02A 4ZCUA 1S1EA 3H4SE 2LCPA 5HKYA 3DF0A 1TNXA 1B8RA 3EVUA 1KFUS 2JTTA 1H8BA 1S6IA 1TTXA 1QLSA 2M7NA 2H2KA 1NP8A 2ZRSA 3DVJA 1EG3A 1J55A 4XJKA 2AAOA 3JTDC 4OVNF 1A75B 2L50A 1CLMA 4CPVA 1WLMA 1QATA 1IQ5A 1Y1AA 2K2AA 1XFWO 4BY4A 2FOTA 1IG5A 1KK8B 5ER5A 1KK7Z 1GGWA 1S5GZ 2KBMA 1IRJA 1NX0A 3BOWA 1UHIA 2OS8B 4DS7A 2KI4C 2LC5A 2MHHA 2K8MB 4I5KA 1K93D 2CT9A 1IJ5A 1A03A 3GOFA 2OTGC 1J1DA 2AUCA 1UWOA 2H61A 2MLEC 4OR9B 1TNQA 1YUSA 2DOQA 3TUYB 5K89A 1AJ5A 1QTXA 2L5XB 1KFXL 2LHIA 4GNKB 4TNCA 1YX7A 3EK7A 4HRGA 3EKHA 4FTGA 1LA0A 5DKRA 2HETA 2LLTA 2HPSA 1YTZC 3DVMA 1UUSA 4N1FA 2LV7A 3KPXA 1J7OA 4C0JA 3NSKA 4QJ5B 4YRUA 1BOCA 3MSEB 5HKWA 1CDMA 2TN4A 5KTYA 3PN7B 1KK8C 1YRUB 3HCMA 1SK6D 1F4OA 2ZFDA 1HT9A 1R2UA 2LLSA 1FPWA 2OS8C 2I94A 3NSIA 1K94A 1WDCB 2KYFA 4OKHA 1EXRA 1K96A 1Y6WA 2LUCA 2I2RE 3DVEA 3CWGA 2JQ6A 3F45A 1K90D 2AMIA 3DD4A 3GK4X 1CKKA 3PLFB 2KQ6A 2ZKMX 5HLVA 1CLLA 4I5JA 1DT7B 3TUYC 1Y0VH 1BODA 1EG4A 2NCPA 5IBWA 2BCBA 1SCMB 1G33A 2L51A 3PFVA 2LVKA 1A29A 3VRPA 2VRGA 1OZSA 3A4UB 1TNWA 4C0KA 3BUNB 3PALA 3ZNIA 2RGIA 3GK2A 4M2QA 2JTZA 2P6BB 2BKIB 1NSHA 1B7TZ 1UHNA 1JFKA 4PHNA 1LKJA 1OE9B 2F8PA 2KOTA 3OP0A 2V53A 3OB1B 1N2DA 5KSZA 1SL7A 1CDLA 1B9AA 3NXAA 1A2XA 1PVBA 2Y4QA 2GGMA 1U5IB 4MZLA 5JJGA 1KSOA 1CNPA 1QXPA 1WDCC 4PE4A 1S36A 2HF5A 1RROA 1LINA 4YGAA 1DGUA 4R1EA 1DMOA 1UURA 3DVKA 2JWWA 3NSLA 2JULA 1XK4C 1EL4A 1M39A 4DRWA 1H4BA 1XA5A 1DF0A 1SCMC 2JXLA 1DJWA 1QS7A 1WY9A 1XFYO 2ZRTA 3BXKA 1Q80A 2SASA 1YUTA 2ZN8A 1TCFA 2KQYA 1QJTA 1L2OB 2CXJA 1MXEA 2LVIA 1N65A 3EVVA 3PSRA 5CSJA 1CDPA 4YI9A 1WRZA 1B47A 4P5OE 1C07A 1PK0D 2L2EA 3OB2B 1QV0A 1B8CA 5FYXA 1BLQA 1M45A 1QV1A 2WC8A 1CMFA 5AXIA 1LXFC 1NCYA 2KFGA 1JBAA 1V1FA 1ZACA 1R6PA 1KK7Y 1JC2A 2PVBA 2BBNA 1S5GY 4GGNA 2QACA 1BG1A 3TDIA 2BL0B 2K7CA 1F54A 3JVTB 4ORAB 4GPLB 4L9MA 2O5GA 3WHTB 1CDNA 3AAJA 1QLKA 1QVIZ 1KWOC 2Y1NA 1E8AA 2K2FA 3KF9A 1YR5A 1SL8A 1SYMA 2L98A 5AEQA 3IF7A 2JPTA 3BYAA 1BR1B 5KU1A 2M1KB 2K7OA 1QIVA 1MR8A 1XFUO 1RTP1 2Y1MA 3BUOB 1XFZO 2BBMA 1L2OC 2JNFA 4JQ0D 4C0LA 2KNEA 1BR4B 4GBAA 3I5GC 2JOJA 2NCOA 5I2OA 1MQ1A 2KSPA 3EKJA 4CLNA 4ORCB 4ICBA 4DIRA 1AK8A 4QJ4B 1DVIA 1SPYA 3PM8A 1BMOA 4QJ3B 2GGZA 1A75A 4AQJA 1SL9A 3AKAA 1TRFA 3TS5C 3LK1A 3BQ3A 1OMVA 2Q4UA 1TIZA 3TZ1A 3RM1A 3WXAA 1NUBA 2KAXA 4AOMA 1SBJA 1PVAA 3K21A 2BCXA 1L7ZA 1TN4A 3JVTC 2WCEA 1K9PA 4MZJA 2FJUB 3EVRA 4N5XA 4YGDB 2HQWA 5I8NA 1K8UA 1Y1XA 4I5NB 5BPJA 1K2HA 1CB1A 3O6BA 2KHNA 2PASA 4I5LB 2COLB 2CNPA 1J7PA 4YGCB 2JT8A 2WOSA 4NDCA 3SIBA 4Q04A 4A4CA 2LVVA 1CFDA 3I5IB 1A4PA 4YI8A 3VROA 1IQ3A 1OOJA 1NX3A 1XVJA 2NZ0A 2ZN9A 3LCPC 1SMGA 4CFQA 1IGVA 1ZFSA 2JRFA 3CS1A 2I7AA 1B7TY 3LL8B 5TNCA 5HYDA 1JUOA 5CPVA 2KGBC 2A4JA 1OSAA 2OPOA 3VRNA 4UPGA 4ETOA 1QASA 1TNPA 2BE4A 4XYNA 3SG5A 1NX2A 3WNXB 1JSAA 1MHOA 1UP5A 4BY5A 4M2PA 4D1EA 1JWDA 3TDUA 1IWQA 2LUXA 5JOLA 3SJSA 1SRAA 1F8HA 1K9KA 1MF8B 3M0WA 3O2PA 2LAPA 2PRUA 4GGFC 3EK4A 5AERA 1CLBA 1OZOA 1ZOTB 2BE6A 1XK4A 1OMRA 4OV2A 4HSZA 1YVLA 3CLNA 2KI6D 2WCBA 4PE7A 1NX1A 1YURA 3PN7C 1CM1A 3LK0A 1RFJA 4MN0A 3SIAA 3I5IC 5D69A 1MUXA 2JC2A 2Q91A 4WRIA 2EC6B 3D0YB 3OX6A 1F70A 3CR2A 3IQQA 2KAVA 2EGDA 2PMYA 2LNKA 1NYAA 1W7JB 5AANA 1BU3A 1F71A 1KQVA 1N0YA 2MRDA 4MLWA 4ZCVA 4M2OA 3C1VA 1KFUL 1S3PA 1U5IA 3CR4X 3AAKA 1F55A 1FI5A 1YX8A 5CSNA 1ALVA 1YUUA 2KGRA 4MSPA 4ORBB 1QX2A 2B1UA 3BUXB 2F3YA 2L0PA 3FWBA 1J7QA 2M49B 2LHLA 1SCVA 2LP3A 3E3RA 1GGZA 2CBLA 1PRWA 1QVIY 1V1GA 1SNLA 1WLZA 1RK9A 3RLZA 3A8RA 5GQQC 1CFPA 4PCWA 3OX5A 1BF5A 3SG4A 1C7WA 1TCOB 1UHJA 2F2OA 2LM5A 4PALA 4JPZB 2LLUA 2EC6C 2ZNEA 1GQMA 3CTNA 3I5FB 3JTDB 2M3WA 4MRYA 1KCYA 1K9UA 1NIWA 2MAZA 3D10A 2G9BA 2KAYA 2SCPA 3ZWHA 4DCKA 3BUMB 1CM4A 4A4BA 3NSOA 3KO0A 1G4YR 4YBHB 2KYCA 4IL1A 1G8IA 1WRKA 5HLOA 3DF0B 4GFTA 4JWQA 3O4YA 5I2LA 1EJ3A 4PE0A 3ICBA 1J1EA 2I18A 1FF1A 2QPTA 3VRRA 1SR6B 4PDZA 2FCDA 1BT6A 1VRKA 1AVSA 4XJKB 1AHRA 2JT0A 2OTGB 1J7RA 2M7LA 1PALA 4MRXA 2BECA 1OMDA 1UHKA 2K61A 1DTLA 1HQVA 1S6CA 1JFJA 1XO5A 4MVFA 2BCAA 1S26D 1YRTB 1B4CA 1W7IB 3BOWB 1CMGA 1PSRA 2G2BA 2JT3A 1DJIA 2M1UA 3I5FC 5G08A 1RECA 2LP2A 2KI6C 2PSRA 5AFPA 3KHEA 1JF2A 2F2PA 2BL0C 1LVCD 2LANA 3PATA 2WORA 1PSBA 5CSIA 1M46A 2LE9B 1AJ4A 4N1GA 5F6TA 1QX7A 1ZMZA 5PALA 1CFCA 1NWDA 1QIWA 3SG6A 4USLA 1OQPA 1RWYA 1SR6C 4MZKA 1QX5B 5DKNA 4CFRA 2O60A 1KQMB 4PHJA 1M31A 1SKTA 2F33A 5I2QA 1B1GA 1DJZA 2EHBA 5CSFA 1ODBA 2ISDA 2L4HA 4F0ZB 1F4QA 4GGFA 2GV5A 1DJXA 3SG3A 1CFFA 3GK1A 3I5HB 4DUQA 3CZTX 1PULA 3KEVA 3AKBA 1KSMA 4WQ2A 1GJYA 1UHHA 4NDDA 1YVHA 2H61C 2JZIA 1FI6A 2MLFC 4MBEA 1IKUA 1RJVA 3VGOA 1DJGA 1WRLA 1FW4A 2MA2A 4GUKA 4U8DA 1IH0A 2Y5IA 2CCMA 1IJ6A 2ZNDA 4YGBB 2NLNA 4GAOA 3O78A 1M63B 2WCFA 1ALWA 1KQMC 2E30A 4E68A 2LMVA 1K95A 1BJFA 2LMTA 1KFXS 3CGAA 5J3XA 1SW8A 3SG7A 4PHMA 1MXLC 2IS9A 1Y1UA 2LVJA 2NXQA 1SY9A 2MJWB 2LMUA 1DJYA 3FS7A 3CR5X 1JF0A 3I5HC 4PE1A 4NQGA 1XYDA 2KDHA 4AQIA 1DGVA 4OCIA 3HX4A 2F3ZA 1S6JA 2BKHB 2L4IA 4HREE 5HKZA 2WNDA 2JU0A 3D0YA 3VRQA 2CTNA 2K0JA 2M9GA 1AP4A 1XFXO 1DF0B 2JXCA 3LLEA 4CIDA 2K7BA 1EH2A 2MBXA 2R2IA 1ZUZA 4P2YB 2M0RA 5DKQA 3OHMB
chains in the Genus database with same CATH superfamily
2E6WA 3FWCA 5ER4X 1AUIB 3SG2A 1LA3A 2M29A 2M8UA 3BUWB 3QRXA 2KBIA 1KWOB 1NCZA 1TOPA 2FCEA 2JNXA 2D8NA 2K7DA 4YGEB 4NDBA 3EK8A 5B8IB 1D1OA 4OZDA 3IQOA 1DJHA 2PALA 1MWNA 1NCXA 3I5GB 4MEWA 1B8LA 1NPQA 2HQ8A 1C7VA 2M97A 2KFHA 2KFFA 3S0AA 2KI4B 4PHKA 1CTRA 1OW4A 3S0BA 5D7FA 1XFVO 3WHUB 4WQ3A 3TDZA 3FIAA 4HRHA 1GM0A 4FQOA 3TS5B 1FBVA 1X02A 3CDNA 3L4AA 4ZCUA 1S1EA 3H4SE 2KLDA 2JPOA 2LCPA 5HKYA 3DF0A 1TNXA 1B8RA 2QEVA 1KFUS 2JTTA 3EVUA 4F7FA 1S6IA 1H8BA 1TTXA 1QLSA 2M7NA 2H2KA 1NP8A 2ZRSA 3DVJA 1EG3A 1J55A 4XJKA 2AAOA 1OOHA 3JTDC 4OVNF 1A75B 1TUJA 3DY9A 2L50A 1CLMA 4CPVA 1WLMA 1QATA 1IQ5A 1Y1AA 2K2AA 1XFWO 4BY4A 2FOTA 1IG5A 1KK8B 5ER5A 1KK7Z 1GGWA 1S5GZ 2KBMA 1IRJA 1NX0A 3BOWA 1UHIA 2OS8B 4DS7A 2KI4C 1SSEB 2LC5A 2MHHA 1T14A 2K8MB 3B86A 4I5KA 1K93D 3R72A 2CT9A 1IJ5A 1A03A 3GOFA 2OTGC 1J1DA 2AUCA 1UWOA 2H61A 2MLEC 2WC5A 4OR9B 1TNQA 1YUSA 2DOQA 3TUYB 5K89A 1AJ5A 1QTXA 2L5XB 1KFXL 2LHIA 4GNKB 4TNCA 1YX7A 3EK7A 4HRGA 3EKHA 4FTGA 1LA0A 5DKRA 2HETA 2LLTA 2HPSA 1YTZC 3FE6A 3DVMA 1UUSA 4N1FA 2LV7A 3KPXA 1J7OA 4C0JA 3NSKA 2FJYA 4QJ5B 1DC1A 4YRUA 1BOCA 3MSEB 5HKWA 1CDMA 2TN4A 5KTYA 3PN7B 1KK8C 1YRUB 3HCMA 1SK6D 1F4OA 2ZFDA 1HT9A 3S0DA 1R2UA 2LLSA 1FPWA 2OS8C 2I94A 3NSIA 1K94A 1WDCB 2KYFA 4OKHA 4JKTA 1EXRA 1K96A 1Y6WA 2LUCA 2I2RE 3DVEA 3CWGA 2JQ6A 3F45A 4INWA 1K90D 2AMIA 3DD4A 3GK4X 1CKKA 3PLFB 2L2CA 2KQ6A 2ZKMX 5HLVA 1CLLA 3IVTA 4I5JA 1DT7B 3TUYC 1Y0VH 2WCKA 1EG4A 2NCPA 1BODA 5IBWA 3B6XA 2BCBA 1SCMB 1G33A 2KLEA 2L51A 2ERBA 2LVKA 3PFVA 1A29A 3VRPA 2VRGA 1OZSA 3CYZA 3A4UB 1TNWA 4C0KA 3BUNB 3PALA 2H8VA 3ZNIA 2RGIA 3GK2A 4M2QA 2JTZA 2P6BB 2BKIB 1NSHA 1B7TZ 1UHNA 1JFKA 3CABA 1LKJA 1OE9B 2F8PA 2KOTA 4PHNA 3OP0A 2V53A 3OB1B 1N2DA 5KSZA 1SL7A 1CDLA 1B9AA 3NXAA 1A2XA 1PVBA 2Y4QA 2GGMA 1U5IB 3DZTA 4MZLA 1OOGA 5JJGA 1KSOA 1CNPA 1QXPA 1WDCC 4PE4A 1S36A 2HF5A 1RROA 1LINA 4YGAA 3D73A 1DGUA 4R1EA 3RZSA 1UURA 1DMOA 3DVKA 3PM2A 2JWWA 5FI7A 3NSLA 2JULA 3R1VA 1XK4C 1EL4A 1M39A 4DRWA 1H4BA 2KPHA 1XA5A 1DF0A 1SCMC 2JXLA 3FE9A 1DJWA 1QS7A 2PYQA 1WY9A 1XFYO 2ZRTA 3BXKA 1C3ZA 1Q80A 2SASA 1YUTA 2ZN8A 1TCFA 2KQYA 1QJTA 1L2OB 2CXJA 1MXEA 2LVIA 1N65A 3EVVA 3NGVA 3PSRA 5CSJA 5D3OA 1CDPA 3QMEA 4YI9A 1WRZA 1B47A 3B88A 4P5OE 1C07A 1PK0D 2L2EA 3OB2B 1QV0A 1B8CA 5FYXA 1BLQA 1M45A 1QV1A 2WC8A 1CMFA 3UNWA 5AXIA 1LXFC 1NCYA 2KFGA 1JBAA 2BAPA 1V1FA 1ZACA 1R6PA 2QDIA 1KK7Y 1JC2A 2PVBA 2BBNA 1S5GY 2WCLA 2QACA 4GGNA 1BG1A 3B7AA 3TDIA 2BL0B 2K7CA 1F54A 3JVTB 2K60A 4ORAB 4GPLB 4L9MA 2O5GA 3WHTB 1XFRA 1W9ZA 3AAJA 1CDNA 1QLKA 1QVIZ 1KWOC 2Y1NA 1E8AA 2K2FA 3KF9A 1YR5A 1SL8A 1SYMA 2L98A 3S0EA 5AEQA 3IF7A 1Z2CB 2JPTA 3BYAA 1BR1B 5DICA 3NHTA 2M1KB 2K7OA 1QIVA 5KU1A 1MR8A 1XFUO 1RTP1 2Y1MA 3BUOB 1XFZO 2BBMA 1L2OC 2JNFA 4JQ0D 4C0LA 2KNEA 1BR4B 4GBAA 3I5GC 1DELA 2JOJA 2NCOA 5I2OA 1MQ1A 2KSPA 3EKJA 4IJ7A 3N7HA 4CLNA 4ORCB 4ICBA 4DIRA 1AK8A 4QJ4B 1DVIA 1SPYA 3PM8A 4FQTA 1C3YA 1BMOA 4QJ3B 3L47A 2GGZA 1A75A 3BFAA 4AQJA 1SL9A 3AKAA 1TRFA 3TS5C 3LK1A 3BQ3A 1OMVA 2Q4UA 1TIZA 3TZ1A 3RM1A 3WXAA 1NUBA 2KAXA 4AOMA 1SBJA 1PVAA 3K21A 2BCXA 1L7ZA 3D75A 1TN4A 3JVTC 2WCEA 1K9PA 4MZJA 2FJUB 3EVRA 4N5XA 4YGDB 2HQWA 5I8NA 1K8UA 1Y1XA 4I5NB 5BPJA 1K2HA 1CB1A 3O6BA 2KHNA 2PASA 4I5LB 2COLB 2CNPA 1J7PA 4YGCB 2JT8A 2WOSA 4NDCA 3SIBA 4Q04A 4A4CA 2LVVA 3S0GA 1CFDA 3CZ1A 3I5IB 1A4PA 4YI8A 3OBVA 3VROA 1IQ3A 1OOJA 1NX3A 1XVJA 2NZ0A 2ZN9A 3LCPC 1SMGA 4CFQA 1IGVA 1ZFSA 2JRFA 1LS8A 2I7AA 1B7TY 3CS1A 3LL8B 5TNCA 5HYDA 1JUOA 5CPVA 2KGBC 3B87A 2A4JA 1OSAA 2OPOA 3VRNA 4UPGA 4ETOA 1Z4HA 1QASA 1TNPA 2BE4A 4XYNA 3SG5A 1NX2A 3WNXB 1QWVA 1MHOA 1UP5A 4BY5A 1JSAA 4M2PA 4D1EA 1JWDA 3TDUA 1IWQA 2LUXA 5JOLA 3SJSA 1SRAA 1F8HA 1K9KA 1MF8B 3M0WA 3O2PA 2LAPA 2PRUA 4GGFC 3EK4A 5AERA 1CLBA 1OZOA 1ZOTB 2BE6A 1XK4A 1OMRA 4OV2A 4HSZA 1YVLA 3CLNA 2KI6D 2WCBA 4PE7A 1NX1A 1YURA 3PN7C 1CM1A 3LK0A 1RFJA 4MN0A 2P70A 3SIAA 3I5IC 5D69A 1MUXA 2JC2A 2Q91A 4WRIA 2EC6B 3D0YB 3OX6A 1F70A 3CR2A 3IQQA 2KAVA 2EGDA 2PMYA 2LNKA 1NYAA 1W7JB 5AANA 1BU3A 1F71A 1KQVA 1N0YA 2MRDA 2QEBA 4MLWA 4ZCVA 3K1EA 3C1VA 4M2OA 1KFUL 1S3PA 1U5IA 3CR4X 3AAKA 1F55A 1FI5A 1YX8A 5CSNA 1ALVA 1YUUA 2KGRA 1TWOA 4MSPA 4ORBB 1DQEA 1QX2A 2B1UA 3BUXB 2F3YA 2L0PA 1ORGA 3FWBA 1J7QA 2M49B 2LHLA 3O4XA 1SCVA 2LP3A 3SS3A 3E3RA 1GGZA 2CBLA 1PRWA 1QVIY 1V1GA 1SNLA 1WLZA 1RK9A 3RLZA 3A8RA 5GQQC 1CFPA 5FI6A 3BFBA 4PCWA 3CZ0A 3OX5A 1BF5A 3SG4A 1C7WA 1TCOB 1UHJA 2F2OA 2LM5A 4PALA 4JPZB 2LLUA 2EC6C 2ZNEA 1GQMA 3CTNA 3I5FB 3JTDB 2M3WA 2GTEA 4MRYA 1K9UA 1NIWA 2MAZA 3D10A 2G9BA 2KAYA 2SCPA 3ZWHA 2YGUA 4DCKA 3BUMB 1CM4A 4A4BA 3NSOA 3DXLA 3KO0A 1G4YR 2BNXA 2KYCA 4PT1A 4IL1A 1G8IA 2P71A 4YBHB 1WRKA 3L4LA 5HLOA 3DF0B 4GFTA 4JWQA 3O4YA 5I2LA 2QEOA 1EJ3A 4PE0A 3ICBA 1J1EA 2I18A 1FF1A 2QPTA 2WCJA 3VRRA 1SR6B 4PDZA 2WC6A 2FCDA 1BT6A 1VRKA 1AVSA 4XJKB 3R1OA 1OOFA 1AHRA 2JT0A 2OTGB 1J7RA 2M7LA 1PALA 4MRXA 2BECA 1OMDA 1UHKA 3EG5B 2K61A 1DTLA 1HQVA 1S6CA 3R1PA 1JFJA 1XO5A 4MVFA 2BCAA 1S26D 1YRTB 1B4CA 3V2LA 1W7IB 3BOWB 1CMGA 3SS5A 1PSRA 2G2BA 2JT3A 1DJIA 2M1UA 3I5FC 5G08A 1RECA 2LP2A 2KI6C 4JD9A 2PSRA 5AFPA 3BFHA 3KHEA 3DYEA 1JF2A 2F2PA 1P28A 1LVCD 2BL0C 2LANA 3PATA 2WORA 1PSBA 5CSIA 1M46A 3D74A 2LE9B 1AJ4A 4N1GA 5F6TA 1QX7A 1ZMZA 5PALA 1CFCA 1NWDA 1QIWA 3SG6A 4USLA 1OQPA 1RWYA 1SR6C 4MZKA 1QX5B 5DKNA 4CFRA 2O60A 1KQMB 4PHJA 1M31A 1SKTA 2F33A 5I2QA 1B1GA 1DJZA 1KCYA 2EHBA 5CSFA 1ODBA 2ISDA 2L4HA 4F0ZB 1F4QA 4GGFA 2GV5A 1DJXA 3D76A 3SG3A 1CFFA 3GK1A 1DEKA 3I5HB 4DUQA 3CZTX 2PQLA 1PULA 3KEVA 3AKBA 1OOIX 3VB1A 1KSMA 4WQ2A 1GJYA 1UHHA 4NDDA 5I94A 1YVHA 2H61C 2JZIA 3BJHA 5FI2A 1FI6A 2MLFC 3D77A 4MBEA 1IKUA 1RJVA 3VGOA 1DJGA 1WRLA 1FW4A 2MA2A 4GUKA 4U8DA 5EL2A 1IH0A 2Y5IA 2CCMA 1IJ6A 2ZNDA 4YGBB 2NLNA 4GAOA 3O78A 1M63B 2WCFA 1ALWA 1KQMC 2E30A 4E68A 2LMVA 1K95A 1BJFA 2LMTA 1KFXS 3CGAA 5J3XA 3SS4A 1SW8A 1TUZA 3SG7A 4PHMA 3UO9A 1MXLC 2IS9A 1Y1UA 2LVJA 2NXQA 1SY9A 3S0FA 2MJWB 2LMUA 2WCMA 1DJYA 3FS7A 3CR5X 5HL1A 1JF0A 3D78A 3I5HC 4PE1A 3PJIA 4NQGA 3Q8IA 4INXA 1XYDA 2KDHA 3OGNA 1DGVA 4OCIA 4AQIA 3HX4A 2F3ZA 1S6JA 1IIOA 2BKHB 2L4IA 3FE8A 4HREE 5HKZA 2QEHA 2WNDA 2JU0A 2L5YA 3D0YA 2CTNA 4KYNA 3VRQA 2K0JA 3NHIA 2M9GA 1AP4A 1XFXO 1DF0B 2JXCA 3CZ2A 3LLEA 4CIDA 2K7BA 1EH2A 2MBXA 2R2IA 1ZUZA 4P2YB 2M0RA 5DKQA 3OHMB 2WCHA
chains in the Genus database with same CATH topology
2E6WA 3FWCA 5ER4X 1AUIB 3SG2A 1LA3A 2M29A 2M8UA 3BUWB 3QRXA 2KBIA 1KWOB 1NCZA 1TOPA 2FCEA 2JNXA 2D8NA 2K7DA 4YGEB 4NDBA 3EK8A 5B8IB 1D1OA 3IQOA 1DJHA 2PALA 1MWNA 1NCXA 3I5GB 4MEWA 1B8LA 1NPQA 2HQ8A 1C7VA 2M97A 2KFHA 2KFFA 2KI4B 4PHKA 1CTRA 3WHUB 5D7FA 1XFVO 4WQ3A 3TDZA 3FIAA 4HRHA 4FQOA 3TS5B 1FBVA 1X02A 4ZCUA 1S1EA 3H4SE 2LCPA 5HKYA 3DF0A 1TNXA 1B8RA 3EVUA 1KFUS 2JTTA 1H8BA 1S6IA 1TTXA 1QLSA 2M7NA 2H2KA 1NP8A 2ZRSA 3DVJA 1EG3A 1J55A 4XJKA 2AAOA 3JTDC 4OVNF 1A75B 2L50A 1CLMA 4CPVA 1WLMA 1QATA 1IQ5A 1Y1AA 2K2AA 1XFWO 4BY4A 2FOTA 1IG5A 1KK8B 5ER5A 1KK7Z 1GGWA 1S5GZ 2KBMA 1IRJA 1NX0A 3BOWA 1UHIA 2OS8B 4DS7A 2KI4C 2LC5A 2MHHA 2K8MB 4I5KA 1K93D 2CT9A 1IJ5A 1A03A 3GOFA 2OTGC 1J1DA 2AUCA 1UWOA 2H61A 2MLEC 4OR9B 1TNQA 1YUSA 2DOQA 3TUYB 5K89A 1AJ5A 1QTXA 2L5XB 1KFXL 2LHIA 4GNKB 4TNCA 1YX7A 3EK7A 4HRGA 3EKHA 4FTGA 1LA0A 5DKRA 2HETA 2LLTA 2HPSA 1YTZC 3DVMA 1UUSA 4N1FA 2LV7A 3KPXA 1J7OA 4C0JA 3NSKA 4QJ5B 4YRUA 1BOCA 3MSEB 5HKWA 1CDMA 2TN4A 5KTYA 3PN7B 1KK8C 1YRUB 3HCMA 1SK6D 1F4OA 2ZFDA 1HT9A 1R2UA 2LLSA 1FPWA 2OS8C 2I94A 3NSIA 1K94A 1WDCB 2KYFA 4OKHA 1EXRA 1K96A 1Y6WA 2LUCA 2I2RE 3DVEA 3CWGA 2JQ6A 3F45A 1K90D 2AMIA 3DD4A 3GK4X 1CKKA 3PLFB 2KQ6A 2ZKMX 5HLVA 1CLLA 4I5JA 1DT7B 3TUYC 1Y0VH 1BODA 1EG4A 2NCPA 5IBWA 2BCBA 1SCMB 1G33A 2L51A 3PFVA 2LVKA 1A29A 3VRPA 2VRGA 1OZSA 3A4UB 1TNWA 4C0KA 3BUNB 3PALA 3ZNIA 2RGIA 3GK2A 4M2QA 2JTZA 2P6BB 2BKIB 1NSHA 1B7TZ 1UHNA 1JFKA 4PHNA 1LKJA 1OE9B 2F8PA 2KOTA 3OP0A 2V53A 3OB1B 1N2DA 5KSZA 1SL7A 1CDLA 1B9AA 3NXAA 1A2XA 1PVBA 2Y4QA 2GGMA 1U5IB 4MZLA 5JJGA 1KSOA 1CNPA 1QXPA 1WDCC 4PE4A 1S36A 2HF5A 1RROA 1LINA 4YGAA 1DGUA 4R1EA 1DMOA 1UURA 3DVKA 2JWWA 3NSLA 2JULA 1XK4C 1EL4A 1M39A 4DRWA 1H4BA 1XA5A 1DF0A 1SCMC 2JXLA 1DJWA 1QS7A 1WY9A 1XFYO 2ZRTA 3BXKA 1Q80A 2SASA 1YUTA 2ZN8A 1TCFA 2KQYA 1QJTA 1L2OB 2CXJA 1MXEA 2LVIA 1N65A 3EVVA 3PSRA 5CSJA 1CDPA 4YI9A 1WRZA 1B47A 4P5OE 1C07A 1PK0D 2L2EA 3OB2B 1QV0A 1B8CA 5FYXA 1BLQA 1M45A 1QV1A 2WC8A 1CMFA 5AXIA 1LXFC 1NCYA 2KFGA 1JBAA 1V1FA 1ZACA 1R6PA 1KK7Y 1JC2A 2PVBA 2BBNA 1S5GY 4GGNA 2QACA 1BG1A 3TDIA 2BL0B 2K7CA 1F54A 3JVTB 4ORAB 4GPLB 4L9MA 2O5GA 3WHTB 1CDNA 3AAJA 1QLKA 1QVIZ 1KWOC 2Y1NA 1E8AA 2K2FA 3KF9A 1YR5A 1SL8A 1SYMA 2L98A 5AEQA 3IF7A 2JPTA 3BYAA 1BR1B 5KU1A 2M1KB 2K7OA 1QIVA 1MR8A 1XFUO 1RTP1 2Y1MA 3BUOB 1XFZO 2BBMA 1L2OC 2JNFA 4JQ0D 4C0LA 2KNEA 1BR4B 4GBAA 3I5GC 2JOJA 2NCOA 5I2OA 1MQ1A 2KSPA 3EKJA 4CLNA 4ORCB 4ICBA 4DIRA 1AK8A 4QJ4B 1DVIA 1SPYA 3PM8A 1BMOA 4QJ3B 2GGZA 1A75A 4AQJA 1SL9A 3AKAA 1TRFA 3TS5C 3LK1A 3BQ3A 1OMVA 2Q4UA 1TIZA 3TZ1A 3RM1A 3WXAA 1NUBA 2KAXA 4AOMA 1SBJA 1PVAA 3K21A 2BCXA 1L7ZA 1TN4A 3JVTC 2WCEA 1K9PA 4MZJA 2FJUB 3EVRA 4N5XA 4YGDB 2HQWA 5I8NA 1K8UA 1Y1XA 4I5NB 5BPJA 1K2HA 1CB1A 3O6BA 2KHNA 2PASA 4I5LB 2COLB 2CNPA 1J7PA 4YGCB 2JT8A 2WOSA 4NDCA 3SIBA 4Q04A 4A4CA 2LVVA 1CFDA 3I5IB 1A4PA 4YI8A 3VROA 1IQ3A 1OOJA 1NX3A 1XVJA 2NZ0A 2ZN9A 3LCPC 1SMGA 4CFQA 1IGVA 1ZFSA 2JRFA 3CS1A 2I7AA 1B7TY 3LL8B 5TNCA 5HYDA 1JUOA 5CPVA 2KGBC 2A4JA 1OSAA 2OPOA 3VRNA 4UPGA 4ETOA 1QASA 1TNPA 2BE4A 4XYNA 3SG5A 1NX2A 3WNXB 1JSAA 1MHOA 1UP5A 4BY5A 4M2PA 4D1EA 1JWDA 3TDUA 1IWQA 2LUXA 5JOLA 3SJSA 1SRAA 1F8HA 1K9KA 1MF8B 3M0WA 3O2PA 2LAPA 2PRUA 4GGFC 3EK4A 5AERA 1CLBA 1OZOA 1ZOTB 2BE6A 1XK4A 1OMRA 4OV2A 4HSZA 1YVLA 3CLNA 2KI6D 2WCBA 4PE7A 1NX1A 1YURA 3PN7C 1CM1A 3LK0A 1RFJA 4MN0A 3SIAA 3I5IC 5D69A 1MUXA 2JC2A 2Q91A 4WRIA 2EC6B 3D0YB 3OX6A 1F70A 3CR2A 3IQQA 2KAVA 2EGDA 2PMYA 2LNKA 1NYAA 1W7JB 5AANA 1BU3A 1F71A 1KQVA 1N0YA 2MRDA 4MLWA 4ZCVA 4M2OA 3C1VA 1KFUL 1S3PA 1U5IA 3CR4X 3AAKA 1F55A 1FI5A 1YX8A 5CSNA 1ALVA 1YUUA 2KGRA 4MSPA 4ORBB 1QX2A 2B1UA 3BUXB 2F3YA 2L0PA 3FWBA 1J7QA 2M49B 2LHLA 1SCVA 2LP3A 3E3RA 1GGZA 2CBLA 1PRWA 1QVIY 1V1GA 1SNLA 1WLZA 1RK9A 3RLZA 3A8RA 5GQQC 1CFPA 4PCWA 3OX5A 1BF5A 3SG4A 1C7WA 1TCOB 1UHJA 2F2OA 2LM5A 4PALA 4JPZB 2LLUA 2EC6C 2ZNEA 1GQMA 3CTNA 3I5FB 3JTDB 2M3WA 4MRYA 1KCYA 1K9UA 1NIWA 2MAZA 3D10A 2G9BA 2KAYA 2SCPA 3ZWHA 4DCKA 3BUMB 1CM4A 4A4BA 3NSOA 3KO0A 1G4YR 4YBHB 2KYCA 4IL1A 1G8IA 1WRKA 5HLOA 3DF0B 4GFTA 4JWQA 3O4YA 5I2LA 1EJ3A 4PE0A 3ICBA 1J1EA 2I18A 1FF1A 2QPTA 3VRRA 1SR6B 4PDZA 2FCDA 1BT6A 1VRKA 1AVSA 4XJKB 1AHRA 2JT0A 2OTGB 1J7RA 2M7LA 1PALA 4MRXA 2BECA 1OMDA 1UHKA 2K61A 1DTLA 1HQVA 1S6CA 1JFJA 1XO5A 4MVFA 2BCAA 1S26D 1YRTB 1B4CA 1W7IB 3BOWB 1CMGA 1PSRA 2G2BA 2JT3A 1DJIA 2M1UA 3I5FC 5G08A 1RECA 2LP2A 2KI6C 2PSRA 5AFPA 3KHEA 1JF2A 2F2PA 2BL0C 1LVCD 2LANA 3PATA 2WORA 1PSBA 5CSIA 1M46A 2LE9B 1AJ4A 4N1GA 5F6TA 1QX7A 1ZMZA 5PALA 1CFCA 1NWDA 1QIWA 3SG6A 4USLA 1OQPA 1RWYA 1SR6C 4MZKA 1QX5B 5DKNA 4CFRA 2O60A 1KQMB 4PHJA 1M31A 1SKTA 2F33A 5I2QA 1B1GA 1DJZA 2EHBA 5CSFA 1ODBA 2ISDA 2L4HA 4F0ZB 1F4QA 4GGFA 2GV5A 1DJXA 3SG3A 1CFFA 3GK1A 3I5HB 4DUQA 3CZTX 1PULA 3KEVA 3AKBA 1KSMA 4WQ2A 1GJYA 1UHHA 4NDDA 1YVHA 2H61C 2JZIA 1FI6A 2MLFC 4MBEA 1IKUA 1RJVA 3VGOA 1DJGA 1WRLA 1FW4A 2MA2A 4GUKA 4U8DA 1IH0A 2Y5IA 2CCMA 1IJ6A 2ZNDA 4YGBB 2NLNA 4GAOA 3O78A 1M63B 2WCFA 1ALWA 1KQMC 2E30A 4E68A 2LMVA 1K95A 1BJFA 2LMTA 1KFXS 3CGAA 5J3XA 1SW8A 3SG7A 4PHMA 1MXLC 2IS9A 1Y1UA 2LVJA 2NXQA 1SY9A 2MJWB 2LMUA 1DJYA 3FS7A 3CR5X 1JF0A 3I5HC 4PE1A 4NQGA 1XYDA 2KDHA 4AQIA 1DGVA 4OCIA 3HX4A 2F3ZA 1S6JA 2BKHB 2L4IA 4HREE 5HKZA 2WNDA 2JU0A 3D0YA 3VRQA 2CTNA 2K0JA 2M9GA 1AP4A 1XFXO 1DF0B 2JXCA 3LLEA 4CIDA 2K7BA 1EH2A 2MBXA 2R2IA 1ZUZA 4P2YB 2M0RA 5DKQA 3OHMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6W A;  3FWC A;  5ER4 X;  1AUI B;  3SG2 A;  1LA3 A;  2M29 A;  2M8U A;  3BUW B;  3QRX A;  2KBI A;  1KWO B;  1NCZ A;  1TOP A;  2FCE A;  2JNX A;  2D8N A;  2K7D A;  4YGE B;  4NDB A;  3EK8 A;  5B8I B;  1D1O A;  3IQO A;  1DJH A;  2PAL A;  1MWN A;  1NCX A;  3I5G B;  4MEW A;  1B8L A;  1NPQ A;  2HQ8 A;  1C7V A;  2M97 A;  2KFH A;  2KFF A;  2KI4 B;  4PHK A;  1CTR A;  3WHU B;  5D7F A;  1XFV O;  4WQ3 A;  3TDZ A;  3FIA A;  4HRH A;  4FQO A;  3TS5 B;  1FBV A;  1X02 A;  4ZCU A;  1S1E A;  3H4S E;  2LCP A;  5HKY A;  3DF0 A;  1TNX A;  1B8R A;  3EVU A;  1KFU S;  2JTT A;  1H8B A;  1S6I A;  1TTX A;  1QLS A;  2M7N A;  2H2K A;  1NP8 A;  2ZRS A;  3DVJ A;  1EG3 A;  1J55 A;  4XJK A;  2AAO A;  3JTD C;  4OVN F;  1A75 B;  2L50 A;  1CLM A;  4CPV A;  1WLM A;  1QAT A;  1IQ5 A;  1Y1A A;  2K2A A;  1XFW O;  4BY4 A;  2FOT A;  1IG5 A;  1KK8 B;  5ER5 A;  1KK7 Z;  1GGW A;  1S5G Z;  2KBM A;  1IRJ A;  1NX0 A;  3BOW A;  1UHI A;  2OS8 B;  4DS7 A;  2KI4 C;  2LC5 A;  2MHH A;  2K8M B;  4I5K A;  1K93 D;  2CT9 A;  1IJ5 A;  1A03 A;  3GOF A;  2OTG C;  1J1D A;  2AUC A;  1UWO A;  2H61 A;  2MLE C;  4OR9 B;  1TNQ A;  1YUS A;  2DOQ A;  3TUY B;  5K89 A;  1AJ5 A;  1QTX A;  2L5X B;  1KFX L;  2LHI A;  4GNK B;  4TNC A;  1YX7 A;  3EK7 A;  4HRG A;  3EKH A;  4FTG A;  1LA0 A;  5DKR A;  2HET A;  2LLT A;  2HPS A;  1YTZ C;  3DVM A;  1UUS A;  4N1F A;  2LV7 A;  3KPX A;  1J7O A;  4C0J A;  3NSK A;  4QJ5 B;  4YRU A;  1BOC A;  3MSE B;  5HKW A;  1CDM A;  2TN4 A;  5KTY A;  3PN7 B;  1KK8 C;  1YRU B;  3HCM A;  1SK6 D;  1F4O A;  2ZFD A;  1HT9 A;  1R2U A;  2LLS A;  1FPW A;  2OS8 C;  2I94 A;  3NSI A;  1K94 A;  1WDC B;  2KYF A;  4OKH A;  1EXR A;  1K96 A;  1Y6W A;  2LUC A;  2I2R E;  3DVE A;  3CWG A;  2JQ6 A;  3F45 A;  1K90 D;  2AMI A;  3DD4 A;  3GK4 X;  1CKK A;  3PLF B;  2KQ6 A;  2ZKM X;  5HLV A;  1CLL A;  4I5J A;  1DT7 B;  3TUY C;  1Y0V H;  1BOD A;  1EG4 A;  2NCP A;  5IBW A;  2BCB A;  1SCM B;  1G33 A;  2L51 A;  3PFV A;  2LVK A;  1A29 A;  3VRP A;  2VRG A;  1OZS A;  3A4U B;  1TNW A;  4C0K A;  3BUN B;  3PAL A;  3ZNI A;  2RGI A;  3GK2 A;  4M2Q A;  2JTZ A;  2P6B B;  2BKI B;  1NSH A;  1B7T Z;  1UHN A;  1JFK A;  4PHN A;  1LKJ A;  1OE9 B;  2F8P A;  2KOT A;  3OP0 A;  2V53 A;  3OB1 B;  1N2D A;  5KSZ A;  1SL7 A;  1CDL A;  1B9A A;  3NXA A;  1A2X A;  1PVB A;  2Y4Q A;  2GGM A;  1U5I B;  4MZL A;  5JJG A;  1KSO A;  1CNP A;  1QXP A;  1WDC C;  4PE4 A;  1S36 A;  2HF5 A;  1RRO A;  1LIN A;  4YGA A;  1DGU A;  4R1E A;  1DMO A;  1UUR A;  3DVK A;  2JWW A;  3NSL A;  2JUL A;  1XK4 C;  1EL4 A;  1M39 A;  4DRW A;  1H4B A;  1XA5 A;  1DF0 A;  1SCM C;  2JXL A;  1DJW A;  1QS7 A;  1WY9 A;  1XFY O;  2ZRT A;  3BXK A;  1Q80 A;  2SAS A;  1YUT A;  2ZN8 A;  1TCF A;  2KQY A;  1QJT A;  1L2O B;  2CXJ A;  1MXE A;  2LVI A;  1N65 A;  3EVV A;  3PSR A;  5CSJ A;  1CDP A;  4YI9 A;  1WRZ A;  1B47 A;  4P5O E;  1C07 A;  1PK0 D;  2L2E A;  3OB2 B;  1QV0 A;  1B8C A;  5FYX A;  1BLQ A;  1M45 A;  1QV1 A;  2WC8 A;  1CMF A;  5AXI A;  1LXF C;  1NCY A;  2KFG A;  1JBA A;  1V1F A;  1ZAC A;  1R6P A;  1KK7 Y;  1JC2 A;  2PVB A;  2BBN A;  1S5G Y;  4GGN A;  2QAC A;  1BG1 A;  3TDI A;  2BL0 B;  2K7C A;  1F54 A;  3JVT B;  4ORA B;  4GPL B;  4L9M A;  2O5G A;  3WHT B;  1CDN A;  3AAJ A;  1QLK A;  1QVI Z;  1KWO C;  2Y1N A;  1E8A A;  2K2F A;  3KF9 A;  1YR5 A;  1SL8 A;  1SYM A;  2L98 A;  5AEQ A;  3IF7 A;  2JPT A;  3BYA A;  1BR1 B;  5KU1 A;  2M1K B;  2K7O A;  1QIV A;  1MR8 A;  1XFU O;  1RTP 1;  2Y1M A;  3BUO B;  1XFZ O;  2BBM A;  1L2O C;  2JNF A;  4JQ0 D;  4C0L A;  2KNE A;  1BR4 B;  4GBA A;  3I5G C;  2JOJ A;  2NCO A;  5I2O A;  1MQ1 A;  2KSP A;  3EKJ A;  4CLN A;  4ORC B;  4ICB A;  4DIR A;  1AK8 A;  4QJ4 B;  1DVI A;  1SPY A;  3PM8 A;  1BMO A;  4QJ3 B;  2GGZ A;  1A75 A;  4AQJ A;  1SL9 A;  3AKA A;  1TRF A;  3TS5 C;  3LK1 A;  3BQ3 A;  1OMV A;  2Q4U A;  1TIZ A;  3TZ1 A;  3RM1 A;  3WXA A;  1NUB A;  2KAX A;  4AOM A;  1SBJ A;  1PVA A;  3K21 A;  2BCX A;  1L7Z A;  1TN4 A;  3JVT C;  2WCE A;  1K9P A;  4MZJ A;  2FJU B;  3EVR A;  4N5X A;  4YGD B;  2HQW A;  5I8N A;  1K8U A;  1Y1X A;  4I5N B;  5BPJ A;  1K2H A;  1CB1 A;  3O6B A;  2KHN A;  2PAS A;  4I5L B;  2COL B;  2CNP A;  1J7P A;  4YGC B;  2JT8 A;  2WOS A;  4NDC A;  3SIB A;  4Q04 A;  4A4C A;  2LVV A;  1CFD A;  3I5I B;  1A4P A;  4YI8 A;  3VRO A;  1IQ3 A;  1OOJ A;  1NX3 A;  1XVJ A;  2NZ0 A;  2ZN9 A;  3LCP C;  1SMG A;  4CFQ A;  1IGV A;  1ZFS A;  2JRF A;  3CS1 A;  2I7A A;  1B7T Y;  3LL8 B;  5TNC A;  5HYD A;  1JUO A;  5CPV A;  2KGB C;  2A4J A;  1OSA A;  2OPO A;  3VRN A;  4UPG A;  4ETO A;  1QAS A;  1TNP A;  2BE4 A;  4XYN A;  3SG5 A;  1NX2 A;  3WNX B;  1JSA A;  1MHO A;  1UP5 A;  4BY5 A;  4M2P A;  4D1E A;  1JWD A;  3TDU A;  1IWQ A;  2LUX A;  5JOL A;  3SJS A;  1SRA A;  1F8H A;  1K9K A;  1MF8 B;  3M0W A;  3O2P A;  2LAP A;  2PRU A;  4GGF C;  3EK4 A;  5AER A;  1CLB A;  1OZO A;  1ZOT B;  2BE6 A;  1XK4 A;  1OMR A;  4OV2 A;  4HSZ A;  1YVL A;  3CLN A;  2KI6 D;  2WCB A;  4PE7 A;  1NX1 A;  1YUR A;  3PN7 C;  1CM1 A;  3LK0 A;  1RFJ A;  4MN0 A;  3SIA A;  3I5I C;  5D69 A;  1MUX A;  2JC2 A;  2Q91 A;  4WRI A;  2EC6 B;  3D0Y B;  3OX6 A;  1F70 A;  3CR2 A;  3IQQ A;  2KAV A;  2EGD A;  2PMY A;  2LNK A;  1NYA A;  1W7J B;  5AAN A;  1BU3 A;  1F71 A;  1KQV A;  1N0Y A;  2MRD A;  4MLW A;  4ZCV A;  4M2O A;  3C1V A;  1KFU L;  1S3P A;  1U5I A;  3CR4 X;  3AAK A;  1F55 A;  1FI5 A;  1YX8 A;  5CSN A;  1ALV A;  1YUU A;  2KGR A;  4MSP A;  4ORB B;  1QX2 A;  2B1U A;  3BUX B;  2F3Y A;  2L0P A;  3FWB A;  1J7Q A;  2M49 B;  2LHL A;  1SCV A;  2LP3 A;  3E3R A;  1GGZ A;  2CBL A;  1PRW A;  1QVI Y;  1V1G A;  1SNL A;  1WLZ A;  1RK9 A;  3RLZ A;  3A8R A;  5GQQ C;  1CFP A;  4PCW A;  3OX5 A;  1BF5 A;  3SG4 A;  1C7W A;  1TCO B;  1UHJ A;  2F2O A;  2LM5 A;  4PAL A;  4JPZ B;  2LLU A;  2EC6 C;  2ZNE A;  1GQM A;  3CTN A;  3I5F B;  3JTD B;  2M3W A;  4MRY A;  1KCY A;  1K9U A;  1NIW A;  2MAZ A;  3D10 A;  2G9B A;  2KAY A;  2SCP A;  3ZWH A;  4DCK A;  3BUM B;  1CM4 A;  4A4B A;  3NSO A;  3KO0 A;  1G4Y R;  4YBH B;  2KYC A;  4IL1 A;  1G8I A;  1WRK A;  5HLO A;  3DF0 B;  4GFT A;  4JWQ A;  3O4Y A;  5I2L A;  1EJ3 A;  4PE0 A;  3ICB A;  1J1E A;  2I18 A;  1FF1 A;  2QPT A;  3VRR A;  1SR6 B;  4PDZ A;  2FCD A;  1BT6 A;  1VRK A;  1AVS A;  4XJK B;  1AHR A;  2JT0 A;  2OTG B;  1J7R A;  2M7L A;  1PAL A;  4MRX A;  2BEC A;  1OMD A;  1UHK A;  2K61 A;  1DTL A;  1HQV A;  1S6C A;  1JFJ A;  1XO5 A;  4MVF A;  2BCA A;  1S26 D;  1YRT B;  1B4C A;  1W7I B;  3BOW B;  1CMG A;  1PSR A;  2G2B A;  2JT3 A;  1DJI A;  2M1U A;  3I5F C;  5G08 A;  1REC A;  2LP2 A;  2KI6 C;  2PSR A;  5AFP A;  3KHE A;  1JF2 A;  2F2P A;  2BL0 C;  1LVC D;  2LAN A;  3PAT A;  2WOR A;  1PSB A;  5CSI A;  1M46 A;  2LE9 B;  1AJ4 A;  4N1G A;  5F6T A;  1QX7 A;  1ZMZ A;  5PAL A;  1CFC A;  1NWD A;  1QIW A;  3SG6 A;  4USL A;  1OQP A;  1RWY A;  1SR6 C;  4MZK A;  1QX5 B;  5DKN A;  4CFR A;  2O60 A;  1KQM B;  4PHJ A;  1M31 A;  1SKT A;  2F33 A;  5I2Q A;  1B1G A;  1DJZ A;  2EHB A;  5CSF A;  1ODB A;  2ISD A;  2L4H A;  4F0Z B;  1F4Q A;  4GGF A;  2GV5 A;  1DJX A;  3SG3 A;  1CFF A;  3GK1 A;  3I5H B;  4DUQ A;  3CZT X;  1PUL A;  3KEV A;  3AKB A;  1KSM A;  4WQ2 A;  1GJY A;  1UHH A;  4NDD A;  1YVH A;  2H61 C;  2JZI A;  1FI6 A;  2MLF C;  4MBE A;  1IKU A;  1RJV A;  3VGO A;  1DJG A;  1WRL A;  1FW4 A;  2MA2 A;  4GUK A;  4U8D A;  1IH0 A;  2Y5I A;  2CCM A;  1IJ6 A;  2ZND A;  4YGB B;  2NLN A;  4GAO A;  3O78 A;  1M63 B;  2WCF A;  1ALW A;  1KQM C;  2E30 A;  4E68 A;  2LMV A;  1K95 A;  1BJF A;  2LMT A;  1KFX S;  3CGA A;  5J3X A;  1SW8 A;  3SG7 A;  4PHM A;  1MXL C;  2IS9 A;  1Y1U A;  2LVJ A;  2NXQ A;  1SY9 A;  2MJW B;  2LMU A;  1DJY A;  3FS7 A;  3CR5 X;  1JF0 A;  3I5H C;  4PE1 A;  4NQG A;  1XYD A;  2KDH A;  4AQI A;  1DGV A;  4OCI A;  3HX4 A;  2F3Z A;  1S6J A;  2BKH B;  2L4I A;  4HRE E;  5HKZ A;  2WND A;  2JU0 A;  3D0Y A;  3VRQ A;  2CTN A;  2K0J A;  2M9G A;  1AP4 A;  1XFX O;  1DF0 B;  2JXC A;  3LLE A;  4CID A;  2K7B A;  1EH2 A;  2MBX A;  2R2I A;  1ZUZ A;  4P2Y B;  2M0R A;  5DKQ A;  3OHM B; 
#chains in the Genus database with same CATH topology
 2E6W A;  3FWC A;  5ER4 X;  1AUI B;  3SG2 A;  1LA3 A;  2M29 A;  2M8U A;  3BUW B;  3QRX A;  2KBI A;  1KWO B;  1NCZ A;  1TOP A;  2FCE A;  2JNX A;  2D8N A;  2K7D A;  4YGE B;  4NDB A;  3EK8 A;  5B8I B;  1D1O A;  4OZD A;  3IQO A;  1DJH A;  2PAL A;  1MWN A;  1NCX A;  3I5G B;  4MEW A;  1B8L A;  1NPQ A;  2HQ8 A;  1C7V A;  2M97 A;  2KFH A;  2KFF A;  3S0A A;  2KI4 B;  4PHK A;  1CTR A;  1OW4 A;  3S0B A;  5D7F A;  1XFV O;  3WHU B;  4WQ3 A;  3TDZ A;  3FIA A;  4HRH A;  1GM0 A;  4FQO A;  3TS5 B;  1FBV A;  1X02 A;  3CDN A;  3L4A A;  4ZCU A;  1S1E A;  3H4S E;  2KLD A;  2JPO A;  2LCP A;  5HKY A;  3DF0 A;  1TNX A;  1B8R A;  2QEV A;  1KFU S;  2JTT A;  3EVU A;  4F7F A;  1S6I A;  1H8B A;  1TTX A;  1QLS A;  2M7N A;  2H2K A;  1NP8 A;  2ZRS A;  3DVJ A;  1EG3 A;  1J55 A;  4XJK A;  2AAO A;  1OOH A;  3JTD C;  4OVN F;  1A75 B;  1TUJ A;  3DY9 A;  2L50 A;  1CLM A;  4CPV A;  1WLM A;  1QAT A;  1IQ5 A;  1Y1A A;  2K2A A;  1XFW O;  4BY4 A;  2FOT A;  1IG5 A;  1KK8 B;  5ER5 A;  1KK7 Z;  1GGW A;  1S5G Z;  2KBM A;  1IRJ A;  1NX0 A;  3BOW A;  1UHI A;  2OS8 B;  4DS7 A;  2KI4 C;  1SSE B;  2LC5 A;  2MHH A;  1T14 A;  2K8M B;  3B86 A;  4I5K A;  1K93 D;  3R72 A;  2CT9 A;  1IJ5 A;  1A03 A;  3GOF A;  2OTG C;  1J1D A;  2AUC A;  1UWO A;  2H61 A;  2MLE C;  2WC5 A;  4OR9 B;  1TNQ A;  1YUS A;  2DOQ A;  3TUY B;  5K89 A;  1AJ5 A;  1QTX A;  2L5X B;  1KFX L;  2LHI A;  4GNK B;  4TNC A;  1YX7 A;  3EK7 A;  4HRG A;  3EKH A;  4FTG A;  1LA0 A;  5DKR A;  2HET A;  2LLT A;  2HPS A;  1YTZ C;  3FE6 A;  3DVM A;  1UUS A;  4N1F A;  2LV7 A;  3KPX A;  1J7O A;  4C0J A;  3NSK A;  2FJY A;  4QJ5 B;  1DC1 A;  4YRU A;  1BOC A;  3MSE B;  5HKW A;  1CDM A;  2TN4 A;  5KTY A;  3PN7 B;  1KK8 C;  1YRU B;  3HCM A;  1SK6 D;  1F4O A;  2ZFD A;  1HT9 A;  3S0D A;  1R2U A;  2LLS A;  1FPW A;  2OS8 C;  2I94 A;  3NSI A;  1K94 A;  1WDC B;  2KYF A;  4OKH A;  4JKT A;  1EXR A;  1K96 A;  1Y6W A;  2LUC A;  2I2R E;  3DVE A;  3CWG A;  2JQ6 A;  3F45 A;  4INW A;  1K90 D;  2AMI A;  3DD4 A;  3GK4 X;  1CKK A;  3PLF B;  2L2C A;  2KQ6 A;  2ZKM X;  5HLV A;  1CLL A;  3IVT A;  4I5J A;  1DT7 B;  3TUY C;  1Y0V H;  2WCK A;  1EG4 A;  2NCP A;  1BOD A;  5IBW A;  3B6X A;  2BCB A;  1SCM B;  1G33 A;  2KLE A;  2L51 A;  2ERB A;  2LVK A;  3PFV A;  1A29 A;  3VRP A;  2VRG A;  1OZS A;  3CYZ A;  3A4U B;  1TNW A;  4C0K A;  3BUN B;  3PAL A;  2H8V A;  3ZNI A;  2RGI A;  3GK2 A;  4M2Q A;  2JTZ A;  2P6B B;  2BKI B;  1NSH A;  1B7T Z;  1UHN A;  1JFK A;  3CAB A;  1LKJ A;  1OE9 B;  2F8P A;  2KOT A;  4PHN A;  3OP0 A;  2V53 A;  3OB1 B;  1N2D A;  5KSZ A;  1SL7 A;  1CDL A;  1B9A A;  3NXA A;  1A2X A;  1PVB A;  2Y4Q A;  2GGM A;  1U5I B;  3DZT A;  4MZL A;  1OOG A;  5JJG A;  1KSO A;  1CNP A;  1QXP A;  1WDC C;  4PE4 A;  1S36 A;  2HF5 A;  1RRO A;  1LIN A;  4YGA A;  3D73 A;  1DGU A;  4R1E A;  3RZS A;  1UUR A;  1DMO A;  3DVK A;  3PM2 A;  2JWW A;  5FI7 A;  3NSL A;  2JUL A;  3R1V A;  1XK4 C;  1EL4 A;  1M39 A;  4DRW A;  1H4B A;  2KPH A;  1XA5 A;  1DF0 A;  1SCM C;  2JXL A;  3FE9 A;  1DJW A;  1QS7 A;  2PYQ A;  1WY9 A;  1XFY O;  2ZRT A;  3BXK A;  1C3Z A;  1Q80 A;  2SAS A;  1YUT A;  2ZN8 A;  1TCF A;  2KQY A;  1QJT A;  1L2O B;  2CXJ A;  1MXE A;  2LVI A;  1N65 A;  3EVV A;  3NGV A;  3PSR A;  5CSJ A;  5D3O A;  1CDP A;  3QME A;  4YI9 A;  1WRZ A;  1B47 A;  3B88 A;  4P5O E;  1C07 A;  1PK0 D;  2L2E A;  3OB2 B;  1QV0 A;  1B8C A;  5FYX A;  1BLQ A;  1M45 A;  1QV1 A;  2WC8 A;  1CMF A;  3UNW A;  5AXI A;  1LXF C;  1NCY A;  2KFG A;  1JBA A;  2BAP A;  1V1F A;  1ZAC A;  1R6P A;  2QDI A;  1KK7 Y;  1JC2 A;  2PVB A;  2BBN A;  1S5G Y;  2WCL A;  2QAC A;  4GGN A;  1BG1 A;  3B7A A;  3TDI A;  2BL0 B;  2K7C A;  1F54 A;  3JVT B;  2K60 A;  4ORA B;  4GPL B;  4L9M A;  2O5G A;  3WHT B;  1XFR A;  1W9Z A;  3AAJ A;  1CDN A;  1QLK A;  1QVI Z;  1KWO C;  2Y1N A;  1E8A A;  2K2F A;  3KF9 A;  1YR5 A;  1SL8 A;  1SYM A;  2L98 A;  3S0E A;  5AEQ A;  3IF7 A;  1Z2C B;  2JPT A;  3BYA A;  1BR1 B;  5DIC A;  3NHT A;  2M1K B;  2K7O A;  1QIV A;  5KU1 A;  1MR8 A;  1XFU O;  1RTP 1;  2Y1M A;  3BUO B;  1XFZ O;  2BBM A;  1L2O C;  2JNF A;  4JQ0 D;  4C0L A;  2KNE A;  1BR4 B;  4GBA A;  3I5G C;  1DEL A;  2JOJ A;  2NCO A;  5I2O A;  1MQ1 A;  2KSP A;  3EKJ A;  4IJ7 A;  3N7H A;  4CLN A;  4ORC B;  4ICB A;  4DIR A;  1AK8 A;  4QJ4 B;  1DVI A;  1SPY A;  3PM8 A;  4FQT A;  1C3Y A;  1BMO A;  4QJ3 B;  3L47 A;  2GGZ A;  1A75 A;  3BFA A;  4AQJ A;  1SL9 A;  3AKA A;  1TRF A;  3TS5 C;  3LK1 A;  3BQ3 A;  1OMV A;  2Q4U A;  1TIZ A;  3TZ1 A;  3RM1 A;  3WXA A;  1NUB A;  2KAX A;  4AOM A;  1SBJ A;  1PVA A;  3K21 A;  2BCX A;  1L7Z A;  3D75 A;  1TN4 A;  3JVT C;  2WCE A;  1K9P A;  4MZJ A;  2FJU B;  3EVR A;  4N5X A;  4YGD B;  2HQW A;  5I8N A;  1K8U A;  1Y1X A;  4I5N B;  5BPJ A;  1K2H A;  1CB1 A;  3O6B A;  2KHN A;  2PAS A;  4I5L B;  2COL B;  2CNP A;  1J7P A;  4YGC B;  2JT8 A;  2WOS A;  4NDC A;  3SIB A;  4Q04 A;  4A4C A;  2LVV A;  3S0G A;  1CFD A;  3CZ1 A;  3I5I B;  1A4P A;  4YI8 A;  3OBV A;  3VRO A;  1IQ3 A;  1OOJ A;  1NX3 A;  1XVJ A;  2NZ0 A;  2ZN9 A;  3LCP C;  1SMG A;  4CFQ A;  1IGV A;  1ZFS A;  2JRF A;  1LS8 A;  2I7A A;  1B7T Y;  3CS1 A;  3LL8 B;  5TNC A;  5HYD A;  1JUO A;  5CPV A;  2KGB C;  3B87 A;  2A4J A;  1OSA A;  2OPO A;  3VRN A;  4UPG A;  4ETO A;  1Z4H A;  1QAS A;  1TNP A;  2BE4 A;  4XYN A;  3SG5 A;  1NX2 A;  3WNX B;  1QWV A;  1MHO A;  1UP5 A;  4BY5 A;  1JSA A;  4M2P A;  4D1E A;  1JWD A;  3TDU A;  1IWQ A;  2LUX A;  5JOL A;  3SJS A;  1SRA A;  1F8H A;  1K9K A;  1MF8 B;  3M0W A;  3O2P A;  2LAP A;  2PRU A;  4GGF C;  3EK4 A;  5AER A;  1CLB A;  1OZO A;  1ZOT B;  2BE6 A;  1XK4 A;  1OMR A;  4OV2 A;  4HSZ A;  1YVL A;  3CLN A;  2KI6 D;  2WCB A;  4PE7 A;  1NX1 A;  1YUR A;  3PN7 C;  1CM1 A;  3LK0 A;  1RFJ A;  4MN0 A;  2P70 A;  3SIA A;  3I5I C;  5D69 A;  1MUX A;  2JC2 A;  2Q91 A;  4WRI A;  2EC6 B;  3D0Y B;  3OX6 A;  1F70 A;  3CR2 A;  3IQQ A;  2KAV A;  2EGD A;  2PMY A;  2LNK A;  1NYA A;  1W7J B;  5AAN A;  1BU3 A;  1F71 A;  1KQV A;  1N0Y A;  2MRD A;  2QEB A;  4MLW A;  4ZCV A;  3K1E A;  3C1V A;  4M2O A;  1KFU L;  1S3P A;  1U5I A;  3CR4 X;  3AAK A;  1F55 A;  1FI5 A;  1YX8 A;  5CSN A;  1ALV A;  1YUU A;  2KGR A;  1TWO A;  4MSP A;  4ORB B;  1DQE A;  1QX2 A;  2B1U A;  3BUX B;  2F3Y A;  2L0P A;  1ORG A;  3FWB A;  1J7Q A;  2M49 B;  2LHL A;  3O4X A;  1SCV A;  2LP3 A;  3SS3 A;  3E3R A;  1GGZ A;  2CBL A;  1PRW A;  1QVI Y;  1V1G A;  1SNL A;  1WLZ A;  1RK9 A;  3RLZ A;  3A8R A;  5GQQ C;  1CFP A;  5FI6 A;  3BFB A;  4PCW A;  3CZ0 A;  3OX5 A;  1BF5 A;  3SG4 A;  1C7W A;  1TCO B;  1UHJ A;  2F2O A;  2LM5 A;  4PAL A;  4JPZ B;  2LLU A;  2EC6 C;  2ZNE A;  1GQM A;  3CTN A;  3I5F B;  3JTD B;  2M3W A;  2GTE A;  4MRY A;  1K9U A;  1NIW A;  2MAZ A;  3D10 A;  2G9B A;  2KAY A;  2SCP A;  3ZWH A;  2YGU A;  4DCK A;  3BUM B;  1CM4 A;  4A4B A;  3NSO A;  3DXL A;  3KO0 A;  1G4Y R;  2BNX A;  2KYC A;  4PT1 A;  4IL1 A;  1G8I A;  2P71 A;  4YBH B;  1WRK A;  3L4L A;  5HLO A;  3DF0 B;  4GFT A;  4JWQ A;  3O4Y A;  5I2L A;  2QEO A;  1EJ3 A;  4PE0 A;  3ICB A;  1J1E A;  2I18 A;  1FF1 A;  2QPT A;  2WCJ A;  3VRR A;  1SR6 B;  4PDZ A;  2WC6 A;  2FCD A;  1BT6 A;  1VRK A;  1AVS A;  4XJK B;  3R1O A;  1OOF A;  1AHR A;  2JT0 A;  2OTG B;  1J7R A;  2M7L A;  1PAL A;  4MRX A;  2BEC A;  1OMD A;  1UHK A;  3EG5 B;  2K61 A;  1DTL A;  1HQV A;  1S6C A;  3R1P A;  1JFJ A;  1XO5 A;  4MVF A;  2BCA A;  1S26 D;  1YRT B;  1B4C A;  3V2L A;  1W7I B;  3BOW B;  1CMG A;  3SS5 A;  1PSR A;  2G2B A;  2JT3 A;  1DJI A;  2M1U A;  3I5F C;  5G08 A;  1REC A;  2LP2 A;  2KI6 C;  4JD9 A;  2PSR A;  5AFP A;  3BFH A;  3KHE A;  3DYE A;  1JF2 A;  2F2P A;  1P28 A;  1LVC D;  2BL0 C;  2LAN A;  3PAT A;  2WOR A;  1PSB A;  5CSI A;  1M46 A;  3D74 A;  2LE9 B;  1AJ4 A;  4N1G A;  5F6T A;  1QX7 A;  1ZMZ A;  5PAL A;  1CFC A;  1NWD A;  1QIW A;  3SG6 A;  4USL A;  1OQP A;  1RWY A;  1SR6 C;  4MZK A;  1QX5 B;  5DKN A;  4CFR A;  2O60 A;  1KQM B;  4PHJ A;  1M31 A;  1SKT A;  2F33 A;  5I2Q A;  1B1G A;  1DJZ A;  1KCY A;  2EHB A;  5CSF A;  1ODB A;  2ISD A;  2L4H A;  4F0Z B;  1F4Q A;  4GGF A;  2GV5 A;  1DJX A;  3D76 A;  3SG3 A;  1CFF A;  3GK1 A;  1DEK A;  3I5H B;  4DUQ A;  3CZT X;  2PQL A;  1PUL A;  3KEV A;  3AKB A;  1OOI X;  3VB1 A;  1KSM A;  4WQ2 A;  1GJY A;  1UHH A;  4NDD A;  5I94 A;  1YVH A;  2H61 C;  2JZI A;  3BJH A;  5FI2 A;  1FI6 A;  2MLF C;  3D77 A;  4MBE A;  1IKU A;  1RJV A;  3VGO A;  1DJG A;  1WRL A;  1FW4 A;  2MA2 A;  4GUK A;  4U8D A;  5EL2 A;  1IH0 A;  2Y5I A;  2CCM A;  1IJ6 A;  2ZND A;  4YGB B;  2NLN A;  4GAO A;  3O78 A;  1M63 B;  2WCF A;  1ALW A;  1KQM C;  2E30 A;  4E68 A;  2LMV A;  1K95 A;  1BJF A;  2LMT A;  1KFX S;  3CGA A;  5J3X A;  3SS4 A;  1SW8 A;  1TUZ A;  3SG7 A;  4PHM A;  3UO9 A;  1MXL C;  2IS9 A;  1Y1U A;  2LVJ A;  2NXQ A;  1SY9 A;  3S0F A;  2MJW B;  2LMU A;  2WCM A;  1DJY A;  3FS7 A;  3CR5 X;  5HL1 A;  1JF0 A;  3D78 A;  3I5H C;  4PE1 A;  3PJI A;  4NQG A;  3Q8I A;  4INX A;  1XYD A;  2KDH A;  3OGN A;  1DGV A;  4OCI A;  4AQI A;  3HX4 A;  2F3Z A;  1S6J A;  1IIO A;  2BKH B;  2L4I A;  3FE8 A;  4HRE E;  5HKZ A;  2QEH A;  2WND A;  2JU0 A;  2L5Y A;  3D0Y A;  2CTN A;  4KYN A;  3VRQ A;  2K0J A;  3NHI A;  2M9G A;  1AP4 A;  1XFX O;  1DF0 B;  2JXC A;  3CZ2 A;  3LLE A;  4CID A;  2K7B A;  1EH2 A;  2MBX A;  2R2I A;  1ZUZ A;  4P2Y B;  2M0R A;  5DKQ A;  3OHM B;  2WCH A; 
#chains in the Genus database with same CATH homology
 2E6W A;  3FWC A;  5ER4 X;  1AUI B;  3SG2 A;  1LA3 A;  2M29 A;  2M8U A;  3BUW B;  3QRX A;  2KBI A;  1KWO B;  1NCZ A;  1TOP A;  2FCE A;  2JNX A;  2D8N A;  2K7D A;  4YGE B;  4NDB A;  3EK8 A;  5B8I B;  1D1O A;  3IQO A;  1DJH A;  2PAL A;  1MWN A;  1NCX A;  3I5G B;  4MEW A;  1B8L A;  1NPQ A;  2HQ8 A;  1C7V A;  2M97 A;  2KFH A;  2KFF A;  2KI4 B;  4PHK A;  1CTR A;  3WHU B;  5D7F A;  1XFV O;  4WQ3 A;  3TDZ A;  3FIA A;  4HRH A;  4FQO A;  3TS5 B;  1FBV A;  1X02 A;  4ZCU A;  1S1E A;  3H4S E;  2LCP A;  5HKY A;  3DF0 A;  1TNX A;  1B8R A;  3EVU A;  1KFU S;  2JTT A;  1H8B A;  1S6I A;  1TTX A;  1QLS A;  2M7N A;  2H2K A;  1NP8 A;  2ZRS A;  3DVJ A;  1EG3 A;  1J55 A;  4XJK A;  2AAO A;  3JTD C;  4OVN F;  1A75 B;  2L50 A;  1CLM A;  4CPV A;  1WLM A;  1QAT A;  1IQ5 A;  1Y1A A;  2K2A A;  1XFW O;  4BY4 A;  2FOT A;  1IG5 A;  1KK8 B;  5ER5 A;  1KK7 Z;  1GGW A;  1S5G Z;  2KBM A;  1IRJ A;  1NX0 A;  3BOW A;  1UHI A;  2OS8 B;  4DS7 A;  2KI4 C;  2LC5 A;  2MHH A;  2K8M B;  4I5K A;  1K93 D;  2CT9 A;  1IJ5 A;  1A03 A;  3GOF A;  2OTG C;  1J1D A;  2AUC A;  1UWO A;  2H61 A;  2MLE C;  4OR9 B;  1TNQ A;  1YUS A;  2DOQ A;  3TUY B;  5K89 A;  1AJ5 A;  1QTX A;  2L5X B;  1KFX L;  2LHI A;  4GNK B;  4TNC A;  1YX7 A;  3EK7 A;  4HRG A;  3EKH A;  4FTG A;  1LA0 A;  5DKR A;  2HET A;  2LLT A;  2HPS A;  1YTZ C;  3DVM A;  1UUS A;  4N1F A;  2LV7 A;  3KPX A;  1J7O A;  4C0J A;  3NSK A;  4QJ5 B;  4YRU A;  1BOC A;  3MSE B;  5HKW A;  1CDM A;  2TN4 A;  5KTY A;  3PN7 B;  1KK8 C;  1YRU B;  3HCM A;  1SK6 D;  1F4O A;  2ZFD A;  1HT9 A;  1R2U A;  2LLS A;  1FPW A;  2OS8 C;  2I94 A;  3NSI A;  1K94 A;  1WDC B;  2KYF A;  4OKH A;  1EXR A;  1K96 A;  1Y6W A;  2LUC A;  2I2R E;  3DVE A;  3CWG A;  2JQ6 A;  3F45 A;  1K90 D;  2AMI A;  3DD4 A;  3GK4 X;  1CKK A;  3PLF B;  2KQ6 A;  2ZKM X;  5HLV A;  1CLL A;  4I5J A;  1DT7 B;  3TUY C;  1Y0V H;  1BOD A;  1EG4 A;  2NCP A;  5IBW A;  2BCB A;  1SCM B;  1G33 A;  2L51 A;  3PFV A;  2LVK A;  1A29 A;  3VRP A;  2VRG A;  1OZS A;  3A4U B;  1TNW A;  4C0K A;  3BUN B;  3PAL A;  3ZNI A;  2RGI A;  3GK2 A;  4M2Q A;  2JTZ A;  2P6B B;  2BKI B;  1NSH A;  1B7T Z;  1UHN A;  1JFK A;  4PHN A;  1LKJ A;  1OE9 B;  2F8P A;  2KOT A;  3OP0 A;  2V53 A;  3OB1 B;  1N2D A;  5KSZ A;  1SL7 A;  1CDL A;  1B9A A;  3NXA A;  1A2X A;  1PVB A;  2Y4Q A;  2GGM A;  1U5I B;  4MZL A;  5JJG A;  1KSO A;  1CNP A;  1QXP A;  1WDC C;  4PE4 A;  1S36 A;  2HF5 A;  1RRO A;  1LIN A;  4YGA A;  1DGU A;  4R1E A;  1DMO A;  1UUR A;  3DVK A;  2JWW A;  3NSL A;  2JUL A;  1XK4 C;  1EL4 A;  1M39 A;  4DRW A;  1H4B A;  1XA5 A;  1DF0 A;  1SCM C;  2JXL A;  1DJW A;  1QS7 A;  1WY9 A;  1XFY O;  2ZRT A;  3BXK A;  1Q80 A;  2SAS A;  1YUT A;  2ZN8 A;  1TCF A;  2KQY A;  1QJT A;  1L2O B;  2CXJ A;  1MXE A;  2LVI A;  1N65 A;  3EVV A;  3PSR A;  5CSJ A;  1CDP A;  4YI9 A;  1WRZ A;  1B47 A;  4P5O E;  1C07 A;  1PK0 D;  2L2E A;  3OB2 B;  1QV0 A;  1B8C A;  5FYX A;  1BLQ A;  1M45 A;  1QV1 A;  2WC8 A;  1CMF A;  5AXI A;  1LXF C;  1NCY A;  2KFG A;  1JBA A;  1V1F A;  1ZAC A;  1R6P A;  1KK7 Y;  1JC2 A;  2PVB A;  2BBN A;  1S5G Y;  4GGN A;  2QAC A;  1BG1 A;  3TDI A;  2BL0 B;  2K7C A;  1F54 A;  3JVT B;  4ORA B;  4GPL B;  4L9M A;  2O5G A;  3WHT B;  1CDN A;  3AAJ A;  1QLK A;  1QVI Z;  1KWO C;  2Y1N A;  1E8A A;  2K2F A;  3KF9 A;  1YR5 A;  1SL8 A;  1SYM A;  2L98 A;  5AEQ A;  3IF7 A;  2JPT A;  3BYA A;  1BR1 B;  5KU1 A;  2M1K B;  2K7O A;  1QIV A;  1MR8 A;  1XFU O;  1RTP 1;  2Y1M A;  3BUO B;  1XFZ O;  2BBM A;  1L2O C;  2JNF A;  4JQ0 D;  4C0L A;  2KNE A;  1BR4 B;  4GBA A;  3I5G C;  2JOJ A;  2NCO A;  5I2O A;  1MQ1 A;  2KSP A;  3EKJ A;  4CLN A;  4ORC B;  4ICB A;  4DIR A;  1AK8 A;  4QJ4 B;  1DVI A;  1SPY A;  3PM8 A;  1BMO A;  4QJ3 B;  2GGZ A;  1A75 A;  4AQJ A;  1SL9 A;  3AKA A;  1TRF A;  3TS5 C;  3LK1 A;  3BQ3 A;  1OMV A;  2Q4U A;  1TIZ A;  3TZ1 A;  3RM1 A;  3WXA A;  1NUB A;  2KAX A;  4AOM A;  1SBJ A;  1PVA A;  3K21 A;  2BCX A;  1L7Z A;  1TN4 A;  3JVT C;  2WCE A;  1K9P A;  4MZJ A;  2FJU B;  3EVR A;  4N5X A;  4YGD B;  2HQW A;  5I8N A;  1K8U A;  1Y1X A;  4I5N B;  5BPJ A;  1K2H A;  1CB1 A;  3O6B A;  2KHN A;  2PAS A;  4I5L B;  2COL B;  2CNP A;  1J7P A;  4YGC B;  2JT8 A;  2WOS A;  4NDC A;  3SIB A;  4Q04 A;  4A4C A;  2LVV A;  1CFD A;  3I5I B;  1A4P A;  4YI8 A;  3VRO A;  1IQ3 A;  1OOJ A;  1NX3 A;  1XVJ A;  2NZ0 A;  2ZN9 A;  3LCP C;  1SMG A;  4CFQ A;  1IGV A;  1ZFS A;  2JRF A;  3CS1 A;  2I7A A;  1B7T Y;  3LL8 B;  5TNC A;  5HYD A;  1JUO A;  5CPV A;  2KGB C;  2A4J A;  1OSA A;  2OPO A;  3VRN A;  4UPG A;  4ETO A;  1QAS A;  1TNP A;  2BE4 A;  4XYN A;  3SG5 A;  1NX2 A;  3WNX B;  1JSA A;  1MHO A;  1UP5 A;  4BY5 A;  4M2P A;  4D1E A;  1JWD A;  3TDU A;  1IWQ A;  2LUX A;  5JOL A;  3SJS A;  1SRA A;  1F8H A;  1K9K A;  1MF8 B;  3M0W A;  3O2P A;  2LAP A;  2PRU A;  4GGF C;  3EK4 A;  5AER A;  1CLB A;  1OZO A;  1ZOT B;  2BE6 A;  1XK4 A;  1OMR A;  4OV2 A;  4HSZ A;  1YVL A;  3CLN A;  2KI6 D;  2WCB A;  4PE7 A;  1NX1 A;  1YUR A;  3PN7 C;  1CM1 A;  3LK0 A;  1RFJ A;  4MN0 A;  3SIA A;  3I5I C;  5D69 A;  1MUX A;  2JC2 A;  2Q91 A;  4WRI A;  2EC6 B;  3D0Y B;  3OX6 A;  1F70 A;  3CR2 A;  3IQQ A;  2KAV A;  2EGD A;  2PMY A;  2LNK A;  1NYA A;  1W7J B;  5AAN A;  1BU3 A;  1F71 A;  1KQV A;  1N0Y A;  2MRD A;  4MLW A;  4ZCV A;  4M2O A;  3C1V A;  1KFU L;  1S3P A;  1U5I A;  3CR4 X;  3AAK A;  1F55 A;  1FI5 A;  1YX8 A;  5CSN A;  1ALV A;  1YUU A;  2KGR A;  4MSP A;  4ORB B;  1QX2 A;  2B1U A;  3BUX B;  2F3Y A;  2L0P A;  3FWB A;  1J7Q A;  2M49 B;  2LHL A;  1SCV A;  2LP3 A;  3E3R A;  1GGZ A;  2CBL A;  1PRW A;  1QVI Y;  1V1G A;  1SNL A;  1WLZ A;  1RK9 A;  3RLZ A;  3A8R A;  5GQQ C;  1CFP A;  4PCW A;  3OX5 A;  1BF5 A;  3SG4 A;  1C7W A;  1TCO B;  1UHJ A;  2F2O A;  2LM5 A;  4PAL A;  4JPZ B;  2LLU A;  2EC6 C;  2ZNE A;  1GQM A;  3CTN A;  3I5F B;  3JTD B;  2M3W A;  4MRY A;  1KCY A;  1K9U A;  1NIW A;  2MAZ A;  3D10 A;  2G9B A;  2KAY A;  2SCP A;  3ZWH A;  4DCK A;  3BUM B;  1CM4 A;  4A4B A;  3NSO A;  3KO0 A;  1G4Y R;  4YBH B;  2KYC A;  4IL1 A;  1G8I A;  1WRK A;  5HLO A;  3DF0 B;  4GFT A;  4JWQ A;  3O4Y A;  5I2L A;  1EJ3 A;  4PE0 A;  3ICB A;  1J1E A;  2I18 A;  1FF1 A;  2QPT A;  3VRR A;  1SR6 B;  4PDZ A;  2FCD A;  1BT6 A;  1VRK A;  1AVS A;  4XJK B;  1AHR A;  2JT0 A;  2OTG B;  1J7R A;  2M7L A;  1PAL A;  4MRX A;  2BEC A;  1OMD A;  1UHK A;  2K61 A;  1DTL A;  1HQV A;  1S6C A;  1JFJ A;  1XO5 A;  4MVF A;  2BCA A;  1S26 D;  1YRT B;  1B4C A;  1W7I B;  3BOW B;  1CMG A;  1PSR A;  2G2B A;  2JT3 A;  1DJI A;  2M1U A;  3I5F C;  5G08 A;  1REC A;  2LP2 A;  2KI6 C;  2PSR A;  5AFP A;  3KHE A;  1JF2 A;  2F2P A;  2BL0 C;  1LVC D;  2LAN A;  3PAT A;  2WOR A;  1PSB A;  5CSI A;  1M46 A;  2LE9 B;  1AJ4 A;  4N1G A;  5F6T A;  1QX7 A;  1ZMZ A;  5PAL A;  1CFC A;  1NWD A;  1QIW A;  3SG6 A;  4USL A;  1OQP A;  1RWY A;  1SR6 C;  4MZK A;  1QX5 B;  5DKN A;  4CFR A;  2O60 A;  1KQM B;  4PHJ A;  1M31 A;  1SKT A;  2F33 A;  5I2Q A;  1B1G A;  1DJZ A;  2EHB A;  5CSF A;  1ODB A;  2ISD A;  2L4H A;  4F0Z B;  1F4Q A;  4GGF A;  2GV5 A;  1DJX A;  3SG3 A;  1CFF A;  3GK1 A;  3I5H B;  4DUQ A;  3CZT X;  1PUL A;  3KEV A;  3AKB A;  1KSM A;  4WQ2 A;  1GJY A;  1UHH A;  4NDD A;  1YVH A;  2H61 C;  2JZI A;  1FI6 A;  2MLF C;  4MBE A;  1IKU A;  1RJV A;  3VGO A;  1DJG A;  1WRL A;  1FW4 A;  2MA2 A;  4GUK A;  4U8D A;  1IH0 A;  2Y5I A;  2CCM A;  1IJ6 A;  2ZND A;  4YGB B;  2NLN A;  4GAO A;  3O78 A;  1M63 B;  2WCF A;  1ALW A;  1KQM C;  2E30 A;  4E68 A;  2LMV A;  1K95 A;  1BJF A;  2LMT A;  1KFX S;  3CGA A;  5J3X A;  1SW8 A;  3SG7 A;  4PHM A;  1MXL C;  2IS9 A;  1Y1U A;  2LVJ A;  2NXQ A;  1SY9 A;  2MJW B;  2LMU A;  1DJY A;  3FS7 A;  3CR5 X;  1JF0 A;  3I5H C;  4PE1 A;  4NQG A;  1XYD A;  2KDH A;  4AQI A;  1DGV A;  4OCI A;  3HX4 A;  2F3Z A;  1S6J A;  2BKH B;  2L4I A;  4HRE E;  5HKZ A;  2WND A;  2JU0 A;  3D0Y A;  3VRQ A;  2CTN A;  2K0J A;  2M9G A;  1AP4 A;  1XFX O;  1DF0 B;  2JXC A;  3LLE A;  4CID A;  2K7B A;  1EH2 A;  2MBX A;  2R2I A;  1ZUZ A;  4P2Y B;  2M0R A;  5DKQ A;  3OHM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...