2BECA

Crystal structure of chp2 in complex with its binding region in nhe1 and insights into the mechanism of ph regulation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
181
Chain Sequence
IPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTEKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcineurin B homologous protein 2
publication title Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transport protein
total genus 56
structure length 181
sequence length 186
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2becA00
3LLEA 1DVIA 3A4UB 2EC6B 1JC2A 2AMIA 1YVHA 2GV5A 4PCWA 2HQ8A 3PLFB 1EXRA 1PVAA 1NYAA 2LE9B 3I5HB 2BBMA 2KFHA 1K90D 1BLQA 2JWWA 1DJXA 1SBJA 3E3RA 5CSJA 2CCMA 2HF5A 3CR5X 1V1FA 1TRFA 1DJZA 1M45A 5D7FA 2ZRSA 3BYAA 3MSEB 1S6CA 2KQYA 1KQVA 3AKBA 5AFPA 1WRKA 1BR1B 5K89A 1QATA 1RROA 3KPXA 1TN4A 1EL4A 1KWOB 2M9GA 1ODBA 1IJ5A 2L2EA 3OB2B 4YGCB 3TDUA 1S5GY 2KYCA 2BL0B 2WC8A 2Q91A 2KBIA 3GOFA 4N1GA 1CDNA 1CKKA 1B4CA 2G2BA 2KHNA 5HLVA 2EC6C 3PALA 5CSNA 2M8UA 1TNPA 2FCEA 1ZOTB 4HRHA 2L98A 5DKRA 1LA3A 2MLFC 1Y1UA 2K61A 3IF7A 4HREE 1W7IB 1NCZA 3I5HC 1CMFA 1IQ3A 1MWNA 1OQPA 1QX7A 3DVJA 3KO0A 1J1EA 2JRFA 4JWQA 1LXFC 3BOWA 1XFZO 1SRAA 2HQWA 2K7DA 2AAOA 1ZUZA 2LV7A 3VROA 4OKHA 3LL8B 3O4YA 5KTYA 1GQMA 1CFFA 1KK8B 1N65A 2M1KB 1KSOA 4UPGA 1KWOC 1KQMB 1Y1AA 3ICBA 2BL0C 1NX2A 3OX6A 4GNKB 2EHBA 2G9BA 1N2DA 2MLEC 1EH2A 1LKJA 3PATA 1C07A 1XFYO 3LK1A 1LA0A 1QTXA 4YI9A 4YGEB 1A4PA 1OMVA 3D0YA 1EJ3A 1CFPA 1BJFA 2PMYA 1NUBA 1DJWA 3EK7A 3TS5B 2CNPA 2MBXA 1JFJA 1TOPA 3VGOA 1DF0A 5F6TA 1WDCB 1XFVO 4MLWA 1DJYA 1K9PA 2F2PA 4P2YB 1V1GA 1QASA 1SW8A 2LVVA 1RECA 2D8NA 4GPLB 1MQ1A 2KI4B 5I2QA 2BCBA 2KBMA 3HCMA 4BY4A 2PVBA 3OP0A 1KK8C 4PE4A 1G33A 1U5IB 2BECA 2HPSA 3DVEA 3O78A 4ORBB 4QJ4B 5HKYA 1J7OA 4MN0A 2LM5A 4M2PA 3ZNIA 4Q04A 1KQMC 1A75A 3FIAA 2M0RA 1YUSA 2MAZA 3IQOA 1XA5A 1K96A 3VRPA 1NP8A 2KAXA 2NLNA 4PALA 5I2OA 2Y5IA 2BCXA 2L50A 1NX0A 1XK4A 2Y1NA 5HKZA 2ZNDA 3C1VA 2JZIA 1SCMB 1K9UA 3SG6A 1B1GA 1JWDA 1AUIB 4CFRA 2KI6D 4FQOA 5HLOA 1DJHA 3CLNA 2K7CA 1L7ZA 4CIDA 4OR9B 1WDCC 5KU1A 1DJGA 1KFUL 1M63B 2LANA 2LCPA 4MZKA 2FCDA 2H61A 2HETA 3CTNA 4MRXA 2JTTA 4USLA 1DT7B 4PHMA 1SCVA 2PSRA 1QJTA 3DF0A 2JC2A 2I18A 2KI4C 4E68A 2RGIA 4OV2A 2QPTA 2WORA 1CFDA 4IL1A 3BOWB 4ETOA 2LMUA 1QX2A 3RM1A 1AJ5A 3PM8A 3OX5A 1J7PA 1UURA 1WRZA 1CB1A 4AQIA 1K9KA 3OHMB 2KQ6A 2L5XB 2ZN9A 2MHHA 4MSPA 4CFQA 1IKUA 1S6IA 3SIBA 2IS9A 3PN7B 1DTLA 1FBVA 5I2LA 3I5GB 2SASA 2WCEA 1MUXA 1SYMA 1SY9A 5AERA 5AXIA 5J3XA 1XFUO 2LVJA 5DKNA 1SCMC 4ORAB 2WCFA 1JF2A 1J7QA 1CLBA 1XYDA 3TUYB 2F2OA 4M2OA 4ZCVA 4PHJA 1BG1A 3D0YB 1SL7A 3NSIA 2K2FA 2PASA 4A4BA 4L9MA 2M1UA 2LLTA 1DGUA 2K7OA 2BBNA 3EVRA 1DF0B 2KGBC 1M39A 1K95A 3EVVA 1BMOA 1LVCD 1EG3A 1H8BA 1UWOA 4HRGA 1S1EA 4WRIA 1LINA 3CR2A 3SG7A 3NSOA 3WHTB 1FI5A 4MEWA 1OZSA 5AEQA 1S36A 2K7BA 1OMRA 4MRYA 3SG3A 1J7RA 1GJYA 1XO5A 3PN7C 1QVIZ 1IQ5A 1SMGA 5AANA 2LP3A 3I5GC 3LK0A 4YGAA 4AOMA 2NZ0A 2M49B 3BUXB 1YRTB 3WHUB 4DCKA 4U8DA 1JUOA 3F45A 1CFCA 3BUOB 4OVNF 1L2OB 1MHOA 1UHJA 3TUYC 2ZNEA 4TNCA 1B47A 5ER5A 1QIVA 1QV1A 4WQ3A 2O60A 1NWDA 2JNFA 1UUSA 2K8MB 2ZFDA 4ZCUA 4GGFA 2LNKA 1KK7Z 2KFFA 1SK6D 2ZRTA 4C0JA 2JT0A 5FYXA 2WNDA 3GK2A 1GGWA 5DKQA 1Y1XA 1CM1A 5ER4X 3BUMB 1FW4A 3DF0B 2CXJA 2WCBA 1YUUA 4MVFA 3VRQA 1CDLA 2NCPA 4A4CA 1QV0A 2DOQA 2ZN8A 3NSLA 1KFXL 5D69A 1K8UA 1G8IA 2MRDA 2TN4A 1JBAA 2WOSA 1A2XA 4P5OE 2VRGA 2ZKMX 1RTP1 1B7TZ 1XK4C 1L2OC 2JOJA 2EGDA 1OZOA 4OCIA 2R2IA 1QLSA 1YRUB 3WXAA 1BU3A 3FWBA 1WLMA 1D1OA 1VRKA 2OTGB 2LUXA 1QIWA 1YX7A 3QRXA 4PE7A 1WLZA 4I5JA 1IWQA 1SR6B 1C7WA 2K2AA 2JNXA 4PE1A 1BF5A 4XJKA 1TNQA 4M2QA 1F8HA 4YBHB 2H61C 2LMTA 2KYFA 1BT6A 1Y6WA 3BUWB 1B8CA 2E6WA 4YI8A 5CSFA 1ZMZA 1QX5B 3GK4X 1IGVA 2MA2A 1OMDA 1DJIA 3TS5C 5GQQC 1BR4B 4BY5A 1S26D 1YTZC 1EG4A 1MF8B 1K2HA 3OB1B 3PSRA 2F3YA 2JTZA 4N1FA 3SG4A 4WQ2A 3BUNB 2PALA 1M46A 1IG5A 2M97A 1JSAA 4GBAA 1SNLA 1TTXA 2Q4UA 2LLSA 2M3WA 1MXEA 1YURA 1ZACA 3O6BA 1PRWA 4MBEA 1YR5A 3A8RA 3VRNA 1KFXS 1BOCA 1F55A 1SPYA 2OTGC 1TCOB 1QS7A 2M29A 3CZTX 1F4OA 4YRUA 1SR6C 2BE6A 2LP2A 4GUKA 1DGVA 4NDDA 5I8NA 2LLUA 1CDPA 4I5NB 4C0KA 1Q80A 4FTGA 5HYDA 2K0JA 3EVUA 5G08A 2LHIA 3BXKA 1S5GZ 3CGAA 2L4HA 4ORCB 1NSHA 1R2UA 2PRUA 2BE4A 3DD4A 1ALWA 4C0LA 1NPQA 1MR8A 2LC5A 4PE0A 2I94A 1AVSA 3H4SE 2BKIB 5PALA 5CSIA 2Y4QA 2I2RE 3WNXB 1IRJA 1UHIA 1RK9A 1HT9A 2CTNA 1NCXA 1X02A 4YGBB 4GFTA 1WY9A 1U5IA 1Y0VH 2KI6C 4PDZA 3RLZA 3SJSA 2KGRA 3M0WA 4R1EA 2LVIA 1IJ6A 4DUQA 3TZ1A 2GGMA 4I5KA 4CLNA 1K93D 1YVLA 1JFKA 3IQQA 1TNWA 1H4BA 2B1UA 1KFUS 2KOTA 1F54A 1B9AA 2O5GA 3DVMA 2ISDA 1A75B 3GK1A 5B8IB 1CLMA 1XFXO 1CM4A 2KDHA 2M7NA 2SCPA 2Y1MA 4NDBA 4JPZB 3JTDB 4GGFC 3LCPC 5HKWA 1PALA 4XJKB 3K21A 1TIZA 3AKAA 3KHEA 3PFVA 1BODA 1TCFA 4NQGA 2JXCA 4DRWA 1NX1A 1QXPA 3EKJA 3SG5A 1JF0A 1RJVA 3AAJA 1AHRA 3TDZA 2KAYA 1WRLA 4PHKA 2A4JA 1IH0A 4QJ3B 2M7LA 1K94A 2COLB 2OPOA 1E8AA 4PHNA 2E30A 3CR4X 2V53A 3NSKA 1GGZA 4MZLA 5BPJA 1A29A 1PK0D 1QVIY 2KAVA 1CLLA 3D10A 5KSZA 1XFWO 1CMGA 1J55A 4HSZA 3SIAA 1MXLC 2QACA 4MZJA 1ZFSA 1FF1A 1HQVA 2NXQA 3FWCA 1M31A 3CWGA 1NIWA 1UHNA 1CTRA 3SG2A 1TNXA 1UP5A 2F3ZA 1UHHA 1UHKA 4NDCA 4DIRA 4JQ0D 1PVBA 2P6BB 1N0YA 1RWYA 2LAPA 3JTDC 3EK8A 2CT9A 2GGZA 4ICBA 3DVKA 1SL9A 3BQ3A 1YUTA 1KK7Y 2F33A 4QJ5B 2LUCA 1PSBA 2H2KA 2BKHB 2OS8B 4CPVA 1W7JB 1S6JA 2BCAA 1KSMA 3I5FB 1CDMA 3EK4A 1AJ4A 2JPTA 1ALVA 1XVJA 1DMOA 2L4IA 1J1DA 2CBLA 3JVTB 4DS7A 1F4QA 1OE9B 3FS7A 1SKTA 1CNPA 2JQ6A 1B8LA 3I5IB 5TNCA 1AK8A 2KNEA 2JT8A 2LVKA 2KSPA 2JXLA 4GGNA 1FI6A 3ZWHA 2JU0A 3VRRA 1QLKA 2NCOA 2JULA 2F8PA 2FJUB 1B7TY 2LHLA 3TDIA 5JJGA 3HX4A 1RFJA 1PSRA 4YGDB 1F71A 1FPWA 3EKHA 1A03A 2I7AA 2KFGA 3O2PA 4D1EA 1OOJA 1PULA 1G4YR 4N5XA 4F0ZB 1C7VA 2LMVA 1NX3A 2OS8C 1B8RA 1YX8A 2JT3A 4XYNA 3KF9A 4GAOA 4I5LB 1R6PA 3AAKA 3CS1A 2FOTA 4AQJA 1OSAA 1KCYA 3I5FC 5IBWA 1NCYA 3KEVA 2MJWB 3NXAA 5JOLA 1AP4A 1S3PA 3JVTC 5CPVA 2AUCA 2L0PA 1SL8A 2L51A 3I5IC 1F70A
chains in the Genus database with same CATH superfamily
3LLEA 1DVIA 3A4UB 2EC6B 1JC2A 2AMIA 1YVHA 2GV5A 4PCWA 1DEKA 2HQ8A 1ORGA 3PLFB 1EXRA 1PVAA 1NYAA 2LE9B 3I5HB 2WC6A 2BBMA 3RZSA 2KFHA 1K90D 1BLQA 2JWWA 1DJXA 1SBJA 3E3RA 5CSJA 2CCMA 2HF5A 3CR5X 1V1FA 3SS5A 1TRFA 1DJZA 1M45A 5D7FA 2ZRSA 3BFAA 3BYAA 3B7AA 1S6CA 3MSEB 3D74A 2KQYA 1KQVA 3AKBA 5AFPA 1WRKA 1BR1B 2H8VA 5K89A 1QATA 1RROA 3KPXA 1TN4A 1EL4A 1KWOB 2M9GA 1ODBA 1IJ5A 1OOGA 2L2EA 3OB2B 4YGCB 3TDUA 1S5GY 4F7FA 2KYCA 2BL0B 2WC8A 2Q91A 2KBIA 3GOFA 4INXA 3O4XA 4N1GA 1CDNA 1CKKA 1B4CA 2G2BA 2KHNA 5HLVA 2EC6C 3PALA 5CSNA 2M8UA 1TNPA 2FCEA 1DQEA 1ZOTB 2L98A 4HRHA 5DKRA 1LA3A 2MLFC 3DZTA 5FI7A 1Y1UA 2K61A 3IF7A 4HREE 1W7IB 1NCZA 3I5HC 1CMFA 1IQ3A 1OOIX 1MWNA 1OQPA 1QX7A 3DVJA 3KO0A 1J1EA 2JRFA 4JWQA 1LXFC 3BOWA 1XFZO 1SRAA 3BFHA 2HQWA 2K7DA 2AAOA 1ZUZA 2LV7A 3VROA 4OKHA 3LL8B 3O4YA 5KTYA 1GQMA 4KYNA 1CFFA 1KK8B 1N65A 3UNWA 2M1KB 1LS8A 1KSOA 4UPGA 1KWOC 3VB1A 1KQMB 3R1VA 1Y1AA 1T14A 3ICBA 2BL0C 1NX2A 3OX6A 4GNKB 2EHBA 2G9BA 1N2DA 2MLEC 1EH2A 1LKJA 3PATA 2WCLA 1C07A 1XFYO 3LK1A 1LA0A 1QTXA 4YI9A 4YGEB 1DELA 1A4PA 1OMVA 3D0YA 1EJ3A 1CFPA 1BJFA 2PMYA 1NUBA 1DJWA 3EK7A 3TS5B 2CNPA 2MBXA 1JFJA 1TOPA 3VGOA 1DF0A 2L2CA 3SS3A 5F6TA 1WDCB 1XFVO 2PQLA 4MLWA 1DJYA 1K9PA 2F2PA 3CDNA 4P2YB 1V1GA 1QASA 1SW8A 2LVVA 1RECA 2D8NA 4GPLB 1MQ1A 2KI4B 5I2QA 2QEVA 2BCBA 2KBMA 3HCMA 4BY4A 2PVBA 3OP0A 1KK8C 4PE4A 3CZ1A 1G33A 1U5IB 2BECA 2HPSA 3DVEA 3O78A 4ORBB 4QJ4B 5HKYA 1J7OA 4MN0A 2LM5A 4M2PA 3ZNIA 4Q04A 1KQMC 1A75A 3FIAA 2M0RA 1YUSA 2MAZA 3IQOA 1XA5A 2KPHA 1K96A 3VRPA 1NP8A 2KAXA 2NLNA 4PALA 3D75A 2Y5IA 2BCXA 3BJHA 4OZDA 2L50A 5I2OA 1NX0A 1XK4A 2Y1NA 5HKZA 2ZNDA 3C1VA 2JZIA 1SCMB 3N7HA 1K9UA 3SG6A 1B1GA 1JWDA 4JD9A 1AUIB 3S0FA 4CFRA 2KI6D 2L5YA 4FQOA 5HLOA 1DJHA 3CLNA 2K7CA 1L7ZA 4CIDA 4OR9B 1WDCC 5KU1A 1DJGA 1KFUL 1M63B 2LANA 2LCPA 3R72A 2FCDA 4MZKA 2H61A 2HETA 1SSEB 3CTNA 2JTTA 4MRXA 4USLA 4PHMA 1SCVA 1DT7B 2PSRA 1QJTA 3DF0A 2JC2A 2I18A 2KI4C 4E68A 2RGIA 3DY9A 4OV2A 2QPTA 2WORA 1CFDA 4IL1A 3BOWB 3UO9A 4ETOA 2LMUA 1QX2A 3RM1A 1AJ5A 3PM8A 3OX5A 1J7PA 1UURA 1WRZA 1CB1A 4AQIA 1K9KA 3OHMB 2KQ6A 2L5XB 2ZN9A 1TUZA 2MHHA 3DYEA 4MSPA 4CFQA 1IKUA 1S6IA 2K60A 2IS9A 3PN7B 3SIBA 1DTLA 1FBVA 5I2LA 5HL1A 3I5GB 2SASA 3R1OA 2WCEA 1MUXA 1SYMA 1SY9A 5AERA 5AXIA 5J3XA 3IVTA 1XFUO 2LVJA 5DKNA 1SCMC 4ORAB 2WCFA 1JF2A 1J7QA 1CLBA 1XYDA 1W9ZA 5EL2A 3TUYB 2F2OA 4M2OA 4ZCVA 3CZ2A 4PHJA 1BG1A 3D0YB 1SL7A 3NSIA 2K2FA 2PASA 4A4BA 4L9MA 2M1UA 2LLTA 1DGUA 2K7OA 2BBNA 3EVRA 1DF0B 2KGBC 1M39A 3S0AA 1K95A 3EVVA 1BMOA 1LVCD 1EG3A 1H8BA 1UWOA 4HRGA 1S1EA 3K1EA 4WRIA 1LINA 3CR2A 3SG7A 3NSOA 3WHTB 1FI5A 1QWVA 3OGNA 3B87A 4MEWA 1OZSA 3OBVA 5AEQA 1S36A 2K7BA 1OMRA 4MRYA 1TWOA 3SG3A 1J7RA 1GJYA 1XO5A 3NHTA 3PN7C 1QVIZ 1IQ5A 1SMGA 5AANA 2LP3A 3I5GC 3LK0A 4YGAA 4AOMA 2NZ0A 2M49B 3BUXB 1YRTB 3WHUB 5D3OA 2P71A 3CZ0A 4DCKA 4U8DA 1JUOA 1C3ZA 3F45A 1CFCA 3BUOB 4OVNF 1L2OB 1MHOA 1UHJA 3FE6A 3D78A 3TUYC 2ZNEA 4TNCA 3FE8A 1B47A 5ER5A 1QIVA 1QV1A 4WQ3A 3Q8IA 2O60A 1NWDA 2JNFA 1UUSA 2K8MB 2ZFDA 4ZCUA 4GGFA 2LNKA 4JKTA 1KK7Z 2KFFA 2QEOA 1SK6D 2ZRTA 4C0JA 2JT0A 5FYXA 2WNDA 3GK2A 1GGWA 5DKQA 1Y1XA 1CM1A 5ER4X 3BUMB 1FW4A 3DF0B 2CXJA 2WCBA 1YUUA 4MVFA 3VRQA 1CDLA 2NCPA 4A4CA 1QV0A 2DOQA 2ZN8A 3NSLA 1KFXL 1OOFA 5D69A 1K8UA 1G8IA 2MRDA 2TN4A 1JBAA 2WOSA 1A2XA 2WCJA 4P5OE 2VRGA 2ZKMX 1RTP1 1B7TZ 1XK4C 1L2OC 2JOJA 2EGDA 1OZOA 4OCIA 2R2IA 1QLSA 1YRUB 3WXAA 1BU3A 3B86A 3FWBA 1WLMA 1D1OA 1VRKA 2OTGB 2LUXA 1QIWA 2YGUA 1YX7A 3QRXA 1IIOA 4PE7A 1WLZA 4I5JA 1IWQA 1SR6B 1C7WA 2K2AA 2JNXA 4PE1A 1BF5A 4XJKA 3D76A 1TNQA 4M2QA 2PYQA 1F8HA 4YBHB 2H61C 2LMTA 2KYFA 1BT6A 1Y6WA 3BUWB 2BNXA 1B8CA 2E6WA 4YI8A 5CSFA 1ZMZA 1QX5B 3GK4X 1IGVA 2MA2A 1OMDA 1DJIA 3TS5C 5GQQC 1BR4B 4BY5A 1S26D 1YTZC 1EG4A 1MF8B 1C3YA 1K2HA 3OB1B 3PSRA 2F3YA 2JTZA 4N1FA 5FI2A 3SG4A 3D73A 4WQ2A 3V2LA 3BUNB 2PALA 1M46A 1IG5A 3QMEA 2M97A 1JSAA 4GBAA 1DC1A 1SNLA 1TTXA 2Q4UA 2LLSA 2M3WA 1MXEA 1YURA 1ZACA 3O6BA 1PRWA 4MBEA 1YR5A 3A8RA 3VRNA 1KFXS 1BOCA 3B6XA 1F55A 3D77A 1SPYA 2OTGC 1TCOB 1QS7A 2M29A 2FJYA 3CZTX 1F4OA 4YRUA 1SR6C 1TUJA 2BE6A 2LP2A 4GUKA 1DGVA 4NDDA 5FI6A 5I8NA 2LLUA 1CDPA 4I5NB 4C0KA 1Q80A 4FTGA 5HYDA 2K0JA 3EVUA 5G08A 2LHIA 3BXKA 1S5GZ 2BAPA 3CGAA 2KLDA 3NHIA 1Z4HA 2L4HA 4ORCB 1NSHA 1R2UA 2PRUA 2QEHA 2BE4A 3DD4A 1ALWA 4C0LA 1NPQA 1MR8A 2LC5A 4PE0A 2I94A 1AVSA 3S0EA 3H4SE 2BKIB 5PALA 5CSIA 2Y4QA 2I2RE 3WNXB 1IRJA 1UHIA 1RK9A 1HT9A 2CTNA 1NCXA 1X02A 4YGBB 3CYZA 3NGVA 4GFTA 2JPOA 1WY9A 1U5IA 1Y0VH 2KI6C 4PDZA 3RLZA 3SJSA 2KGRA 3M0WA 4R1EA 2LVIA 1IJ6A 4DUQA 3TZ1A 2GGMA 4I5KA 4CLNA 1K93D 1YVLA 2WC5A 2WCMA 1JFKA 3EG5B 3IQQA 4INWA 1TNWA 1H4BA 2B1UA 1KFUS 2KOTA 1F54A 1B9AA 3PM2A 2QEBA 2O5GA 3DVMA 3FE9A 2ISDA 1A75B 3GK1A 5B8IB 1CLMA 1XFXO 1CM4A 2KDHA 2M7NA 2SCPA 2Y1MA 4NDBA 4JPZB 3JTDB 4GGFC 3LCPC 5HKWA 1PALA 4XJKB 3K21A 1TIZA 3AKAA 3KHEA 3PFVA 1BODA 1TCFA 4NQGA 2JXCA 4DRWA 1NX1A 1QXPA 3EKJA 3SG5A 1JF0A 1RJVA 3AAJA 1AHRA 3TDZA 2KAYA 1WRLA 4PHKA 2A4JA 1IH0A 4QJ3B 2M7LA 1K94A 2COLB 2OPOA 1E8AA 4PHNA 2E30A 3CR4X 2V53A 3NSKA 1GGZA 4MZLA 5BPJA 1A29A 1PK0D 1QVIY 2KAVA 1CLLA 2QDIA 3D10A 5KSZA 1XFWO 1CMGA 1J55A 4HSZA 3SIAA 1MXLC 1XFRA 2QACA 4MZJA 1ZFSA 1FF1A 1HQVA 2NXQA 3FWCA 1M31A 3CWGA 5I94A 1NIWA 1UHNA 1CTRA 3SG2A 1TNXA 1UP5A 2F3ZA 1UHHA 1UHKA 4NDCA 4DIRA 4JQ0D 1PVBA 2P6BB 1N0YA 1RWYA 2LAPA 3JTDC 3EK8A 2CT9A 2GGZA 4ICBA 3S0DA 3SS4A 3DVKA 1SL9A 3BQ3A 1YUTA 3L4LA 1KK7Y 2F33A 4QJ5B 2LUCA 1PSBA 2H2KA 2BKHB 2OS8B 4CPVA 2KLEA 1W7JB 1S6JA 2BCAA 1P28A 3DXLA 1KSMA 3I5FB 1CDMA 3EK4A 1AJ4A 2JPTA 1ALVA 1XVJA 1DMOA 2L4IA 1J1DA 2CBLA 3JVTB 4PT1A 4DS7A 1F4QA 1OOHA 1OE9B 3PJIA 3FS7A 1SKTA 1CNPA 2JQ6A 1B8LA 3I5IB 5TNCA 3L4AA 1AK8A 2KNEA 2JT8A 2LVKA 2KSPA 2JXLA 4GGNA 1FI6A 3ZWHA 2JU0A 1OW4A 3VRRA 1QLKA 2NCOA 2JULA 2F8PA 2FJUB 1B7TY 2LHLA 3TDIA 5JJGA 3HX4A 2WCKA 2ERBA 3CABA 1RFJA 1PSRA 4YGDB 1F71A 1FPWA 3EKHA 1A03A 2I7AA 2KFGA 3S0GA 3O2PA 4D1EA 4IJ7A 1OOJA 1PULA 3S0BA 1G4YR 4N5XA 4F0ZB 4FQTA 2P70A 1Z2CB 1C7VA 2LMVA 2GTEA 1NX3A 2OS8C 1B8RA 1YX8A 2JT3A 3BFBA 4XYNA 3KF9A 4GAOA 3B88A 3R1PA 4I5LB 1R6PA 3AAKA 3CS1A 2FOTA 3L47A 1OSAA 4AQJA 3I5FC 5IBWA 1KCYA 1NCYA 3KEVA 2MJWB 3NXAA 5JOLA 1AP4A 1S3PA 3JVTC 5CPVA 2AUCA 2L0PA 1SL8A 2L51A 5DICA 2WCHA 1GM0A 3I5IC 1F70A
chains in the Genus database with same CATH topology
3LLEA 1DVIA 3A4UB 2EC6B 1JC2A 2AMIA 1YVHA 2GV5A 4PCWA 2HQ8A 3PLFB 1EXRA 1PVAA 1NYAA 2LE9B 3I5HB 2BBMA 2KFHA 1K90D 1BLQA 2JWWA 1DJXA 1SBJA 3E3RA 5CSJA 2CCMA 2HF5A 3CR5X 1V1FA 1TRFA 1DJZA 1M45A 5D7FA 2ZRSA 3BYAA 3MSEB 1S6CA 2KQYA 1KQVA 3AKBA 5AFPA 1WRKA 1BR1B 5K89A 1QATA 1RROA 3KPXA 1TN4A 1EL4A 1KWOB 2M9GA 1ODBA 1IJ5A 2L2EA 3OB2B 4YGCB 3TDUA 1S5GY 2KYCA 2BL0B 2WC8A 2Q91A 2KBIA 3GOFA 4N1GA 1CDNA 1CKKA 1B4CA 2G2BA 2KHNA 5HLVA 2EC6C 3PALA 5CSNA 2M8UA 1TNPA 2FCEA 1ZOTB 4HRHA 2L98A 5DKRA 1LA3A 2MLFC 1Y1UA 2K61A 3IF7A 4HREE 1W7IB 1NCZA 3I5HC 1CMFA 1IQ3A 1MWNA 1OQPA 1QX7A 3DVJA 3KO0A 1J1EA 2JRFA 4JWQA 1LXFC 3BOWA 1XFZO 1SRAA 2HQWA 2K7DA 2AAOA 1ZUZA 2LV7A 3VROA 4OKHA 3LL8B 3O4YA 5KTYA 1GQMA 1CFFA 1KK8B 1N65A 2M1KB 1KSOA 4UPGA 1KWOC 1KQMB 1Y1AA 3ICBA 2BL0C 1NX2A 3OX6A 4GNKB 2EHBA 2G9BA 1N2DA 2MLEC 1EH2A 1LKJA 3PATA 1C07A 1XFYO 3LK1A 1LA0A 1QTXA 4YI9A 4YGEB 1A4PA 1OMVA 3D0YA 1EJ3A 1CFPA 1BJFA 2PMYA 1NUBA 1DJWA 3EK7A 3TS5B 2CNPA 2MBXA 1JFJA 1TOPA 3VGOA 1DF0A 5F6TA 1WDCB 1XFVO 4MLWA 1DJYA 1K9PA 2F2PA 4P2YB 1V1GA 1QASA 1SW8A 2LVVA 1RECA 2D8NA 4GPLB 1MQ1A 2KI4B 5I2QA 2BCBA 2KBMA 3HCMA 4BY4A 2PVBA 3OP0A 1KK8C 4PE4A 1G33A 1U5IB 2BECA 2HPSA 3DVEA 3O78A 4ORBB 4QJ4B 5HKYA 1J7OA 4MN0A 2LM5A 4M2PA 3ZNIA 4Q04A 1KQMC 1A75A 3FIAA 2M0RA 1YUSA 2MAZA 3IQOA 1XA5A 1K96A 3VRPA 1NP8A 2KAXA 2NLNA 4PALA 5I2OA 2Y5IA 2BCXA 2L50A 1NX0A 1XK4A 2Y1NA 5HKZA 2ZNDA 3C1VA 2JZIA 1SCMB 1K9UA 3SG6A 1B1GA 1JWDA 1AUIB 4CFRA 2KI6D 4FQOA 5HLOA 1DJHA 3CLNA 2K7CA 1L7ZA 4CIDA 4OR9B 1WDCC 5KU1A 1DJGA 1KFUL 1M63B 2LANA 2LCPA 4MZKA 2FCDA 2H61A 2HETA 3CTNA 4MRXA 2JTTA 4USLA 1DT7B 4PHMA 1SCVA 2PSRA 1QJTA 3DF0A 2JC2A 2I18A 2KI4C 4E68A 2RGIA 4OV2A 2QPTA 2WORA 1CFDA 4IL1A 3BOWB 4ETOA 2LMUA 1QX2A 3RM1A 1AJ5A 3PM8A 3OX5A 1J7PA 1UURA 1WRZA 1CB1A 4AQIA 1K9KA 3OHMB 2KQ6A 2L5XB 2ZN9A 2MHHA 4MSPA 4CFQA 1IKUA 1S6IA 3SIBA 2IS9A 3PN7B 1DTLA 1FBVA 5I2LA 3I5GB 2SASA 2WCEA 1MUXA 1SYMA 1SY9A 5AERA 5AXIA 5J3XA 1XFUO 2LVJA 5DKNA 1SCMC 4ORAB 2WCFA 1JF2A 1J7QA 1CLBA 1XYDA 3TUYB 2F2OA 4M2OA 4ZCVA 4PHJA 1BG1A 3D0YB 1SL7A 3NSIA 2K2FA 2PASA 4A4BA 4L9MA 2M1UA 2LLTA 1DGUA 2K7OA 2BBNA 3EVRA 1DF0B 2KGBC 1M39A 1K95A 3EVVA 1BMOA 1LVCD 1EG3A 1H8BA 1UWOA 4HRGA 1S1EA 4WRIA 1LINA 3CR2A 3SG7A 3NSOA 3WHTB 1FI5A 4MEWA 1OZSA 5AEQA 1S36A 2K7BA 1OMRA 4MRYA 3SG3A 1J7RA 1GJYA 1XO5A 3PN7C 1QVIZ 1IQ5A 1SMGA 5AANA 2LP3A 3I5GC 3LK0A 4YGAA 4AOMA 2NZ0A 2M49B 3BUXB 1YRTB 3WHUB 4DCKA 4U8DA 1JUOA 3F45A 1CFCA 3BUOB 4OVNF 1L2OB 1MHOA 1UHJA 3TUYC 2ZNEA 4TNCA 1B47A 5ER5A 1QIVA 1QV1A 4WQ3A 2O60A 1NWDA 2JNFA 1UUSA 2K8MB 2ZFDA 4ZCUA 4GGFA 2LNKA 1KK7Z 2KFFA 1SK6D 2ZRTA 4C0JA 2JT0A 5FYXA 2WNDA 3GK2A 1GGWA 5DKQA 1Y1XA 1CM1A 5ER4X 3BUMB 1FW4A 3DF0B 2CXJA 2WCBA 1YUUA 4MVFA 3VRQA 1CDLA 2NCPA 4A4CA 1QV0A 2DOQA 2ZN8A 3NSLA 1KFXL 5D69A 1K8UA 1G8IA 2MRDA 2TN4A 1JBAA 2WOSA 1A2XA 4P5OE 2VRGA 2ZKMX 1RTP1 1B7TZ 1XK4C 1L2OC 2JOJA 2EGDA 1OZOA 4OCIA 2R2IA 1QLSA 1YRUB 3WXAA 1BU3A 3FWBA 1WLMA 1D1OA 1VRKA 2OTGB 2LUXA 1QIWA 1YX7A 3QRXA 4PE7A 1WLZA 4I5JA 1IWQA 1SR6B 1C7WA 2K2AA 2JNXA 4PE1A 1BF5A 4XJKA 1TNQA 4M2QA 1F8HA 4YBHB 2H61C 2LMTA 2KYFA 1BT6A 1Y6WA 3BUWB 1B8CA 2E6WA 4YI8A 5CSFA 1ZMZA 1QX5B 3GK4X 1IGVA 2MA2A 1OMDA 1DJIA 3TS5C 5GQQC 1BR4B 4BY5A 1S26D 1YTZC 1EG4A 1MF8B 1K2HA 3OB1B 3PSRA 2F3YA 2JTZA 4N1FA 3SG4A 4WQ2A 3BUNB 2PALA 1M46A 1IG5A 2M97A 1JSAA 4GBAA 1SNLA 1TTXA 2Q4UA 2LLSA 2M3WA 1MXEA 1YURA 1ZACA 3O6BA 1PRWA 4MBEA 1YR5A 3A8RA 3VRNA 1KFXS 1BOCA 1F55A 1SPYA 2OTGC 1TCOB 1QS7A 2M29A 3CZTX 1F4OA 4YRUA 1SR6C 2BE6A 2LP2A 4GUKA 1DGVA 4NDDA 5I8NA 2LLUA 1CDPA 4I5NB 4C0KA 1Q80A 4FTGA 5HYDA 2K0JA 3EVUA 5G08A 2LHIA 3BXKA 1S5GZ 3CGAA 2L4HA 4ORCB 1NSHA 1R2UA 2PRUA 2BE4A 3DD4A 1ALWA 4C0LA 1NPQA 1MR8A 2LC5A 4PE0A 2I94A 1AVSA 3H4SE 2BKIB 5PALA 5CSIA 2Y4QA 2I2RE 3WNXB 1IRJA 1UHIA 1RK9A 1HT9A 2CTNA 1NCXA 1X02A 4YGBB 4GFTA 1WY9A 1U5IA 1Y0VH 2KI6C 4PDZA 3RLZA 3SJSA 2KGRA 3M0WA 4R1EA 2LVIA 1IJ6A 4DUQA 3TZ1A 2GGMA 4I5KA 4CLNA 1K93D 1YVLA 1JFKA 3IQQA 1TNWA 1H4BA 2B1UA 1KFUS 2KOTA 1F54A 1B9AA 2O5GA 3DVMA 2ISDA 1A75B 3GK1A 5B8IB 1CLMA 1XFXO 1CM4A 2KDHA 2M7NA 2SCPA 2Y1MA 4NDBA 4JPZB 3JTDB 4GGFC 3LCPC 5HKWA 1PALA 4XJKB 3K21A 1TIZA 3AKAA 3KHEA 3PFVA 1BODA 1TCFA 4NQGA 2JXCA 4DRWA 1NX1A 1QXPA 3EKJA 3SG5A 1JF0A 1RJVA 3AAJA 1AHRA 3TDZA 2KAYA 1WRLA 4PHKA 2A4JA 1IH0A 4QJ3B 2M7LA 1K94A 2COLB 2OPOA 1E8AA 4PHNA 2E30A 3CR4X 2V53A 3NSKA 1GGZA 4MZLA 5BPJA 1A29A 1PK0D 1QVIY 2KAVA 1CLLA 3D10A 5KSZA 1XFWO 1CMGA 1J55A 4HSZA 3SIAA 1MXLC 2QACA 4MZJA 1ZFSA 1FF1A 1HQVA 2NXQA 3FWCA 1M31A 3CWGA 1NIWA 1UHNA 1CTRA 3SG2A 1TNXA 1UP5A 2F3ZA 1UHHA 1UHKA 4NDCA 4DIRA 4JQ0D 1PVBA 2P6BB 1N0YA 1RWYA 2LAPA 3JTDC 3EK8A 2CT9A 2GGZA 4ICBA 3DVKA 1SL9A 3BQ3A 1YUTA 1KK7Y 2F33A 4QJ5B 2LUCA 1PSBA 2H2KA 2BKHB 2OS8B 4CPVA 1W7JB 1S6JA 2BCAA 1KSMA 3I5FB 1CDMA 3EK4A 1AJ4A 2JPTA 1ALVA 1XVJA 1DMOA 2L4IA 1J1DA 2CBLA 3JVTB 4DS7A 1F4QA 1OE9B 3FS7A 1SKTA 1CNPA 2JQ6A 1B8LA 3I5IB 5TNCA 1AK8A 2KNEA 2JT8A 2LVKA 2KSPA 2JXLA 4GGNA 1FI6A 3ZWHA 2JU0A 3VRRA 1QLKA 2NCOA 2JULA 2F8PA 2FJUB 1B7TY 2LHLA 3TDIA 5JJGA 3HX4A 1RFJA 1PSRA 4YGDB 1F71A 1FPWA 3EKHA 1A03A 2I7AA 2KFGA 3O2PA 4D1EA 1OOJA 1PULA 1G4YR 4N5XA 4F0ZB 1C7VA 2LMVA 1NX3A 2OS8C 1B8RA 1YX8A 2JT3A 4XYNA 3KF9A 4GAOA 4I5LB 1R6PA 3AAKA 3CS1A 2FOTA 4AQJA 1OSAA 1KCYA 3I5FC 5IBWA 1NCYA 3KEVA 2MJWB 3NXAA 5JOLA 1AP4A 1S3PA 3JVTC 5CPVA 2AUCA 2L0PA 1SL8A 2L51A 3I5IC 1F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLE A;  1DVI A;  3A4U B;  2EC6 B;  1JC2 A;  2AMI A;  1YVH A;  2GV5 A;  4PCW A;  2HQ8 A;  3PLF B;  1EXR A;  1PVA A;  1NYA A;  2LE9 B;  3I5H B;  2BBM A;  2KFH A;  1K90 D;  1BLQ A;  2JWW A;  1DJX A;  1SBJ A;  3E3R A;  5CSJ A;  2CCM A;  2HF5 A;  3CR5 X;  1V1F A;  1TRF A;  1DJZ A;  1M45 A;  5D7F A;  2ZRS A;  3BYA A;  3MSE B;  1S6C A;  2KQY A;  1KQV A;  3AKB A;  5AFP A;  1WRK A;  1BR1 B;  5K89 A;  1QAT A;  1RRO A;  3KPX A;  1TN4 A;  1EL4 A;  1KWO B;  2M9G A;  1ODB A;  1IJ5 A;  2L2E A;  3OB2 B;  4YGC B;  3TDU A;  1S5G Y;  2KYC A;  2BL0 B;  2WC8 A;  2Q91 A;  2KBI A;  3GOF A;  4N1G A;  1CDN A;  1CKK A;  1B4C A;  2G2B A;  2KHN A;  5HLV A;  2EC6 C;  3PAL A;  5CSN A;  2M8U A;  1TNP A;  2FCE A;  1ZOT B;  4HRH A;  2L98 A;  5DKR A;  1LA3 A;  2MLF C;  1Y1U A;  2K61 A;  3IF7 A;  4HRE E;  1W7I B;  1NCZ A;  3I5H C;  1CMF A;  1IQ3 A;  1MWN A;  1OQP A;  1QX7 A;  3DVJ A;  3KO0 A;  1J1E A;  2JRF A;  4JWQ A;  1LXF C;  3BOW A;  1XFZ O;  1SRA A;  2HQW A;  2K7D A;  2AAO A;  1ZUZ A;  2LV7 A;  3VRO A;  4OKH A;  3LL8 B;  3O4Y A;  5KTY A;  1GQM A;  1CFF A;  1KK8 B;  1N65 A;  2M1K B;  1KSO A;  4UPG A;  1KWO C;  1KQM B;  1Y1A A;  3ICB A;  2BL0 C;  1NX2 A;  3OX6 A;  4GNK B;  2EHB A;  2G9B A;  1N2D A;  2MLE C;  1EH2 A;  1LKJ A;  3PAT A;  1C07 A;  1XFY O;  3LK1 A;  1LA0 A;  1QTX A;  4YI9 A;  4YGE B;  1A4P A;  1OMV A;  3D0Y A;  1EJ3 A;  1CFP A;  1BJF A;  2PMY A;  1NUB A;  1DJW A;  3EK7 A;  3TS5 B;  2CNP A;  2MBX A;  1JFJ A;  1TOP A;  3VGO A;  1DF0 A;  5F6T A;  1WDC B;  1XFV O;  4MLW A;  1DJY A;  1K9P A;  2F2P A;  4P2Y B;  1V1G A;  1QAS A;  1SW8 A;  2LVV A;  1REC A;  2D8N A;  4GPL B;  1MQ1 A;  2KI4 B;  5I2Q A;  2BCB A;  2KBM A;  3HCM A;  4BY4 A;  2PVB A;  3OP0 A;  1KK8 C;  4PE4 A;  1G33 A;  1U5I B;  2BEC A;  2HPS A;  3DVE A;  3O78 A;  4ORB B;  4QJ4 B;  5HKY A;  1J7O A;  4MN0 A;  2LM5 A;  4M2P A;  3ZNI A;  4Q04 A;  1KQM C;  1A75 A;  3FIA A;  2M0R A;  1YUS A;  2MAZ A;  3IQO A;  1XA5 A;  1K96 A;  3VRP A;  1NP8 A;  2KAX A;  2NLN A;  4PAL A;  5I2O A;  2Y5I A;  2BCX A;  2L50 A;  1NX0 A;  1XK4 A;  2Y1N A;  5HKZ A;  2ZND A;  3C1V A;  2JZI A;  1SCM B;  1K9U A;  3SG6 A;  1B1G A;  1JWD A;  1AUI B;  4CFR A;  2KI6 D;  4FQO A;  5HLO A;  1DJH A;  3CLN A;  2K7C A;  1L7Z A;  4CID A;  4OR9 B;  1WDC C;  5KU1 A;  1DJG A;  1KFU L;  1M63 B;  2LAN A;  2LCP A;  4MZK A;  2FCD A;  2H61 A;  2HET A;  3CTN A;  4MRX A;  2JTT A;  4USL A;  1DT7 B;  4PHM A;  1SCV A;  2PSR A;  1QJT A;  3DF0 A;  2JC2 A;  2I18 A;  2KI4 C;  4E68 A;  2RGI A;  4OV2 A;  2QPT A;  2WOR A;  1CFD A;  4IL1 A;  3BOW B;  4ETO A;  2LMU A;  1QX2 A;  3RM1 A;  1AJ5 A;  3PM8 A;  3OX5 A;  1J7P A;  1UUR A;  1WRZ A;  1CB1 A;  4AQI A;  1K9K A;  3OHM B;  2KQ6 A;  2L5X B;  2ZN9 A;  2MHH A;  4MSP A;  4CFQ A;  1IKU A;  1S6I A;  3SIB A;  2IS9 A;  3PN7 B;  1DTL A;  1FBV A;  5I2L A;  3I5G B;  2SAS A;  2WCE A;  1MUX A;  1SYM A;  1SY9 A;  5AER A;  5AXI A;  5J3X A;  1XFU O;  2LVJ A;  5DKN A;  1SCM C;  4ORA B;  2WCF A;  1JF2 A;  1J7Q A;  1CLB A;  1XYD A;  3TUY B;  2F2O A;  4M2O A;  4ZCV A;  4PHJ A;  1BG1 A;  3D0Y B;  1SL7 A;  3NSI A;  2K2F A;  2PAS A;  4A4B A;  4L9M A;  2M1U A;  2LLT A;  1DGU A;  2K7O A;  2BBN A;  3EVR A;  1DF0 B;  2KGB C;  1M39 A;  1K95 A;  3EVV A;  1BMO A;  1LVC D;  1EG3 A;  1H8B A;  1UWO A;  4HRG A;  1S1E A;  4WRI A;  1LIN A;  3CR2 A;  3SG7 A;  3NSO A;  3WHT B;  1FI5 A;  4MEW A;  1OZS A;  5AEQ A;  1S36 A;  2K7B A;  1OMR A;  4MRY A;  3SG3 A;  1J7R A;  1GJY A;  1XO5 A;  3PN7 C;  1QVI Z;  1IQ5 A;  1SMG A;  5AAN A;  2LP3 A;  3I5G C;  3LK0 A;  4YGA A;  4AOM A;  2NZ0 A;  2M49 B;  3BUX B;  1YRT B;  3WHU B;  4DCK A;  4U8D A;  1JUO A;  3F45 A;  1CFC A;  3BUO B;  4OVN F;  1L2O B;  1MHO A;  1UHJ A;  3TUY C;  2ZNE A;  4TNC A;  1B47 A;  5ER5 A;  1QIV A;  1QV1 A;  4WQ3 A;  2O60 A;  1NWD A;  2JNF A;  1UUS A;  2K8M B;  2ZFD A;  4ZCU A;  4GGF A;  2LNK A;  1KK7 Z;  2KFF A;  1SK6 D;  2ZRT A;  4C0J A;  2JT0 A;  5FYX A;  2WND A;  3GK2 A;  1GGW A;  5DKQ A;  1Y1X A;  1CM1 A;  5ER4 X;  3BUM B;  1FW4 A;  3DF0 B;  2CXJ A;  2WCB A;  1YUU A;  4MVF A;  3VRQ A;  1CDL A;  2NCP A;  4A4C A;  1QV0 A;  2DOQ A;  2ZN8 A;  3NSL A;  1KFX L;  5D69 A;  1K8U A;  1G8I A;  2MRD A;  2TN4 A;  1JBA A;  2WOS A;  1A2X A;  4P5O E;  2VRG A;  2ZKM X;  1RTP 1;  1B7T Z;  1XK4 C;  1L2O C;  2JOJ A;  2EGD A;  1OZO A;  4OCI A;  2R2I A;  1QLS A;  1YRU B;  3WXA A;  1BU3 A;  3FWB A;  1WLM A;  1D1O A;  1VRK A;  2OTG B;  2LUX A;  1QIW A;  1YX7 A;  3QRX A;  4PE7 A;  1WLZ A;  4I5J A;  1IWQ A;  1SR6 B;  1C7W A;  2K2A A;  2JNX A;  4PE1 A;  1BF5 A;  4XJK A;  1TNQ A;  4M2Q A;  1F8H A;  4YBH B;  2H61 C;  2LMT A;  2KYF A;  1BT6 A;  1Y6W A;  3BUW B;  1B8C A;  2E6W A;  4YI8 A;  5CSF A;  1ZMZ A;  1QX5 B;  3GK4 X;  1IGV A;  2MA2 A;  1OMD A;  1DJI A;  3TS5 C;  5GQQ C;  1BR4 B;  4BY5 A;  1S26 D;  1YTZ C;  1EG4 A;  1MF8 B;  1K2H A;  3OB1 B;  3PSR A;  2F3Y A;  2JTZ A;  4N1F A;  3SG4 A;  4WQ2 A;  3BUN B;  2PAL A;  1M46 A;  1IG5 A;  2M97 A;  1JSA A;  4GBA A;  1SNL A;  1TTX A;  2Q4U A;  2LLS A;  2M3W A;  1MXE A;  1YUR A;  1ZAC A;  3O6B A;  1PRW A;  4MBE A;  1YR5 A;  3A8R A;  3VRN A;  1KFX S;  1BOC A;  1F55 A;  1SPY A;  2OTG C;  1TCO B;  1QS7 A;  2M29 A;  3CZT X;  1F4O A;  4YRU A;  1SR6 C;  2BE6 A;  2LP2 A;  4GUK A;  1DGV A;  4NDD A;  5I8N A;  2LLU A;  1CDP A;  4I5N B;  4C0K A;  1Q80 A;  4FTG A;  5HYD A;  2K0J A;  3EVU A;  5G08 A;  2LHI A;  3BXK A;  1S5G Z;  3CGA A;  2L4H A;  4ORC B;  1NSH A;  1R2U A;  2PRU A;  2BE4 A;  3DD4 A;  1ALW A;  4C0L A;  1NPQ A;  1MR8 A;  2LC5 A;  4PE0 A;  2I94 A;  1AVS A;  3H4S E;  2BKI B;  5PAL A;  5CSI A;  2Y4Q A;  2I2R E;  3WNX B;  1IRJ A;  1UHI A;  1RK9 A;  1HT9 A;  2CTN A;  1NCX A;  1X02 A;  4YGB B;  4GFT A;  1WY9 A;  1U5I A;  1Y0V H;  2KI6 C;  4PDZ A;  3RLZ A;  3SJS A;  2KGR A;  3M0W A;  4R1E A;  2LVI A;  1IJ6 A;  4DUQ A;  3TZ1 A;  2GGM A;  4I5K A;  4CLN A;  1K93 D;  1YVL A;  1JFK A;  3IQQ A;  1TNW A;  1H4B A;  2B1U A;  1KFU S;  2KOT A;  1F54 A;  1B9A A;  2O5G A;  3DVM A;  2ISD A;  1A75 B;  3GK1 A;  5B8I B;  1CLM A;  1XFX O;  1CM4 A;  2KDH A;  2M7N A;  2SCP A;  2Y1M A;  4NDB A;  4JPZ B;  3JTD B;  4GGF C;  3LCP C;  5HKW A;  1PAL A;  4XJK B;  3K21 A;  1TIZ A;  3AKA A;  3KHE A;  3PFV A;  1BOD A;  1TCF A;  4NQG A;  2JXC A;  4DRW A;  1NX1 A;  1QXP A;  3EKJ A;  3SG5 A;  1JF0 A;  1RJV A;  3AAJ A;  1AHR A;  3TDZ A;  2KAY A;  1WRL A;  4PHK A;  2A4J A;  1IH0 A;  4QJ3 B;  2M7L A;  1K94 A;  2COL B;  2OPO A;  1E8A A;  4PHN A;  2E30 A;  3CR4 X;  2V53 A;  3NSK A;  1GGZ A;  4MZL A;  5BPJ A;  1A29 A;  1PK0 D;  1QVI Y;  2KAV A;  1CLL A;  3D10 A;  5KSZ A;  1XFW O;  1CMG A;  1J55 A;  4HSZ A;  3SIA A;  1MXL C;  2QAC A;  4MZJ A;  1ZFS A;  1FF1 A;  1HQV A;  2NXQ A;  3FWC A;  1M31 A;  3CWG A;  1NIW A;  1UHN A;  1CTR A;  3SG2 A;  1TNX A;  1UP5 A;  2F3Z A;  1UHH A;  1UHK A;  4NDC A;  4DIR A;  4JQ0 D;  1PVB A;  2P6B B;  1N0Y A;  1RWY A;  2LAP A;  3JTD C;  3EK8 A;  2CT9 A;  2GGZ A;  4ICB A;  3DVK A;  1SL9 A;  3BQ3 A;  1YUT A;  1KK7 Y;  2F33 A;  4QJ5 B;  2LUC A;  1PSB A;  2H2K A;  2BKH B;  2OS8 B;  4CPV A;  1W7J B;  1S6J A;  2BCA A;  1KSM A;  3I5F B;  1CDM A;  3EK4 A;  1AJ4 A;  2JPT A;  1ALV A;  1XVJ A;  1DMO A;  2L4I A;  1J1D A;  2CBL A;  3JVT B;  4DS7 A;  1F4Q A;  1OE9 B;  3FS7 A;  1SKT A;  1CNP A;  2JQ6 A;  1B8L A;  3I5I B;  5TNC A;  1AK8 A;  2KNE A;  2JT8 A;  2LVK A;  2KSP A;  2JXL A;  4GGN A;  1FI6 A;  3ZWH A;  2JU0 A;  3VRR A;  1QLK A;  2NCO A;  2JUL A;  2F8P A;  2FJU B;  1B7T Y;  2LHL A;  3TDI A;  5JJG A;  3HX4 A;  1RFJ A;  1PSR A;  4YGD B;  1F71 A;  1FPW A;  3EKH A;  1A03 A;  2I7A A;  2KFG A;  3O2P A;  4D1E A;  1OOJ A;  1PUL A;  1G4Y R;  4N5X A;  4F0Z B;  1C7V A;  2LMV A;  1NX3 A;  2OS8 C;  1B8R A;  1YX8 A;  2JT3 A;  4XYN A;  3KF9 A;  4GAO A;  4I5L B;  1R6P A;  3AAK A;  3CS1 A;  2FOT A;  4AQJ A;  1OSA A;  1KCY A;  3I5F C;  5IBW A;  1NCY A;  3KEV A;  2MJW B;  3NXA A;  5JOL A;  1AP4 A;  1S3P A;  3JVT C;  5CPV A;  2AUC A;  2L0P A;  1SL8 A;  2L51 A;  3I5I C;  1F70 A; 
#chains in the Genus database with same CATH topology
 3LLE A;  1DVI A;  3A4U B;  2EC6 B;  1JC2 A;  2AMI A;  1YVH A;  2GV5 A;  4PCW A;  1DEK A;  2HQ8 A;  1ORG A;  3PLF B;  1EXR A;  1PVA A;  1NYA A;  2LE9 B;  3I5H B;  2WC6 A;  2BBM A;  3RZS A;  2KFH A;  1K90 D;  1BLQ A;  2JWW A;  1DJX A;  1SBJ A;  3E3R A;  5CSJ A;  2CCM A;  2HF5 A;  3CR5 X;  1V1F A;  3SS5 A;  1TRF A;  1DJZ A;  1M45 A;  5D7F A;  2ZRS A;  3BFA A;  3BYA A;  3B7A A;  1S6C A;  3MSE B;  3D74 A;  2KQY A;  1KQV A;  3AKB A;  5AFP A;  1WRK A;  1BR1 B;  2H8V A;  5K89 A;  1QAT A;  1RRO A;  3KPX A;  1TN4 A;  1EL4 A;  1KWO B;  2M9G A;  1ODB A;  1IJ5 A;  1OOG A;  2L2E A;  3OB2 B;  4YGC B;  3TDU A;  1S5G Y;  4F7F A;  2KYC A;  2BL0 B;  2WC8 A;  2Q91 A;  2KBI A;  3GOF A;  4INX A;  3O4X A;  4N1G A;  1CDN A;  1CKK A;  1B4C A;  2G2B A;  2KHN A;  5HLV A;  2EC6 C;  3PAL A;  5CSN A;  2M8U A;  1TNP A;  2FCE A;  1DQE A;  1ZOT B;  2L98 A;  4HRH A;  5DKR A;  1LA3 A;  2MLF C;  3DZT A;  5FI7 A;  1Y1U A;  2K61 A;  3IF7 A;  4HRE E;  1W7I B;  1NCZ A;  3I5H C;  1CMF A;  1IQ3 A;  1OOI X;  1MWN A;  1OQP A;  1QX7 A;  3DVJ A;  3KO0 A;  1J1E A;  2JRF A;  4JWQ A;  1LXF C;  3BOW A;  1XFZ O;  1SRA A;  3BFH A;  2HQW A;  2K7D A;  2AAO A;  1ZUZ A;  2LV7 A;  3VRO A;  4OKH A;  3LL8 B;  3O4Y A;  5KTY A;  1GQM A;  4KYN A;  1CFF A;  1KK8 B;  1N65 A;  3UNW A;  2M1K B;  1LS8 A;  1KSO A;  4UPG A;  1KWO C;  3VB1 A;  1KQM B;  3R1V A;  1Y1A A;  1T14 A;  3ICB A;  2BL0 C;  1NX2 A;  3OX6 A;  4GNK B;  2EHB A;  2G9B A;  1N2D A;  2MLE C;  1EH2 A;  1LKJ A;  3PAT A;  2WCL A;  1C07 A;  1XFY O;  3LK1 A;  1LA0 A;  1QTX A;  4YI9 A;  4YGE B;  1DEL A;  1A4P A;  1OMV A;  3D0Y A;  1EJ3 A;  1CFP A;  1BJF A;  2PMY A;  1NUB A;  1DJW A;  3EK7 A;  3TS5 B;  2CNP A;  2MBX A;  1JFJ A;  1TOP A;  3VGO A;  1DF0 A;  2L2C A;  3SS3 A;  5F6T A;  1WDC B;  1XFV O;  2PQL A;  4MLW A;  1DJY A;  1K9P A;  2F2P A;  3CDN A;  4P2Y B;  1V1G A;  1QAS A;  1SW8 A;  2LVV A;  1REC A;  2D8N A;  4GPL B;  1MQ1 A;  2KI4 B;  5I2Q A;  2QEV A;  2BCB A;  2KBM A;  3HCM A;  4BY4 A;  2PVB A;  3OP0 A;  1KK8 C;  4PE4 A;  3CZ1 A;  1G33 A;  1U5I B;  2BEC A;  2HPS A;  3DVE A;  3O78 A;  4ORB B;  4QJ4 B;  5HKY A;  1J7O A;  4MN0 A;  2LM5 A;  4M2P A;  3ZNI A;  4Q04 A;  1KQM C;  1A75 A;  3FIA A;  2M0R A;  1YUS A;  2MAZ A;  3IQO A;  1XA5 A;  2KPH A;  1K96 A;  3VRP A;  1NP8 A;  2KAX A;  2NLN A;  4PAL A;  3D75 A;  2Y5I A;  2BCX A;  3BJH A;  4OZD A;  2L50 A;  5I2O A;  1NX0 A;  1XK4 A;  2Y1N A;  5HKZ A;  2ZND A;  3C1V A;  2JZI A;  1SCM B;  3N7H A;  1K9U A;  3SG6 A;  1B1G A;  1JWD A;  4JD9 A;  1AUI B;  3S0F A;  4CFR A;  2KI6 D;  2L5Y A;  4FQO A;  5HLO A;  1DJH A;  3CLN A;  2K7C A;  1L7Z A;  4CID A;  4OR9 B;  1WDC C;  5KU1 A;  1DJG A;  1KFU L;  1M63 B;  2LAN A;  2LCP A;  3R72 A;  2FCD A;  4MZK A;  2H61 A;  2HET A;  1SSE B;  3CTN A;  2JTT A;  4MRX A;  4USL A;  4PHM A;  1SCV A;  1DT7 B;  2PSR A;  1QJT A;  3DF0 A;  2JC2 A;  2I18 A;  2KI4 C;  4E68 A;  2RGI A;  3DY9 A;  4OV2 A;  2QPT A;  2WOR A;  1CFD A;  4IL1 A;  3BOW B;  3UO9 A;  4ETO A;  2LMU A;  1QX2 A;  3RM1 A;  1AJ5 A;  3PM8 A;  3OX5 A;  1J7P A;  1UUR A;  1WRZ A;  1CB1 A;  4AQI A;  1K9K A;  3OHM B;  2KQ6 A;  2L5X B;  2ZN9 A;  1TUZ A;  2MHH A;  3DYE A;  4MSP A;  4CFQ A;  1IKU A;  1S6I A;  2K60 A;  2IS9 A;  3PN7 B;  3SIB A;  1DTL A;  1FBV A;  5I2L A;  5HL1 A;  3I5G B;  2SAS A;  3R1O A;  2WCE A;  1MUX A;  1SYM A;  1SY9 A;  5AER A;  5AXI A;  5J3X A;  3IVT A;  1XFU O;  2LVJ A;  5DKN A;  1SCM C;  4ORA B;  2WCF A;  1JF2 A;  1J7Q A;  1CLB A;  1XYD A;  1W9Z A;  5EL2 A;  3TUY B;  2F2O A;  4M2O A;  4ZCV A;  3CZ2 A;  4PHJ A;  1BG1 A;  3D0Y B;  1SL7 A;  3NSI A;  2K2F A;  2PAS A;  4A4B A;  4L9M A;  2M1U A;  2LLT A;  1DGU A;  2K7O A;  2BBN A;  3EVR A;  1DF0 B;  2KGB C;  1M39 A;  3S0A A;  1K95 A;  3EVV A;  1BMO A;  1LVC D;  1EG3 A;  1H8B A;  1UWO A;  4HRG A;  1S1E A;  3K1E A;  4WRI A;  1LIN A;  3CR2 A;  3SG7 A;  3NSO A;  3WHT B;  1FI5 A;  1QWV A;  3OGN A;  3B87 A;  4MEW A;  1OZS A;  3OBV A;  5AEQ A;  1S36 A;  2K7B A;  1OMR A;  4MRY A;  1TWO A;  3SG3 A;  1J7R A;  1GJY A;  1XO5 A;  3NHT A;  3PN7 C;  1QVI Z;  1IQ5 A;  1SMG A;  5AAN A;  2LP3 A;  3I5G C;  3LK0 A;  4YGA A;  4AOM A;  2NZ0 A;  2M49 B;  3BUX B;  1YRT B;  3WHU B;  5D3O A;  2P71 A;  3CZ0 A;  4DCK A;  4U8D A;  1JUO A;  1C3Z A;  3F45 A;  1CFC A;  3BUO B;  4OVN F;  1L2O B;  1MHO A;  1UHJ A;  3FE6 A;  3D78 A;  3TUY C;  2ZNE A;  4TNC A;  3FE8 A;  1B47 A;  5ER5 A;  1QIV A;  1QV1 A;  4WQ3 A;  3Q8I A;  2O60 A;  1NWD A;  2JNF A;  1UUS A;  2K8M B;  2ZFD A;  4ZCU A;  4GGF A;  2LNK A;  4JKT A;  1KK7 Z;  2KFF A;  2QEO A;  1SK6 D;  2ZRT A;  4C0J A;  2JT0 A;  5FYX A;  2WND A;  3GK2 A;  1GGW A;  5DKQ A;  1Y1X A;  1CM1 A;  5ER4 X;  3BUM B;  1FW4 A;  3DF0 B;  2CXJ A;  2WCB A;  1YUU A;  4MVF A;  3VRQ A;  1CDL A;  2NCP A;  4A4C A;  1QV0 A;  2DOQ A;  2ZN8 A;  3NSL A;  1KFX L;  1OOF A;  5D69 A;  1K8U A;  1G8I A;  2MRD A;  2TN4 A;  1JBA A;  2WOS A;  1A2X A;  2WCJ A;  4P5O E;  2VRG A;  2ZKM X;  1RTP 1;  1B7T Z;  1XK4 C;  1L2O C;  2JOJ A;  2EGD A;  1OZO A;  4OCI A;  2R2I A;  1QLS A;  1YRU B;  3WXA A;  1BU3 A;  3B86 A;  3FWB A;  1WLM A;  1D1O A;  1VRK A;  2OTG B;  2LUX A;  1QIW A;  2YGU A;  1YX7 A;  3QRX A;  1IIO A;  4PE7 A;  1WLZ A;  4I5J A;  1IWQ A;  1SR6 B;  1C7W A;  2K2A A;  2JNX A;  4PE1 A;  1BF5 A;  4XJK A;  3D76 A;  1TNQ A;  4M2Q A;  2PYQ A;  1F8H A;  4YBH B;  2H61 C;  2LMT A;  2KYF A;  1BT6 A;  1Y6W A;  3BUW B;  2BNX A;  1B8C A;  2E6W A;  4YI8 A;  5CSF A;  1ZMZ A;  1QX5 B;  3GK4 X;  1IGV A;  2MA2 A;  1OMD A;  1DJI A;  3TS5 C;  5GQQ C;  1BR4 B;  4BY5 A;  1S26 D;  1YTZ C;  1EG4 A;  1MF8 B;  1C3Y A;  1K2H A;  3OB1 B;  3PSR A;  2F3Y A;  2JTZ A;  4N1F A;  5FI2 A;  3SG4 A;  3D73 A;  4WQ2 A;  3V2L A;  3BUN B;  2PAL A;  1M46 A;  1IG5 A;  3QME A;  2M97 A;  1JSA A;  4GBA A;  1DC1 A;  1SNL A;  1TTX A;  2Q4U A;  2LLS A;  2M3W A;  1MXE A;  1YUR A;  1ZAC A;  3O6B A;  1PRW A;  4MBE A;  1YR5 A;  3A8R A;  3VRN A;  1KFX S;  1BOC A;  3B6X A;  1F55 A;  3D77 A;  1SPY A;  2OTG C;  1TCO B;  1QS7 A;  2M29 A;  2FJY A;  3CZT X;  1F4O A;  4YRU A;  1SR6 C;  1TUJ A;  2BE6 A;  2LP2 A;  4GUK A;  1DGV A;  4NDD A;  5FI6 A;  5I8N A;  2LLU A;  1CDP A;  4I5N B;  4C0K A;  1Q80 A;  4FTG A;  5HYD A;  2K0J A;  3EVU A;  5G08 A;  2LHI A;  3BXK A;  1S5G Z;  2BAP A;  3CGA A;  2KLD A;  3NHI A;  1Z4H A;  2L4H A;  4ORC B;  1NSH A;  1R2U A;  2PRU A;  2QEH A;  2BE4 A;  3DD4 A;  1ALW A;  4C0L A;  1NPQ A;  1MR8 A;  2LC5 A;  4PE0 A;  2I94 A;  1AVS A;  3S0E A;  3H4S E;  2BKI B;  5PAL A;  5CSI A;  2Y4Q A;  2I2R E;  3WNX B;  1IRJ A;  1UHI A;  1RK9 A;  1HT9 A;  2CTN A;  1NCX A;  1X02 A;  4YGB B;  3CYZ A;  3NGV A;  4GFT A;  2JPO A;  1WY9 A;  1U5I A;  1Y0V H;  2KI6 C;  4PDZ A;  3RLZ A;  3SJS A;  2KGR A;  3M0W A;  4R1E A;  2LVI A;  1IJ6 A;  4DUQ A;  3TZ1 A;  2GGM A;  4I5K A;  4CLN A;  1K93 D;  1YVL A;  2WC5 A;  2WCM A;  1JFK A;  3EG5 B;  3IQQ A;  4INW A;  1TNW A;  1H4B A;  2B1U A;  1KFU S;  2KOT A;  1F54 A;  1B9A A;  3PM2 A;  2QEB A;  2O5G A;  3DVM A;  3FE9 A;  2ISD A;  1A75 B;  3GK1 A;  5B8I B;  1CLM A;  1XFX O;  1CM4 A;  2KDH A;  2M7N A;  2SCP A;  2Y1M A;  4NDB A;  4JPZ B;  3JTD B;  4GGF C;  3LCP C;  5HKW A;  1PAL A;  4XJK B;  3K21 A;  1TIZ A;  3AKA A;  3KHE A;  3PFV A;  1BOD A;  1TCF A;  4NQG A;  2JXC A;  4DRW A;  1NX1 A;  1QXP A;  3EKJ A;  3SG5 A;  1JF0 A;  1RJV A;  3AAJ A;  1AHR A;  3TDZ A;  2KAY A;  1WRL A;  4PHK A;  2A4J A;  1IH0 A;  4QJ3 B;  2M7L A;  1K94 A;  2COL B;  2OPO A;  1E8A A;  4PHN A;  2E30 A;  3CR4 X;  2V53 A;  3NSK A;  1GGZ A;  4MZL A;  5BPJ A;  1A29 A;  1PK0 D;  1QVI Y;  2KAV A;  1CLL A;  2QDI A;  3D10 A;  5KSZ A;  1XFW O;  1CMG A;  1J55 A;  4HSZ A;  3SIA A;  1MXL C;  1XFR A;  2QAC A;  4MZJ A;  1ZFS A;  1FF1 A;  1HQV A;  2NXQ A;  3FWC A;  1M31 A;  3CWG A;  5I94 A;  1NIW A;  1UHN A;  1CTR A;  3SG2 A;  1TNX A;  1UP5 A;  2F3Z A;  1UHH A;  1UHK A;  4NDC A;  4DIR A;  4JQ0 D;  1PVB A;  2P6B B;  1N0Y A;  1RWY A;  2LAP A;  3JTD C;  3EK8 A;  2CT9 A;  2GGZ A;  4ICB A;  3S0D A;  3SS4 A;  3DVK A;  1SL9 A;  3BQ3 A;  1YUT A;  3L4L A;  1KK7 Y;  2F33 A;  4QJ5 B;  2LUC A;  1PSB A;  2H2K A;  2BKH B;  2OS8 B;  4CPV A;  2KLE A;  1W7J B;  1S6J A;  2BCA A;  1P28 A;  3DXL A;  1KSM A;  3I5F B;  1CDM A;  3EK4 A;  1AJ4 A;  2JPT A;  1ALV A;  1XVJ A;  1DMO A;  2L4I A;  1J1D A;  2CBL A;  3JVT B;  4PT1 A;  4DS7 A;  1F4Q A;  1OOH A;  1OE9 B;  3PJI A;  3FS7 A;  1SKT A;  1CNP A;  2JQ6 A;  1B8L A;  3I5I B;  5TNC A;  3L4A A;  1AK8 A;  2KNE A;  2JT8 A;  2LVK A;  2KSP A;  2JXL A;  4GGN A;  1FI6 A;  3ZWH A;  2JU0 A;  1OW4 A;  3VRR A;  1QLK A;  2NCO A;  2JUL A;  2F8P A;  2FJU B;  1B7T Y;  2LHL A;  3TDI A;  5JJG A;  3HX4 A;  2WCK A;  2ERB A;  3CAB A;  1RFJ A;  1PSR A;  4YGD B;  1F71 A;  1FPW A;  3EKH A;  1A03 A;  2I7A A;  2KFG A;  3S0G A;  3O2P A;  4D1E A;  4IJ7 A;  1OOJ A;  1PUL A;  3S0B A;  1G4Y R;  4N5X A;  4F0Z B;  4FQT A;  2P70 A;  1Z2C B;  1C7V A;  2LMV A;  2GTE A;  1NX3 A;  2OS8 C;  1B8R A;  1YX8 A;  2JT3 A;  3BFB A;  4XYN A;  3KF9 A;  4GAO A;  3B88 A;  3R1P A;  4I5L B;  1R6P A;  3AAK A;  3CS1 A;  2FOT A;  3L47 A;  1OSA A;  4AQJ A;  3I5F C;  5IBW A;  1KCY A;  1NCY A;  3KEV A;  2MJW B;  3NXA A;  5JOL A;  1AP4 A;  1S3P A;  3JVT C;  5CPV A;  2AUC A;  2L0P A;  1SL8 A;  2L51 A;  5DIC A;  2WCH A;  1GM0 A;  3I5I C;  1F70 A; 
#chains in the Genus database with same CATH homology
 3LLE A;  1DVI A;  3A4U B;  2EC6 B;  1JC2 A;  2AMI A;  1YVH A;  2GV5 A;  4PCW A;  2HQ8 A;  3PLF B;  1EXR A;  1PVA A;  1NYA A;  2LE9 B;  3I5H B;  2BBM A;  2KFH A;  1K90 D;  1BLQ A;  2JWW A;  1DJX A;  1SBJ A;  3E3R A;  5CSJ A;  2CCM A;  2HF5 A;  3CR5 X;  1V1F A;  1TRF A;  1DJZ A;  1M45 A;  5D7F A;  2ZRS A;  3BYA A;  3MSE B;  1S6C A;  2KQY A;  1KQV A;  3AKB A;  5AFP A;  1WRK A;  1BR1 B;  5K89 A;  1QAT A;  1RRO A;  3KPX A;  1TN4 A;  1EL4 A;  1KWO B;  2M9G A;  1ODB A;  1IJ5 A;  2L2E A;  3OB2 B;  4YGC B;  3TDU A;  1S5G Y;  2KYC A;  2BL0 B;  2WC8 A;  2Q91 A;  2KBI A;  3GOF A;  4N1G A;  1CDN A;  1CKK A;  1B4C A;  2G2B A;  2KHN A;  5HLV A;  2EC6 C;  3PAL A;  5CSN A;  2M8U A;  1TNP A;  2FCE A;  1ZOT B;  4HRH A;  2L98 A;  5DKR A;  1LA3 A;  2MLF C;  1Y1U A;  2K61 A;  3IF7 A;  4HRE E;  1W7I B;  1NCZ A;  3I5H C;  1CMF A;  1IQ3 A;  1MWN A;  1OQP A;  1QX7 A;  3DVJ A;  3KO0 A;  1J1E A;  2JRF A;  4JWQ A;  1LXF C;  3BOW A;  1XFZ O;  1SRA A;  2HQW A;  2K7D A;  2AAO A;  1ZUZ A;  2LV7 A;  3VRO A;  4OKH A;  3LL8 B;  3O4Y A;  5KTY A;  1GQM A;  1CFF A;  1KK8 B;  1N65 A;  2M1K B;  1KSO A;  4UPG A;  1KWO C;  1KQM B;  1Y1A A;  3ICB A;  2BL0 C;  1NX2 A;  3OX6 A;  4GNK B;  2EHB A;  2G9B A;  1N2D A;  2MLE C;  1EH2 A;  1LKJ A;  3PAT A;  1C07 A;  1XFY O;  3LK1 A;  1LA0 A;  1QTX A;  4YI9 A;  4YGE B;  1A4P A;  1OMV A;  3D0Y A;  1EJ3 A;  1CFP A;  1BJF A;  2PMY A;  1NUB A;  1DJW A;  3EK7 A;  3TS5 B;  2CNP A;  2MBX A;  1JFJ A;  1TOP A;  3VGO A;  1DF0 A;  5F6T A;  1WDC B;  1XFV O;  4MLW A;  1DJY A;  1K9P A;  2F2P A;  4P2Y B;  1V1G A;  1QAS A;  1SW8 A;  2LVV A;  1REC A;  2D8N A;  4GPL B;  1MQ1 A;  2KI4 B;  5I2Q A;  2BCB A;  2KBM A;  3HCM A;  4BY4 A;  2PVB A;  3OP0 A;  1KK8 C;  4PE4 A;  1G33 A;  1U5I B;  2BEC A;  2HPS A;  3DVE A;  3O78 A;  4ORB B;  4QJ4 B;  5HKY A;  1J7O A;  4MN0 A;  2LM5 A;  4M2P A;  3ZNI A;  4Q04 A;  1KQM C;  1A75 A;  3FIA A;  2M0R A;  1YUS A;  2MAZ A;  3IQO A;  1XA5 A;  1K96 A;  3VRP A;  1NP8 A;  2KAX A;  2NLN A;  4PAL A;  5I2O A;  2Y5I A;  2BCX A;  2L50 A;  1NX0 A;  1XK4 A;  2Y1N A;  5HKZ A;  2ZND A;  3C1V A;  2JZI A;  1SCM B;  1K9U A;  3SG6 A;  1B1G A;  1JWD A;  1AUI B;  4CFR A;  2KI6 D;  4FQO A;  5HLO A;  1DJH A;  3CLN A;  2K7C A;  1L7Z A;  4CID A;  4OR9 B;  1WDC C;  5KU1 A;  1DJG A;  1KFU L;  1M63 B;  2LAN A;  2LCP A;  4MZK A;  2FCD A;  2H61 A;  2HET A;  3CTN A;  4MRX A;  2JTT A;  4USL A;  1DT7 B;  4PHM A;  1SCV A;  2PSR A;  1QJT A;  3DF0 A;  2JC2 A;  2I18 A;  2KI4 C;  4E68 A;  2RGI A;  4OV2 A;  2QPT A;  2WOR A;  1CFD A;  4IL1 A;  3BOW B;  4ETO A;  2LMU A;  1QX2 A;  3RM1 A;  1AJ5 A;  3PM8 A;  3OX5 A;  1J7P A;  1UUR A;  1WRZ A;  1CB1 A;  4AQI A;  1K9K A;  3OHM B;  2KQ6 A;  2L5X B;  2ZN9 A;  2MHH A;  4MSP A;  4CFQ A;  1IKU A;  1S6I A;  3SIB A;  2IS9 A;  3PN7 B;  1DTL A;  1FBV A;  5I2L A;  3I5G B;  2SAS A;  2WCE A;  1MUX A;  1SYM A;  1SY9 A;  5AER A;  5AXI A;  5J3X A;  1XFU O;  2LVJ A;  5DKN A;  1SCM C;  4ORA B;  2WCF A;  1JF2 A;  1J7Q A;  1CLB A;  1XYD A;  3TUY B;  2F2O A;  4M2O A;  4ZCV A;  4PHJ A;  1BG1 A;  3D0Y B;  1SL7 A;  3NSI A;  2K2F A;  2PAS A;  4A4B A;  4L9M A;  2M1U A;  2LLT A;  1DGU A;  2K7O A;  2BBN A;  3EVR A;  1DF0 B;  2KGB C;  1M39 A;  1K95 A;  3EVV A;  1BMO A;  1LVC D;  1EG3 A;  1H8B A;  1UWO A;  4HRG A;  1S1E A;  4WRI A;  1LIN A;  3CR2 A;  3SG7 A;  3NSO A;  3WHT B;  1FI5 A;  4MEW A;  1OZS A;  5AEQ A;  1S36 A;  2K7B A;  1OMR A;  4MRY A;  3SG3 A;  1J7R A;  1GJY A;  1XO5 A;  3PN7 C;  1QVI Z;  1IQ5 A;  1SMG A;  5AAN A;  2LP3 A;  3I5G C;  3LK0 A;  4YGA A;  4AOM A;  2NZ0 A;  2M49 B;  3BUX B;  1YRT B;  3WHU B;  4DCK A;  4U8D A;  1JUO A;  3F45 A;  1CFC A;  3BUO B;  4OVN F;  1L2O B;  1MHO A;  1UHJ A;  3TUY C;  2ZNE A;  4TNC A;  1B47 A;  5ER5 A;  1QIV A;  1QV1 A;  4WQ3 A;  2O60 A;  1NWD A;  2JNF A;  1UUS A;  2K8M B;  2ZFD A;  4ZCU A;  4GGF A;  2LNK A;  1KK7 Z;  2KFF A;  1SK6 D;  2ZRT A;  4C0J A;  2JT0 A;  5FYX A;  2WND A;  3GK2 A;  1GGW A;  5DKQ A;  1Y1X A;  1CM1 A;  5ER4 X;  3BUM B;  1FW4 A;  3DF0 B;  2CXJ A;  2WCB A;  1YUU A;  4MVF A;  3VRQ A;  1CDL A;  2NCP A;  4A4C A;  1QV0 A;  2DOQ A;  2ZN8 A;  3NSL A;  1KFX L;  5D69 A;  1K8U A;  1G8I A;  2MRD A;  2TN4 A;  1JBA A;  2WOS A;  1A2X A;  4P5O E;  2VRG A;  2ZKM X;  1RTP 1;  1B7T Z;  1XK4 C;  1L2O C;  2JOJ A;  2EGD A;  1OZO A;  4OCI A;  2R2I A;  1QLS A;  1YRU B;  3WXA A;  1BU3 A;  3FWB A;  1WLM A;  1D1O A;  1VRK A;  2OTG B;  2LUX A;  1QIW A;  1YX7 A;  3QRX A;  4PE7 A;  1WLZ A;  4I5J A;  1IWQ A;  1SR6 B;  1C7W A;  2K2A A;  2JNX A;  4PE1 A;  1BF5 A;  4XJK A;  1TNQ A;  4M2Q A;  1F8H A;  4YBH B;  2H61 C;  2LMT A;  2KYF A;  1BT6 A;  1Y6W A;  3BUW B;  1B8C A;  2E6W A;  4YI8 A;  5CSF A;  1ZMZ A;  1QX5 B;  3GK4 X;  1IGV A;  2MA2 A;  1OMD A;  1DJI A;  3TS5 C;  5GQQ C;  1BR4 B;  4BY5 A;  1S26 D;  1YTZ C;  1EG4 A;  1MF8 B;  1K2H A;  3OB1 B;  3PSR A;  2F3Y A;  2JTZ A;  4N1F A;  3SG4 A;  4WQ2 A;  3BUN B;  2PAL A;  1M46 A;  1IG5 A;  2M97 A;  1JSA A;  4GBA A;  1SNL A;  1TTX A;  2Q4U A;  2LLS A;  2M3W A;  1MXE A;  1YUR A;  1ZAC A;  3O6B A;  1PRW A;  4MBE A;  1YR5 A;  3A8R A;  3VRN A;  1KFX S;  1BOC A;  1F55 A;  1SPY A;  2OTG C;  1TCO B;  1QS7 A;  2M29 A;  3CZT X;  1F4O A;  4YRU A;  1SR6 C;  2BE6 A;  2LP2 A;  4GUK A;  1DGV A;  4NDD A;  5I8N A;  2LLU A;  1CDP A;  4I5N B;  4C0K A;  1Q80 A;  4FTG A;  5HYD A;  2K0J A;  3EVU A;  5G08 A;  2LHI A;  3BXK A;  1S5G Z;  3CGA A;  2L4H A;  4ORC B;  1NSH A;  1R2U A;  2PRU A;  2BE4 A;  3DD4 A;  1ALW A;  4C0L A;  1NPQ A;  1MR8 A;  2LC5 A;  4PE0 A;  2I94 A;  1AVS A;  3H4S E;  2BKI B;  5PAL A;  5CSI A;  2Y4Q A;  2I2R E;  3WNX B;  1IRJ A;  1UHI A;  1RK9 A;  1HT9 A;  2CTN A;  1NCX A;  1X02 A;  4YGB B;  4GFT A;  1WY9 A;  1U5I A;  1Y0V H;  2KI6 C;  4PDZ A;  3RLZ A;  3SJS A;  2KGR A;  3M0W A;  4R1E A;  2LVI A;  1IJ6 A;  4DUQ A;  3TZ1 A;  2GGM A;  4I5K A;  4CLN A;  1K93 D;  1YVL A;  1JFK A;  3IQQ A;  1TNW A;  1H4B A;  2B1U A;  1KFU S;  2KOT A;  1F54 A;  1B9A A;  2O5G A;  3DVM A;  2ISD A;  1A75 B;  3GK1 A;  5B8I B;  1CLM A;  1XFX O;  1CM4 A;  2KDH A;  2M7N A;  2SCP A;  2Y1M A;  4NDB A;  4JPZ B;  3JTD B;  4GGF C;  3LCP C;  5HKW A;  1PAL A;  4XJK B;  3K21 A;  1TIZ A;  3AKA A;  3KHE A;  3PFV A;  1BOD A;  1TCF A;  4NQG A;  2JXC A;  4DRW A;  1NX1 A;  1QXP A;  3EKJ A;  3SG5 A;  1JF0 A;  1RJV A;  3AAJ A;  1AHR A;  3TDZ A;  2KAY A;  1WRL A;  4PHK A;  2A4J A;  1IH0 A;  4QJ3 B;  2M7L A;  1K94 A;  2COL B;  2OPO A;  1E8A A;  4PHN A;  2E30 A;  3CR4 X;  2V53 A;  3NSK A;  1GGZ A;  4MZL A;  5BPJ A;  1A29 A;  1PK0 D;  1QVI Y;  2KAV A;  1CLL A;  3D10 A;  5KSZ A;  1XFW O;  1CMG A;  1J55 A;  4HSZ A;  3SIA A;  1MXL C;  2QAC A;  4MZJ A;  1ZFS A;  1FF1 A;  1HQV A;  2NXQ A;  3FWC A;  1M31 A;  3CWG A;  1NIW A;  1UHN A;  1CTR A;  3SG2 A;  1TNX A;  1UP5 A;  2F3Z A;  1UHH A;  1UHK A;  4NDC A;  4DIR A;  4JQ0 D;  1PVB A;  2P6B B;  1N0Y A;  1RWY A;  2LAP A;  3JTD C;  3EK8 A;  2CT9 A;  2GGZ A;  4ICB A;  3DVK A;  1SL9 A;  3BQ3 A;  1YUT A;  1KK7 Y;  2F33 A;  4QJ5 B;  2LUC A;  1PSB A;  2H2K A;  2BKH B;  2OS8 B;  4CPV A;  1W7J B;  1S6J A;  2BCA A;  1KSM A;  3I5F B;  1CDM A;  3EK4 A;  1AJ4 A;  2JPT A;  1ALV A;  1XVJ A;  1DMO A;  2L4I A;  1J1D A;  2CBL A;  3JVT B;  4DS7 A;  1F4Q A;  1OE9 B;  3FS7 A;  1SKT A;  1CNP A;  2JQ6 A;  1B8L A;  3I5I B;  5TNC A;  1AK8 A;  2KNE A;  2JT8 A;  2LVK A;  2KSP A;  2JXL A;  4GGN A;  1FI6 A;  3ZWH A;  2JU0 A;  3VRR A;  1QLK A;  2NCO A;  2JUL A;  2F8P A;  2FJU B;  1B7T Y;  2LHL A;  3TDI A;  5JJG A;  3HX4 A;  1RFJ A;  1PSR A;  4YGD B;  1F71 A;  1FPW A;  3EKH A;  1A03 A;  2I7A A;  2KFG A;  3O2P A;  4D1E A;  1OOJ A;  1PUL A;  1G4Y R;  4N5X A;  4F0Z B;  1C7V A;  2LMV A;  1NX3 A;  2OS8 C;  1B8R A;  1YX8 A;  2JT3 A;  4XYN A;  3KF9 A;  4GAO A;  4I5L B;  1R6P A;  3AAK A;  3CS1 A;  2FOT A;  4AQJ A;  1OSA A;  1KCY A;  3I5F C;  5IBW A;  1NCY A;  3KEV A;  2MJW B;  3NXA A;  5JOL A;  1AP4 A;  1S3P A;  3JVT C;  5CPV A;  2AUC A;  2L0P A;  1SL8 A;  2L51 A;  3I5I C;  1F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...