2BECA

Crystal structure of chp2 in complex with its binding region in nhe1 and insights into the mechanism of ph regulation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
181
Chain Sequence
IPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTEKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcineurin B homologous protein 2
publication title Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transport protein
total genus 56
structure length 181
sequence length 186
ec nomenclature
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2becA00
1SRAA 3DD4A 4L9MA 2OS8B 4MRYA 2KI4C 4GBAA 1LINA 1FI5A 1EG3A 1NWDA 4NDCA 1BOCA 1UHKA 4OV2A 1B8LA 1YVLA 1JSAA 3I5GB 1SK6D 3CGAA 3MSEB 5CSFA 4U8DA 2JTZA 2BCAA 4MN0A 1IJ5A 3LL8B 1S6IA 2MLEC 5ER4X 4AOMA 3PN7C 2Y4QA 3TUYB 1BT6A 2SASA 4WQ2A 1PULA 1CFDA 3I5IC 3OX6A 1B8CA 2BE4A 2F2OA 5BPJA 1J55A 5JJGA 2CNPA 1NX3A 2L50A 4MZKA 1QX5B 1SR6C 1XFYO 1WRKA 1NCZA 1XFXO 4PHMA 1BF5A 1QVIY 1SNLA 1U5IA 1Y1XA 2MRDA 1M31A 2LP3A 1K9PA 2AUCA 1JF2A 4YRUA 1PSBA 1QX2A 1BR1B 3A8RA 2H2KA 3I5FC 2K2AA 2Y5IA 2GGZA 1XFWO 1XVJA 1BJFA 3LLEA 1F8HA 1M39A 4OCIA 4M2PA 4HRHA 2PRUA 3SG6A 1RROA 1SMGA 4HSZA 1LXFC 3PN7B 4MEWA 2M1KB 2JT0A 1WLZA 3F45A 2KOTA 2NCPA 2CT9A 1MXEA 2DOQA 2MAZA 3DVJA 4ETOA 1KSMA 3I5IB 2M8UA 1JUOA 4I5KA 2F33A 1KWOC 1DJGA 1RJVA 3IQOA 5KTYA 4ORAB 1K93D 1TCFA 1XFZO 2L98A 1B1GA 1NX1A 2LVKA 3DF0B 2BCXA 2JT3A 3RLZA 1GGWA 3I5FB 1C7VA 1KFXS 2SCPA 2LUCA 3PSRA 5JOLA 4F0ZB 2JC2A 1CMGA 1QJTA 4YGEB 1NX2A 2EC6B 2ZNDA 5ER5A 5DKNA 2KAVA 2M1UA 2EGDA 4ZCVA 1QV0A 2LUXA 4P5OE 4PE4A 1DJXA 1IKUA 1BR4B 1N65A 1A29A 1ODBA 3NSIA 1NYAA 1CLBA 2CXJA 4AQIA 2LLTA 1A2XA 3O4YA 1KFUS 3SIBA 3BXKA 4CIDA 1NPQA 1QVIZ 3EVRA 4PHKA 4C0LA 4DIRA 1FPWA 3BOWB 3TDUA 1S5GY 3LCPC 3CS1A 1J1EA 1UHHA 2JULA 1AJ4A 2QACA 5D69A 2WC8A 1KK8B 1DJHA 2ZKMX 1YRTB 1RK9A 1X02A 2Q4UA 3I5HC 4WRIA 2F2PA 4YI9A 2PMYA 2H61C 2L4HA 1SCVA 1R2UA 1XFVO 1ZMZA 2E6WA 2JZIA 4PHJA 2JT8A 4MLWA 1PVAA 3WXAA 4I5LB 2HQ8A 1ZACA 1S6CA 3HX4A 3PLFB 4JQ0D 1K9KA 1E8AA 4M2OA 1UHIA 2MHHA 4YBHB 1CFFA 3GOFA 1J7QA 3BOWA 4GGNA 3EK7A 2KGBC 3VRPA 2Q91A 1K95A 2BCBA 2LHIA 3I5HB 4PDZA 1OOJA 2M7LA 4DS7A 1CNPA 4PALA 4QJ4B 2L2EA 2L0PA 1BMOA 5CSIA 2NZ0A 1U5IB 4CPVA 2G9BA 1CM4A 1JF0A 5I2LA 1CMFA 1EL4A 4QJ3B 2K8MB 1AK8A 2NXQA 1DT7B 2OTGB 2EHBA 1JC2A 3EKHA 2K0JA 1H4BA 3DVEA 4N5XA 2LNKA 3PALA 1A03A 5I2QA 2VRGA 4DCKA 2TN4A 3BYAA 3H4SE 2F3YA 4OR9B 1NCYA 2JU0A 1XYDA 5HKWA 1OQPA 5B8IB 1D1OA 1BU3A 1MF8B 1S5GZ 1XK4A 2Y1NA 4PE1A 4YGDB 1YX8A 3JVTB 1CFPA 2GGMA 3BUNB 4C0KA 1IQ3A 1SCMC 1YUSA 1F70A 1A75B 1TNQA 1CKKA 1YRUB 1WRLA 3HCMA 2BL0C 3OHMB 1NCXA 1G4YR 2BKIB 2KDHA 2I7AA 1S3PA 3WNXB 2FCDA 1CFCA 1DGVA 2M29A 2JXCA 2LE9B 2RGIA 3OX5A 1JWDA 3VGOA 1QASA 2H61A 4XJKA 1GGZA 1OZOA 1SW8A 2AAOA 2KI4B 2NCOA 1MR8A 1TNPA 1DTLA 4C0JA 1K9UA 4HREE 2JPTA 2V53A 4DUQA 5DKRA 3VRRA 4MRXA 5HLVA 1IH0A 2LANA 1C7WA 1SCMB 5CSJA 1VRKA 1S6JA 3ICBA 2M0RA 1AVSA 1A4PA 2KYFA 1TN4A 1MHOA 3FWCA 4D1EA 1A75A 2LM5A 1JFKA 3BUXB 1HQVA 2M9GA 3VRNA 4DRWA 2KFGA 1FW4A 3CR5X 1SR6B 1EG4A 1HT9A 1YUUA 2PALA 2LC5A 1CDPA 4N1GA 2I94A 4ICBA 4TNCA 3GK1A 2LLUA 1CDMA 1SL7A 5TNCA 1RWYA 1V1GA 4MBEA 3O2PA 4MSPA 1LKJA 2CTNA 2QPTA 1UWOA 4ORBB 1J7OA 2KI6C 1G33A 2E30A 3TZ1A 1Q80A 4R1EA 1BLQA 2KGRA 1QTXA 1KWOB 1W7IB 2K7BA 5AEQA 4BY5A 1BG1A 3SIAA 2LMVA 3TDIA 1B9AA 1XA5A 1OZSA 3EK4A 1IGVA 4CLNA 1QLKA 1QIVA 1TNXA 2KSPA 4I5NB 3EVUA 4YGBB 4CFQA 3CLNA 5AANA 1KCYA 2ZN9A 1WLMA 2AMIA 3E3RA 3BUOB 3CZTX 2K61A 1RTP1 4GUKA 1RFJA 4NDDA 4Q04A 1C07A 2F3ZA 2LMUA 3CR2A 3TDZA 5HLOA 4MZLA 1UP5A 1TOPA 2KFHA 1RECA 2CBLA 1SL8A 2PSRA 3A4UB 1SBJA 2KAXA 2WNDA 4GGFC 3WHUB 2ZN8A 2I2RE 1CDLA 3OP0A 1PK0D 1KFXL 2R2IA 2MBXA 2ISDA 1YVHA 3KHEA 3LK1A 4PCWA 1AHRA 1YURA 2JNFA 2KFFA 3ZNIA 3JTDC 5KSZA 2LP2A 2KBMA 1M46A 1TIZA 2KYCA 1YR5A 2WCBA 1ZUZA 1J7RA 1KQVA 3NXAA 2GV5A 1K96A 2CCMA 1DJYA 1N2DA 1TCOB 2ZFDA 4OKHA 2ZRTA 5G08A 2WCFA 4I5JA 1PSRA 3D0YB 2LLSA 2L4IA 4CFRA 3KF9A 1Y0VH 4FTGA 2LHLA 3AAJA 3VROA 2Y1MA 3TS5C 4XJKB 1KFUL 1KQMC 5CSNA 1LA0A 4QJ5B 3SG4A 1LA3A 1S1EA 4XYNA 1EJ3A 1WY9A 1B7TY 4HRGA 1S26D 5AERA 2KI6D 1AP4A 3EK8A 4MZJA 3SG7A 1IG5A 1K8UA 5AXIA 1K90D 1OMVA 2ZRSA 3FIAA 3FWBA 4YI8A 1LVCD 2FJUB 1L2OC 5GQQC 5IBWA 1KK7Y 5CPVA 4M2QA 4GNKB 2ZNEA 1YUTA 2JRFA 4IL1A 3D0YA 1UURA 2M49B 3KPXA 1SKTA 1PRWA 3BUWB 1F54A 1B47A 2FCEA 3IQQA 4E68A 2D8NA 1MUXA 4USLA 2JNXA 4GGFA 1PALA 5PALA 4MVFA 1JBAA 2K7OA 2OPOA 1MQ1A 1F55A 1F4OA 1DJWA 3LK0A 1FF1A 2L5XB 2NLNA 2B1UA 2WORA 3CWGA 3ZWHA 2KQYA 4A4BA 2LVJA 2LMTA 2BKHB 1TRFA 4YGCB 1S36A 2HETA 1Y6WA 1L2OB 1SY9A 1DJIA 1CB1A 1NP8A 2BL0B 1ALWA 1SL9A 1W7JB 2JXLA 4PHNA 1ZFSA 1XO5A 2BECA 2MA2A 3D10A 4A4CA 3PFVA 2IS9A 3IF7A 3SG3A 1DMOA 4OVNF 3RM1A 1H8BA 4BY4A 1QV1A 1AUIB 2KBIA 5AFPA 1QX7A 1B7TZ 1MXLC 3EVVA 2JWWA 1MWNA 2BBMA 1YX7A 1CM1A 2EC6C 3QRXA 1OE9B 2A4JA 2BE6A 1DF0B 3AKAA 1G8IA 4JPZB 2LAPA 1ALVA 4JWQA 1QATA 1K94A 5FYXA 3AKBA 2KQ6A 3GK4X 1PVBA 1WDCC 1KK7Z 1YTZC 2K7DA 1NX0A 2LCPA 2MJWB 1OMRA 2HQWA 1CDNA 1IJ6A 3K21A 4ORCB 4YGAA 1TNWA 1XFUO 1F71A 5K89A 2BBNA 5HKYA 1ZOTB 1EXRA 2WCEA 1JFJA 4ZCUA 5D7FA 2HPSA 2MLFC 3EKJA 3GK2A 1NUBA 1AJ5A 1SYMA 2COLB 1KK8C 2G2BA 2FOTA 1J7PA 1B8RA 1F4QA 1OSAA 1NSHA 1K2HA 1QXPA 1IWQA 3AAKA 3NSOA 1EH2A 3O6BA 4GAOA 3SJSA 1UUSA 1B4CA 1V1FA 1DF0A 1DGUA 3WHTB 5I8NA 1Y1UA 1WDCB 4PE7A 1OMDA 5HYDA 1GQMA 1IQ5A 2KNEA 1KSOA 5DKQA 4GFTA 2M3WA 3NSKA 3SG5A 1XK4C 3DF0A 1IRJA 1GJYA 3O78A 3DVMA 4GPLB 2O60A 2KAYA 5I2OA 4N1FA 5F6TA 5J3XA 2F8PA 1FI6A 1QS7A 3BUMB 4AQJA 1DVIA 2LV7A 2KHNA 3CTNA 1NIWA 1BODA 3C1VA 3FS7A 3CR4X 3NSLA 2I18A 4NQGA 3OB1B 2PVBA 1TTXA 2OTGC 4UPGA 1J1DA 2L51A 4P2YB 2LVVA 3VRQA 5KU1A 1SPYA 2K2FA 1CTRA 1R6PA 2OS8C 1WRZA 1CLLA 5HKZA 2M7NA 3PM8A 1FBVA 1Y1AA 2O5GA 3JTDB 1DJZA 3I5GC 2LVIA 2K7CA 1UHJA 1N0YA 2JOJA 2M97A 3JVTC 1QLSA 3M0WA 1M63B 2HF5A 3OB2B 4NDBA 1QIWA 1L7ZA 4FQOA 4PE0A 2PASA 1CLMA 3TUYC 4WQ3A 3KEVA 2WOSA 2JTTA 3DVKA 1M45A 2P6BB 3BQ3A 3PATA 1UHNA 2JQ6A 3TS5B 3KO0A 3SG2A 1KQMB
chains in the Genus database with same CATH superfamily
1SRAA 3DD4A 2KPHA 4L9MA 2OS8B 4MRYA 2KI4C 4GBAA 1LINA 1FI5A 1EG3A 1NWDA 4NDCA 1OOHA 1BOCA 1UHKA 4OV2A 1B8LA 1YVLA 1JSAA 3I5GB 1SK6D 3CGAA 3MSEB 3D73A 5CSFA 4U8DA 3UNWA 2JTZA 3NHTA 2BCAA 4MN0A 1IJ5A 3LL8B 1S6IA 2MLEC 4JKTA 5ER4X 4AOMA 3PN7C 2Y4QA 2P70A 1BT6A 3TUYB 2SASA 4WQ2A 1PULA 1CFDA 1ORGA 3I5IC 3OX6A 1B8CA 2BE4A 2F2OA 5BPJA 3BFAA 3S0GA 1J55A 3S0EA 5JJGA 2CNPA 1NX3A 2L50A 4MZKA 3R1VA 1QX5B 1SR6C 1XFYO 1WRKA 1NCZA 1XFXO 4PHMA 1BF5A 1QVIY 1SNLA 1U5IA 1Y1XA 2MRDA 1M31A 1QWVA 2LP3A 1K9PA 2AUCA 1JF2A 4YRUA 1PSBA 1QX2A 1BR1B 3A8RA 2H2KA 3I5FC 2K2AA 2Y5IA 3FE6A 2GGZA 1XFWO 1XVJA 1BJFA 3LLEA 1F8HA 1M39A 4KYNA 4OCIA 4M2PA 4HRHA 2PRUA 3SG6A 1RROA 1SMGA 4HSZA 1LXFC 2KLEA 3PN7B 4MEWA 2M1KB 2JT0A 1WLZA 3F45A 3UO9A 2KOTA 2NCPA 2CT9A 1MXEA 2DOQA 2MAZA 3DVJA 4ETOA 1KSMA 3I5IB 2M8UA 1JUOA 4I5KA 2F33A 1KWOC 1DJGA 1RJVA 3IQOA 3R1OA 5KTYA 4ORAB 1K93D 1TCFA 1XFZO 2L98A 1B1GA 1NX1A 1OOGA 2LVKA 3DF0B 2BCXA 2JT3A 1T14A 3VB1A 3RLZA 1GGWA 3I5FB 1C7VA 1KFXS 2SCPA 2LUCA 3PJIA 3PSRA 5JOLA 4F0ZB 2JC2A 1CMGA 1QJTA 4YGEB 1NX2A 2EC6B 2ZNDA 5ER5A 5DKNA 2KAVA 2M1UA 3O4XA 2EGDA 4ZCVA 1QV0A 2LUXA 4FQTA 4P5OE 4PE4A 1DJXA 1IKUA 1BR4B 1N65A 2WCJA 1A29A 1ODBA 3NSIA 1NYAA 1CLBA 2CXJA 4AQIA 2LLTA 2YGUA 1A2XA 3O4YA 1KFUS 3SIBA 3BXKA 4CIDA 1NPQA 1QVIZ 3EVRA 4PHKA 4C0LA 4DIRA 1FPWA 3BOWB 3TDUA 1S5GY 3LCPC 4IJ7A 3CS1A 1J1EA 3BJHA 1UHHA 2JULA 1AJ4A 2QACA 5D69A 2WC8A 1KK8B 1DJHA 2ZKMX 1YRTB 3S0FA 1RK9A 1X02A 2Q4UA 3I5HC 2L5YA 4WRIA 2F2PA 3SS4A 4YI9A 2PMYA 2H61C 2L4HA 1SCVA 1R2UA 1XFVO 4PT1A 1ZMZA 2E6WA 2JZIA 2QEHA 3CZ2A 4PHJA 2JT8A 4MLWA 1PVAA 3WXAA 1OOFA 4I5LB 2HQ8A 1ZACA 1S6CA 3HX4A 3PLFB 4JQ0D 1K9KA 3D77A 1P28A 1E8AA 4M2OA 1UHIA 2MHHA 4YBHB 1CFFA 3GOFA 1J7QA 2L2CA 2QEVA 3BOWA 1TUZA 4GGNA 3EK7A 2KGBC 3B88A 3VRPA 2Q91A 1K95A 2BCBA 2LHIA 3I5HB 4PDZA 1OOJA 2M7LA 4DS7A 1CNPA 4PALA 3FE8A 4QJ4B 1OW4A 2L2EA 2L0PA 1BMOA 5CSIA 2NZ0A 1U5IB 4CPVA 4OZDA 2G9BA 1CM4A 1LS8A 1JF0A 5I2LA 1CMFA 1EL4A 4QJ3B 2K8MB 3CYZA 2NXQA 1DT7B 1AK8A 3CZ1A 2OTGB 2EHBA 1JC2A 3EKHA 2K0JA 1H4BA 3DVEA 4N5XA 2LNKA 3CZ0A 3PALA 5I2QA 1A03A 2VRGA 4DCKA 2TN4A 3BYAA 3H4SE 2F3YA 4OR9B 1NCYA 2JU0A 1XYDA 5HKWA 1OQPA 5B8IB 1D1OA 1BU3A 1MF8B 1S5GZ 1XK4A 2Y1NA 4PE1A 2QEBA 4YGDB 1YX8A 3JVTB 1CFPA 2GGMA 3BUNB 4C0KA 1IQ3A 1SCMC 1YUSA 1F70A 1A75B 1TNQA 1CKKA 1YRUB 3SS5A 1WRLA 3HCMA 2BL0C 3OHMB 1NCXA 5FI2A 1G4YR 2BKIB 2KDHA 2I7AA 1S3PA 3WNXB 2FCDA 1CFCA 1DGVA 2M29A 2JXCA 2LE9B 2RGIA 3OX5A 1JWDA 2WCKA 3VGOA 3Q8IA 1QASA 2H61A 4XJKA 1GGZA 1OZOA 1SW8A 2AAOA 3S0BA 2ERBA 2KI4B 2NCOA 1MR8A 1TNPA 1IIOA 1DTLA 4C0JA 1K9UA 4HREE 1TWOA 3L4AA 2JPTA 2V53A 4DUQA 5HL1A 5DKRA 3VRRA 4MRXA 5HLVA 1IH0A 2LANA 1C7WA 1SCMB 5CSJA 1VRKA 1S6JA 3ICBA 5DICA 2M0RA 1AVSA 1A4PA 2KYFA 1TN4A 1MHOA 3FWCA 4D1EA 1A75A 2LM5A 1JFKA 3BUXB 1HQVA 5D3OA 2M9GA 3VRNA 4DRWA 2KFGA 1FW4A 3CR5X 1SR6B 1YUUA 1EG4A 1HT9A 2PALA 2LC5A 1CDPA 3FE9A 4N1GA 2I94A 4ICBA 4TNCA 3GK1A 2LLUA 1CDMA 1SL7A 5TNCA 3N7HA 1RWYA 1V1GA 4MBEA 3O2PA 1W9ZA 4MSPA 1LKJA 3CABA 2CTNA 2QPTA 3D78A 1UWOA 4ORBB 1J7OA 2KI6C 1G33A 2E30A 3TZ1A 1Q80A 4R1EA 2JPOA 4INXA 1BLQA 2KGRA 1QTXA 1KWOB 1W7IB 2K7BA 5AEQA 4BY5A 1BG1A 3SIAA 2LMVA 3TDIA 5FI7A 1B9AA 1XA5A 1OZSA 3EK4A 1IGVA 4CLNA 1QLKA 1QIVA 1TNXA 2KSPA 4I5NB 3EVUA 4YGBB 4CFQA 3CLNA 5AANA 1KCYA 2ZN9A 1OOIX 1WLMA 2AMIA 3E3RA 3BUOB 3CZTX 2K61A 1RTP1 4GUKA 1RFJA 4NDDA 1XFRA 4Q04A 1C07A 3DZTA 3D74A 2F3ZA 2LMUA 3CR2A 3TDZA 5HLOA 4MZLA 1UP5A 1TOPA 2KFHA 1RECA 5EL2A 2CBLA 2PQLA 1SL8A 2PSRA 3A4UB 1SBJA 2KAXA 2WNDA 4GGFC 3OBVA 3WHUB 2ZN8A 2I2RE 1CDLA 3OP0A 1PK0D 1KFXL 2R2IA 2MBXA 2ISDA 1DC1A 1YVHA 3KHEA 3LK1A 4PCWA 1AHRA 1YURA 2JNFA 2KFFA 3ZNIA 3JTDC 1DEKA 5KSZA 2LP2A 2KBMA 1M46A 1TIZA 2KYCA 1YR5A 2WCBA 1ZUZA 1J7RA 1KQVA 3NXAA 2GV5A 1K96A 1DJYA 1N2DA 2CCMA 1TCOB 2ZFDA 4OKHA 4INWA 2ZRTA 5G08A 2WCFA 4I5JA 1PSRA 3D0YB 2LLSA 2L4IA 3EG5B 4CFRA 3KF9A 1Y0VH 4FTGA 2LHLA 3AAJA 3VROA 2Y1MA 3TS5C 4XJKB 1KFUL 1KQMC 5CSNA 1LA0A 3DYEA 4QJ5B 3SG4A 1LA3A 1S1EA 4XYNA 1EJ3A 1WY9A 1B7TY 4HRGA 1S26D 5AERA 2KI6D 1AP4A 3EK8A 4MZJA 3SG7A 1IG5A 1K8UA 5AXIA 1K90D 1OMVA 2ZRSA 3FIAA 3FWBA 4YI8A 1LVCD 2FJUB 1L2OC 5GQQC 5IBWA 1KK7Y 5CPVA 4M2QA 1TUJA 2ZNEA 4GNKB 1YUTA 2JRFA 4IL1A 3D0YA 1UURA 2M49B 3KPXA 1SKTA 1PRWA 3BUWB 1F54A 1B47A 2FCEA 3IQQA 1SSEB 4E68A 2D8NA 1MUXA 4USLA 2JNXA 4GGFA 1PALA 5PALA 1C3YA 4MVFA 1JBAA 2K7OA 2OPOA 3B6XA 1MQ1A 1F55A 1F4OA 1DJWA 3LK0A 1FF1A 2L5XB 3QMEA 2NLNA 2B1UA 2WORA 3CWGA 3ZWHA 2KQYA 4A4BA 2FJYA 2LVJA 2LMTA 2BKHB 4F7FA 1TRFA 4YGCB 1S36A 2HETA 1Y6WA 1L2OB 1SY9A 1DJIA 1CB1A 1NP8A 3V2LA 2BL0B 1Z2CB 1ALWA 1SL9A 3D75A 1W7JB 2JXLA 4PHNA 1ZFSA 1XO5A 2GTEA 2BECA 2P71A 3OGNA 2MA2A 3D10A 4A4CA 3PFVA 2IS9A 3IF7A 3DY9A 3SG3A 1DMOA 5FI6A 5I94A 4OVNF 3RM1A 1H8BA 4BY4A 1QV1A 1AUIB 2KBIA 5AFPA 1QX7A 1B7TZ 1MXLC 3EVVA 1DQEA 1MWNA 2BBMA 1YX7A 1CM1A 2EC6C 2JWWA 2WCMA 3IVTA 1OE9B 3B87A 3CDNA 2A4JA 2BE6A 3S0AA 1DF0B 2WC5A 3AKAA 1G8IA 4JPZB 2LAPA 1ALVA 4JWQA 1QATA 1K94A 2BAPA 5FYXA 3RZSA 1GM0A 3AKBA 2KQ6A 3GK4X 1PVBA 1WDCC 1KK7Z 1YTZC 2K7DA 1Z4HA 1NX0A 2LCPA 1OMRA 2HQWA 2MJWB 1IJ6A 3B86A 3K21A 1CDNA 4ORCB 4YGAA 1TNWA 1XFUO 1F71A 5K89A 2BBNA 5HKYA 3K1EA 1ZOTB 1EXRA 2WCEA 2K60A 1JFJA 4ZCUA 5D7FA 3BFBA 2HPSA 2MLFC 3EKJA 3BFHA 3GK2A 1NUBA 1AJ5A 1SYMA 2COLB 1KK8C 2G2BA 2FOTA 1J7PA 1B8RA 1F4QA 1OSAA 1NSHA 1K2HA 1QXPA 1IWQA 3AAKA 3NSOA 1EH2A 3O6BA 4GAOA 3SJSA 1UUSA 1B4CA 1V1FA 1DF0A 1DGUA 1C3ZA 2PYQA 1Y1UA 3WHTB 5I8NA 1WDCB 4PE7A 3L4LA 1OMDA 2QEOA 5HYDA 1GQMA 1IQ5A 2KNEA 1KSOA 3S0DA 5DKQA 4GFTA 3L47A 2M3WA 2WCHA 2WCLA 3NHIA 3NSKA 3SG5A 1XK4C 3DF0A 1IRJA 1GJYA 3O78A 3DVMA 4GPLB 2O60A 2KAYA 5I2OA 4N1FA 5F6TA 5J3XA 2F8PA 2WC6A 1FI6A 1QS7A 3BUMB 4JD9A 4AQJA 1DVIA 1DELA 2LV7A 2H8VA 2KHNA 3CTNA 1NIWA 1BODA 3C1VA 3FS7A 3CR4X 3NSLA 2I18A 4NQGA 3OB1B 3DXLA 2PVBA 1TTXA 2OTGC 4UPGA 1J1DA 2L51A 4P2YB 2LVVA 3VRQA 5KU1A 1SPYA 2K2FA 1CTRA 1R6PA 2OS8C 3NGVA 1WRZA 2BNXA 1CLLA 3PM2A 2M7NA 3PM8A 5HKZA 3SS3A 1FBVA 1Y1AA 2O5GA 3JTDB 1DJZA 3R72A 3I5GC 2LVIA 2K7CA 2KLDA 1UHJA 3B7AA 1N0YA 2JOJA 2M97A 3JVTC 1QLSA 3M0WA 1M63B 2HF5A 2QDIA 3OB2B 1QIWA 3R1PA 4NDBA 1L7ZA 4FQOA 4PE0A 2PASA 1CLMA 3TUYC 4WQ3A 3KEVA 2WOSA 2JTTA 3DVKA 3D76A 1M45A 2P6BB 3QRXA 3BQ3A 3PATA 1UHNA 2JQ6A 3TS5B 3KO0A 3SG2A 1KQMB
chains in the Genus database with same CATH topology
1SRAA 3DD4A 4L9MA 2OS8B 4MRYA 2KI4C 4GBAA 1LINA 1FI5A 1EG3A 1NWDA 4NDCA 1BOCA 1UHKA 4OV2A 1B8LA 1YVLA 1JSAA 3I5GB 1SK6D 3CGAA 3MSEB 5CSFA 4U8DA 2JTZA 2BCAA 4MN0A 1IJ5A 3LL8B 1S6IA 2MLEC 5ER4X 4AOMA 3PN7C 2Y4QA 3TUYB 1BT6A 2SASA 4WQ2A 1PULA 1CFDA 3I5IC 3OX6A 1B8CA 2BE4A 2F2OA 5BPJA 1J55A 5JJGA 2CNPA 1NX3A 2L50A 4MZKA 1QX5B 1SR6C 1XFYO 1WRKA 1NCZA 1XFXO 4PHMA 1BF5A 1QVIY 1SNLA 1U5IA 1Y1XA 2MRDA 1M31A 2LP3A 1K9PA 2AUCA 1JF2A 4YRUA 1PSBA 1QX2A 1BR1B 3A8RA 2H2KA 3I5FC 2K2AA 2Y5IA 2GGZA 1XFWO 1XVJA 1BJFA 3LLEA 1F8HA 1M39A 4OCIA 4M2PA 4HRHA 2PRUA 3SG6A 1RROA 1SMGA 4HSZA 1LXFC 3PN7B 4MEWA 2M1KB 2JT0A 1WLZA 3F45A 2KOTA 2NCPA 2CT9A 1MXEA 2DOQA 2MAZA 3DVJA 4ETOA 1KSMA 3I5IB 2M8UA 1JUOA 4I5KA 2F33A 1KWOC 1DJGA 1RJVA 3IQOA 5KTYA 4ORAB 1K93D 1TCFA 1XFZO 2L98A 1B1GA 1NX1A 2LVKA 3DF0B 2BCXA 2JT3A 3RLZA 1GGWA 3I5FB 1C7VA 1KFXS 2SCPA 2LUCA 3PSRA 5JOLA 4F0ZB 2JC2A 1CMGA 1QJTA 4YGEB 1NX2A 2EC6B 2ZNDA 5ER5A 5DKNA 2KAVA 2M1UA 2EGDA 4ZCVA 1QV0A 2LUXA 4P5OE 4PE4A 1DJXA 1IKUA 1BR4B 1N65A 1A29A 1ODBA 3NSIA 1NYAA 1CLBA 2CXJA 4AQIA 2LLTA 1A2XA 3O4YA 1KFUS 3SIBA 3BXKA 4CIDA 1NPQA 1QVIZ 3EVRA 4PHKA 4C0LA 4DIRA 1FPWA 3BOWB 3TDUA 1S5GY 3LCPC 3CS1A 1J1EA 1UHHA 2JULA 1AJ4A 2QACA 5D69A 2WC8A 1KK8B 1DJHA 2ZKMX 1YRTB 1RK9A 1X02A 2Q4UA 3I5HC 4WRIA 2F2PA 4YI9A 2PMYA 2H61C 2L4HA 1SCVA 1R2UA 1XFVO 1ZMZA 2E6WA 2JZIA 4PHJA 2JT8A 4MLWA 1PVAA 3WXAA 4I5LB 2HQ8A 1ZACA 1S6CA 3HX4A 3PLFB 4JQ0D 1K9KA 1E8AA 4M2OA 1UHIA 2MHHA 4YBHB 1CFFA 3GOFA 1J7QA 3BOWA 4GGNA 3EK7A 2KGBC 3VRPA 2Q91A 1K95A 2BCBA 2LHIA 3I5HB 4PDZA 1OOJA 2M7LA 4DS7A 1CNPA 4PALA 4QJ4B 2L2EA 2L0PA 1BMOA 5CSIA 2NZ0A 1U5IB 4CPVA 2G9BA 1CM4A 1JF0A 5I2LA 1CMFA 1EL4A 4QJ3B 2K8MB 1AK8A 2NXQA 1DT7B 2OTGB 2EHBA 1JC2A 3EKHA 2K0JA 1H4BA 3DVEA 4N5XA 2LNKA 3PALA 1A03A 5I2QA 2VRGA 4DCKA 2TN4A 3BYAA 3H4SE 2F3YA 4OR9B 1NCYA 2JU0A 1XYDA 5HKWA 1OQPA 5B8IB 1D1OA 1BU3A 1MF8B 1S5GZ 1XK4A 2Y1NA 4PE1A 4YGDB 1YX8A 3JVTB 1CFPA 2GGMA 3BUNB 4C0KA 1IQ3A 1SCMC 1YUSA 1F70A 1A75B 1TNQA 1CKKA 1YRUB 1WRLA 3HCMA 2BL0C 3OHMB 1NCXA 1G4YR 2BKIB 2KDHA 2I7AA 1S3PA 3WNXB 2FCDA 1CFCA 1DGVA 2M29A 2JXCA 2LE9B 2RGIA 3OX5A 1JWDA 3VGOA 1QASA 2H61A 4XJKA 1GGZA 1OZOA 1SW8A 2AAOA 2KI4B 2NCOA 1MR8A 1TNPA 1DTLA 4C0JA 1K9UA 4HREE 2JPTA 2V53A 4DUQA 5DKRA 3VRRA 4MRXA 5HLVA 1IH0A 2LANA 1C7WA 1SCMB 5CSJA 1VRKA 1S6JA 3ICBA 2M0RA 1AVSA 1A4PA 2KYFA 1TN4A 1MHOA 3FWCA 4D1EA 1A75A 2LM5A 1JFKA 3BUXB 1HQVA 2M9GA 3VRNA 4DRWA 2KFGA 1FW4A 3CR5X 1SR6B 1EG4A 1HT9A 1YUUA 2PALA 2LC5A 1CDPA 4N1GA 2I94A 4ICBA 4TNCA 3GK1A 2LLUA 1CDMA 1SL7A 5TNCA 1RWYA 1V1GA 4MBEA 3O2PA 4MSPA 1LKJA 2CTNA 2QPTA 1UWOA 4ORBB 1J7OA 2KI6C 1G33A 2E30A 3TZ1A 1Q80A 4R1EA 1BLQA 2KGRA 1QTXA 1KWOB 1W7IB 2K7BA 5AEQA 4BY5A 1BG1A 3SIAA 2LMVA 3TDIA 1B9AA 1XA5A 1OZSA 3EK4A 1IGVA 4CLNA 1QLKA 1QIVA 1TNXA 2KSPA 4I5NB 3EVUA 4YGBB 4CFQA 3CLNA 5AANA 1KCYA 2ZN9A 1WLMA 2AMIA 3E3RA 3BUOB 3CZTX 2K61A 1RTP1 4GUKA 1RFJA 4NDDA 4Q04A 1C07A 2F3ZA 2LMUA 3CR2A 3TDZA 5HLOA 4MZLA 1UP5A 1TOPA 2KFHA 1RECA 2CBLA 1SL8A 2PSRA 3A4UB 1SBJA 2KAXA 2WNDA 4GGFC 3WHUB 2ZN8A 2I2RE 1CDLA 3OP0A 1PK0D 1KFXL 2R2IA 2MBXA 2ISDA 1YVHA 3KHEA 3LK1A 4PCWA 1AHRA 1YURA 2JNFA 2KFFA 3ZNIA 3JTDC 5KSZA 2LP2A 2KBMA 1M46A 1TIZA 2KYCA 1YR5A 2WCBA 1ZUZA 1J7RA 1KQVA 3NXAA 2GV5A 1K96A 2CCMA 1DJYA 1N2DA 1TCOB 2ZFDA 4OKHA 2ZRTA 5G08A 2WCFA 4I5JA 1PSRA 3D0YB 2LLSA 2L4IA 4CFRA 3KF9A 1Y0VH 4FTGA 2LHLA 3AAJA 3VROA 2Y1MA 3TS5C 4XJKB 1KFUL 1KQMC 5CSNA 1LA0A 4QJ5B 3SG4A 1LA3A 1S1EA 4XYNA 1EJ3A 1WY9A 1B7TY 4HRGA 1S26D 5AERA 2KI6D 1AP4A 3EK8A 4MZJA 3SG7A 1IG5A 1K8UA 5AXIA 1K90D 1OMVA 2ZRSA 3FIAA 3FWBA 4YI8A 1LVCD 2FJUB 1L2OC 5GQQC 5IBWA 1KK7Y 5CPVA 4M2QA 4GNKB 2ZNEA 1YUTA 2JRFA 4IL1A 3D0YA 1UURA 2M49B 3KPXA 1SKTA 1PRWA 3BUWB 1F54A 1B47A 2FCEA 3IQQA 4E68A 2D8NA 1MUXA 4USLA 2JNXA 4GGFA 1PALA 5PALA 4MVFA 1JBAA 2K7OA 2OPOA 1MQ1A 1F55A 1F4OA 1DJWA 3LK0A 1FF1A 2L5XB 2NLNA 2B1UA 2WORA 3CWGA 3ZWHA 2KQYA 4A4BA 2LVJA 2LMTA 2BKHB 1TRFA 4YGCB 1S36A 2HETA 1Y6WA 1L2OB 1SY9A 1DJIA 1CB1A 1NP8A 2BL0B 1ALWA 1SL9A 1W7JB 2JXLA 4PHNA 1ZFSA 1XO5A 2BECA 2MA2A 3D10A 4A4CA 3PFVA 2IS9A 3IF7A 3SG3A 1DMOA 4OVNF 3RM1A 1H8BA 4BY4A 1QV1A 1AUIB 2KBIA 5AFPA 1QX7A 1B7TZ 1MXLC 3EVVA 2JWWA 1MWNA 2BBMA 1YX7A 1CM1A 2EC6C 3QRXA 1OE9B 2A4JA 2BE6A 1DF0B 3AKAA 1G8IA 4JPZB 2LAPA 1ALVA 4JWQA 1QATA 1K94A 5FYXA 3AKBA 2KQ6A 3GK4X 1PVBA 1WDCC 1KK7Z 1YTZC 2K7DA 1NX0A 2LCPA 2MJWB 1OMRA 2HQWA 1CDNA 1IJ6A 3K21A 4ORCB 4YGAA 1TNWA 1XFUO 1F71A 5K89A 2BBNA 5HKYA 1ZOTB 1EXRA 2WCEA 1JFJA 4ZCUA 5D7FA 2HPSA 2MLFC 3EKJA 3GK2A 1NUBA 1AJ5A 1SYMA 2COLB 1KK8C 2G2BA 2FOTA 1J7PA 1B8RA 1F4QA 1OSAA 1NSHA 1K2HA 1QXPA 1IWQA 3AAKA 3NSOA 1EH2A 3O6BA 4GAOA 3SJSA 1UUSA 1B4CA 1V1FA 1DF0A 1DGUA 3WHTB 5I8NA 1Y1UA 1WDCB 4PE7A 1OMDA 5HYDA 1GQMA 1IQ5A 2KNEA 1KSOA 5DKQA 4GFTA 2M3WA 3NSKA 3SG5A 1XK4C 3DF0A 1IRJA 1GJYA 3O78A 3DVMA 4GPLB 2O60A 2KAYA 5I2OA 4N1FA 5F6TA 5J3XA 2F8PA 1FI6A 1QS7A 3BUMB 4AQJA 1DVIA 2LV7A 2KHNA 3CTNA 1NIWA 1BODA 3C1VA 3FS7A 3CR4X 3NSLA 2I18A 4NQGA 3OB1B 2PVBA 1TTXA 2OTGC 4UPGA 1J1DA 2L51A 4P2YB 2LVVA 3VRQA 5KU1A 1SPYA 2K2FA 1CTRA 1R6PA 2OS8C 1WRZA 1CLLA 5HKZA 2M7NA 3PM8A 1FBVA 1Y1AA 2O5GA 3JTDB 1DJZA 3I5GC 2LVIA 2K7CA 1UHJA 1N0YA 2JOJA 2M97A 3JVTC 1QLSA 3M0WA 1M63B 2HF5A 3OB2B 4NDBA 1QIWA 1L7ZA 4FQOA 4PE0A 2PASA 1CLMA 3TUYC 4WQ3A 3KEVA 2WOSA 2JTTA 3DVKA 1M45A 2P6BB 3BQ3A 3PATA 1UHNA 2JQ6A 3TS5B 3KO0A 3SG2A 1KQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRA A;  3DD4 A;  4L9M A;  2OS8 B;  4MRY A;  2KI4 C;  4GBA A;  1LIN A;  1FI5 A;  1EG3 A;  1NWD A;  4NDC A;  1BOC A;  1UHK A;  4OV2 A;  1B8L A;  1YVL A;  1JSA A;  3I5G B;  1SK6 D;  3CGA A;  3MSE B;  5CSF A;  4U8D A;  2JTZ A;  2BCA A;  4MN0 A;  1IJ5 A;  3LL8 B;  1S6I A;  2MLE C;  5ER4 X;  4AOM A;  3PN7 C;  2Y4Q A;  3TUY B;  1BT6 A;  2SAS A;  4WQ2 A;  1PUL A;  1CFD A;  3I5I C;  3OX6 A;  1B8C A;  2BE4 A;  2F2O A;  5BPJ A;  1J55 A;  5JJG A;  2CNP A;  1NX3 A;  2L50 A;  4MZK A;  1QX5 B;  1SR6 C;  1XFY O;  1WRK A;  1NCZ A;  1XFX O;  4PHM A;  1BF5 A;  1QVI Y;  1SNL A;  1U5I A;  1Y1X A;  2MRD A;  1M31 A;  2LP3 A;  1K9P A;  2AUC A;  1JF2 A;  4YRU A;  1PSB A;  1QX2 A;  1BR1 B;  3A8R A;  2H2K A;  3I5F C;  2K2A A;  2Y5I A;  2GGZ A;  1XFW O;  1XVJ A;  1BJF A;  3LLE A;  1F8H A;  1M39 A;  4OCI A;  4M2P A;  4HRH A;  2PRU A;  3SG6 A;  1RRO A;  1SMG A;  4HSZ A;  1LXF C;  3PN7 B;  4MEW A;  2M1K B;  2JT0 A;  1WLZ A;  3F45 A;  2KOT A;  2NCP A;  2CT9 A;  1MXE A;  2DOQ A;  2MAZ A;  3DVJ A;  4ETO A;  1KSM A;  3I5I B;  2M8U A;  1JUO A;  4I5K A;  2F33 A;  1KWO C;  1DJG A;  1RJV A;  3IQO A;  5KTY A;  4ORA B;  1K93 D;  1TCF A;  1XFZ O;  2L98 A;  1B1G A;  1NX1 A;  2LVK A;  3DF0 B;  2BCX A;  2JT3 A;  3RLZ A;  1GGW A;  3I5F B;  1C7V A;  1KFX S;  2SCP A;  2LUC A;  3PSR A;  5JOL A;  4F0Z B;  2JC2 A;  1CMG A;  1QJT A;  4YGE B;  1NX2 A;  2EC6 B;  2ZND A;  5ER5 A;  5DKN A;  2KAV A;  2M1U A;  2EGD A;  4ZCV A;  1QV0 A;  2LUX A;  4P5O E;  4PE4 A;  1DJX A;  1IKU A;  1BR4 B;  1N65 A;  1A29 A;  1ODB A;  3NSI A;  1NYA A;  1CLB A;  2CXJ A;  4AQI A;  2LLT A;  1A2X A;  3O4Y A;  1KFU S;  3SIB A;  3BXK A;  4CID A;  1NPQ A;  1QVI Z;  3EVR A;  4PHK A;  4C0L A;  4DIR A;  1FPW A;  3BOW B;  3TDU A;  1S5G Y;  3LCP C;  3CS1 A;  1J1E A;  1UHH A;  2JUL A;  1AJ4 A;  2QAC A;  5D69 A;  2WC8 A;  1KK8 B;  1DJH A;  2ZKM X;  1YRT B;  1RK9 A;  1X02 A;  2Q4U A;  3I5H C;  4WRI A;  2F2P A;  4YI9 A;  2PMY A;  2H61 C;  2L4H A;  1SCV A;  1R2U A;  1XFV O;  1ZMZ A;  2E6W A;  2JZI A;  4PHJ A;  2JT8 A;  4MLW A;  1PVA A;  3WXA A;  4I5L B;  2HQ8 A;  1ZAC A;  1S6C A;  3HX4 A;  3PLF B;  4JQ0 D;  1K9K A;  1E8A A;  4M2O A;  1UHI A;  2MHH A;  4YBH B;  1CFF A;  3GOF A;  1J7Q A;  3BOW A;  4GGN A;  3EK7 A;  2KGB C;  3VRP A;  2Q91 A;  1K95 A;  2BCB A;  2LHI A;  3I5H B;  4PDZ A;  1OOJ A;  2M7L A;  4DS7 A;  1CNP A;  4PAL A;  4QJ4 B;  2L2E A;  2L0P A;  1BMO A;  5CSI A;  2NZ0 A;  1U5I B;  4CPV A;  2G9B A;  1CM4 A;  1JF0 A;  5I2L A;  1CMF A;  1EL4 A;  4QJ3 B;  2K8M B;  1AK8 A;  2NXQ A;  1DT7 B;  2OTG B;  2EHB A;  1JC2 A;  3EKH A;  2K0J A;  1H4B A;  3DVE A;  4N5X A;  2LNK A;  3PAL A;  1A03 A;  5I2Q A;  2VRG A;  4DCK A;  2TN4 A;  3BYA A;  3H4S E;  2F3Y A;  4OR9 B;  1NCY A;  2JU0 A;  1XYD A;  5HKW A;  1OQP A;  5B8I B;  1D1O A;  1BU3 A;  1MF8 B;  1S5G Z;  1XK4 A;  2Y1N A;  4PE1 A;  4YGD B;  1YX8 A;  3JVT B;  1CFP A;  2GGM A;  3BUN B;  4C0K A;  1IQ3 A;  1SCM C;  1YUS A;  1F70 A;  1A75 B;  1TNQ A;  1CKK A;  1YRU B;  1WRL A;  3HCM A;  2BL0 C;  3OHM B;  1NCX A;  1G4Y R;  2BKI B;  2KDH A;  2I7A A;  1S3P A;  3WNX B;  2FCD A;  1CFC A;  1DGV A;  2M29 A;  2JXC A;  2LE9 B;  2RGI A;  3OX5 A;  1JWD A;  3VGO A;  1QAS A;  2H61 A;  4XJK A;  1GGZ A;  1OZO A;  1SW8 A;  2AAO A;  2KI4 B;  2NCO A;  1MR8 A;  1TNP A;  1DTL A;  4C0J A;  1K9U A;  4HRE E;  2JPT A;  2V53 A;  4DUQ A;  5DKR A;  3VRR A;  4MRX A;  5HLV A;  1IH0 A;  2LAN A;  1C7W A;  1SCM B;  5CSJ A;  1VRK A;  1S6J A;  3ICB A;  2M0R A;  1AVS A;  1A4P A;  2KYF A;  1TN4 A;  1MHO A;  3FWC A;  4D1E A;  1A75 A;  2LM5 A;  1JFK A;  3BUX B;  1HQV A;  2M9G A;  3VRN A;  4DRW A;  2KFG A;  1FW4 A;  3CR5 X;  1SR6 B;  1EG4 A;  1HT9 A;  1YUU A;  2PAL A;  2LC5 A;  1CDP A;  4N1G A;  2I94 A;  4ICB A;  4TNC A;  3GK1 A;  2LLU A;  1CDM A;  1SL7 A;  5TNC A;  1RWY A;  1V1G A;  4MBE A;  3O2P A;  4MSP A;  1LKJ A;  2CTN A;  2QPT A;  1UWO A;  4ORB B;  1J7O A;  2KI6 C;  1G33 A;  2E30 A;  3TZ1 A;  1Q80 A;  4R1E A;  1BLQ A;  2KGR A;  1QTX A;  1KWO B;  1W7I B;  2K7B A;  5AEQ A;  4BY5 A;  1BG1 A;  3SIA A;  2LMV A;  3TDI A;  1B9A A;  1XA5 A;  1OZS A;  3EK4 A;  1IGV A;  4CLN A;  1QLK A;  1QIV A;  1TNX A;  2KSP A;  4I5N B;  3EVU A;  4YGB B;  4CFQ A;  3CLN A;  5AAN A;  1KCY A;  2ZN9 A;  1WLM A;  2AMI A;  3E3R A;  3BUO B;  3CZT X;  2K61 A;  1RTP 1;  4GUK A;  1RFJ A;  4NDD A;  4Q04 A;  1C07 A;  2F3Z A;  2LMU A;  3CR2 A;  3TDZ A;  5HLO A;  4MZL A;  1UP5 A;  1TOP A;  2KFH A;  1REC A;  2CBL A;  1SL8 A;  2PSR A;  3A4U B;  1SBJ A;  2KAX A;  2WND A;  4GGF C;  3WHU B;  2ZN8 A;  2I2R E;  1CDL A;  3OP0 A;  1PK0 D;  1KFX L;  2R2I A;  2MBX A;  2ISD A;  1YVH A;  3KHE A;  3LK1 A;  4PCW A;  1AHR A;  1YUR A;  2JNF A;  2KFF A;  3ZNI A;  3JTD C;  5KSZ A;  2LP2 A;  2KBM A;  1M46 A;  1TIZ A;  2KYC A;  1YR5 A;  2WCB A;  1ZUZ A;  1J7R A;  1KQV A;  3NXA A;  2GV5 A;  1K96 A;  2CCM A;  1DJY A;  1N2D A;  1TCO B;  2ZFD A;  4OKH A;  2ZRT A;  5G08 A;  2WCF A;  4I5J A;  1PSR A;  3D0Y B;  2LLS A;  2L4I A;  4CFR A;  3KF9 A;  1Y0V H;  4FTG A;  2LHL A;  3AAJ A;  3VRO A;  2Y1M A;  3TS5 C;  4XJK B;  1KFU L;  1KQM C;  5CSN A;  1LA0 A;  4QJ5 B;  3SG4 A;  1LA3 A;  1S1E A;  4XYN A;  1EJ3 A;  1WY9 A;  1B7T Y;  4HRG A;  1S26 D;  5AER A;  2KI6 D;  1AP4 A;  3EK8 A;  4MZJ A;  3SG7 A;  1IG5 A;  1K8U A;  5AXI A;  1K90 D;  1OMV A;  2ZRS A;  3FIA A;  3FWB A;  4YI8 A;  1LVC D;  2FJU B;  1L2O C;  5GQQ C;  5IBW A;  1KK7 Y;  5CPV A;  4M2Q A;  4GNK B;  2ZNE A;  1YUT A;  2JRF A;  4IL1 A;  3D0Y A;  1UUR A;  2M49 B;  3KPX A;  1SKT A;  1PRW A;  3BUW B;  1F54 A;  1B47 A;  2FCE A;  3IQQ A;  4E68 A;  2D8N A;  1MUX A;  4USL A;  2JNX A;  4GGF A;  1PAL A;  5PAL A;  4MVF A;  1JBA A;  2K7O A;  2OPO A;  1MQ1 A;  1F55 A;  1F4O A;  1DJW A;  3LK0 A;  1FF1 A;  2L5X B;  2NLN A;  2B1U A;  2WOR A;  3CWG A;  3ZWH A;  2KQY A;  4A4B A;  2LVJ A;  2LMT A;  2BKH B;  1TRF A;  4YGC B;  1S36 A;  2HET A;  1Y6W A;  1L2O B;  1SY9 A;  1DJI A;  1CB1 A;  1NP8 A;  2BL0 B;  1ALW A;  1SL9 A;  1W7J B;  2JXL A;  4PHN A;  1ZFS A;  1XO5 A;  2BEC A;  2MA2 A;  3D10 A;  4A4C A;  3PFV A;  2IS9 A;  3IF7 A;  3SG3 A;  1DMO A;  4OVN F;  3RM1 A;  1H8B A;  4BY4 A;  1QV1 A;  1AUI B;  2KBI A;  5AFP A;  1QX7 A;  1B7T Z;  1MXL C;  3EVV A;  2JWW A;  1MWN A;  2BBM A;  1YX7 A;  1CM1 A;  2EC6 C;  3QRX A;  1OE9 B;  2A4J A;  2BE6 A;  1DF0 B;  3AKA A;  1G8I A;  4JPZ B;  2LAP A;  1ALV A;  4JWQ A;  1QAT A;  1K94 A;  5FYX A;  3AKB A;  2KQ6 A;  3GK4 X;  1PVB A;  1WDC C;  1KK7 Z;  1YTZ C;  2K7D A;  1NX0 A;  2LCP A;  2MJW B;  1OMR A;  2HQW A;  1CDN A;  1IJ6 A;  3K21 A;  4ORC B;  4YGA A;  1TNW A;  1XFU O;  1F71 A;  5K89 A;  2BBN A;  5HKY A;  1ZOT B;  1EXR A;  2WCE A;  1JFJ A;  4ZCU A;  5D7F A;  2HPS A;  2MLF C;  3EKJ A;  3GK2 A;  1NUB A;  1AJ5 A;  1SYM A;  2COL B;  1KK8 C;  2G2B A;  2FOT A;  1J7P A;  1B8R A;  1F4Q A;  1OSA A;  1NSH A;  1K2H A;  1QXP A;  1IWQ A;  3AAK A;  3NSO A;  1EH2 A;  3O6B A;  4GAO A;  3SJS A;  1UUS A;  1B4C A;  1V1F A;  1DF0 A;  1DGU A;  3WHT B;  5I8N A;  1Y1U A;  1WDC B;  4PE7 A;  1OMD A;  5HYD A;  1GQM A;  1IQ5 A;  2KNE A;  1KSO A;  5DKQ A;  4GFT A;  2M3W A;  3NSK A;  3SG5 A;  1XK4 C;  3DF0 A;  1IRJ A;  1GJY A;  3O78 A;  3DVM A;  4GPL B;  2O60 A;  2KAY A;  5I2O A;  4N1F A;  5F6T A;  5J3X A;  2F8P A;  1FI6 A;  1QS7 A;  3BUM B;  4AQJ A;  1DVI A;  2LV7 A;  2KHN A;  3CTN A;  1NIW A;  1BOD A;  3C1V A;  3FS7 A;  3CR4 X;  3NSL A;  2I18 A;  4NQG A;  3OB1 B;  2PVB A;  1TTX A;  2OTG C;  4UPG A;  1J1D A;  2L51 A;  4P2Y B;  2LVV A;  3VRQ A;  5KU1 A;  1SPY A;  2K2F A;  1CTR A;  1R6P A;  2OS8 C;  1WRZ A;  1CLL A;  5HKZ A;  2M7N A;  3PM8 A;  1FBV A;  1Y1A A;  2O5G A;  3JTD B;  1DJZ A;  3I5G C;  2LVI A;  2K7C A;  1UHJ A;  1N0Y A;  2JOJ A;  2M97 A;  3JVT C;  1QLS A;  3M0W A;  1M63 B;  2HF5 A;  3OB2 B;  4NDB A;  1QIW A;  1L7Z A;  4FQO A;  4PE0 A;  2PAS A;  1CLM A;  3TUY C;  4WQ3 A;  3KEV A;  2WOS A;  2JTT A;  3DVK A;  1M45 A;  2P6B B;  3BQ3 A;  3PAT A;  1UHN A;  2JQ6 A;  3TS5 B;  3KO0 A;  3SG2 A;  1KQM B; 
#chains in the Genus database with same CATH topology
 1SRA A;  3DD4 A;  2KPH A;  4L9M A;  2OS8 B;  4MRY A;  2KI4 C;  4GBA A;  1LIN A;  1FI5 A;  1EG3 A;  1NWD A;  4NDC A;  1OOH A;  1BOC A;  1UHK A;  4OV2 A;  1B8L A;  1YVL A;  1JSA A;  3I5G B;  1SK6 D;  3CGA A;  3MSE B;  3D73 A;  5CSF A;  4U8D A;  3UNW A;  2JTZ A;  3NHT A;  2BCA A;  4MN0 A;  1IJ5 A;  3LL8 B;  1S6I A;  2MLE C;  4JKT A;  5ER4 X;  4AOM A;  3PN7 C;  2Y4Q A;  2P70 A;  1BT6 A;  3TUY B;  2SAS A;  4WQ2 A;  1PUL A;  1CFD A;  1ORG A;  3I5I C;  3OX6 A;  1B8C A;  2BE4 A;  2F2O A;  5BPJ A;  3BFA A;  3S0G A;  1J55 A;  3S0E A;  5JJG A;  2CNP A;  1NX3 A;  2L50 A;  4MZK A;  3R1V A;  1QX5 B;  1SR6 C;  1XFY O;  1WRK A;  1NCZ A;  1XFX O;  4PHM A;  1BF5 A;  1QVI Y;  1SNL A;  1U5I A;  1Y1X A;  2MRD A;  1M31 A;  1QWV A;  2LP3 A;  1K9P A;  2AUC A;  1JF2 A;  4YRU A;  1PSB A;  1QX2 A;  1BR1 B;  3A8R A;  2H2K A;  3I5F C;  2K2A A;  2Y5I A;  3FE6 A;  2GGZ A;  1XFW O;  1XVJ A;  1BJF A;  3LLE A;  1F8H A;  1M39 A;  4KYN A;  4OCI A;  4M2P A;  4HRH A;  2PRU A;  3SG6 A;  1RRO A;  1SMG A;  4HSZ A;  1LXF C;  2KLE A;  3PN7 B;  4MEW A;  2M1K B;  2JT0 A;  1WLZ A;  3F45 A;  3UO9 A;  2KOT A;  2NCP A;  2CT9 A;  1MXE A;  2DOQ A;  2MAZ A;  3DVJ A;  4ETO A;  1KSM A;  3I5I B;  2M8U A;  1JUO A;  4I5K A;  2F33 A;  1KWO C;  1DJG A;  1RJV A;  3IQO A;  3R1O A;  5KTY A;  4ORA B;  1K93 D;  1TCF A;  1XFZ O;  2L98 A;  1B1G A;  1NX1 A;  1OOG A;  2LVK A;  3DF0 B;  2BCX A;  2JT3 A;  1T14 A;  3VB1 A;  3RLZ A;  1GGW A;  3I5F B;  1C7V A;  1KFX S;  2SCP A;  2LUC A;  3PJI A;  3PSR A;  5JOL A;  4F0Z B;  2JC2 A;  1CMG A;  1QJT A;  4YGE B;  1NX2 A;  2EC6 B;  2ZND A;  5ER5 A;  5DKN A;  2KAV A;  2M1U A;  3O4X A;  2EGD A;  4ZCV A;  1QV0 A;  2LUX A;  4FQT A;  4P5O E;  4PE4 A;  1DJX A;  1IKU A;  1BR4 B;  1N65 A;  2WCJ A;  1A29 A;  1ODB A;  3NSI A;  1NYA A;  1CLB A;  2CXJ A;  4AQI A;  2LLT A;  2YGU A;  1A2X A;  3O4Y A;  1KFU S;  3SIB A;  3BXK A;  4CID A;  1NPQ A;  1QVI Z;  3EVR A;  4PHK A;  4C0L A;  4DIR A;  1FPW A;  3BOW B;  3TDU A;  1S5G Y;  3LCP C;  4IJ7 A;  3CS1 A;  1J1E A;  3BJH A;  1UHH A;  2JUL A;  1AJ4 A;  2QAC A;  5D69 A;  2WC8 A;  1KK8 B;  1DJH A;  2ZKM X;  1YRT B;  3S0F A;  1RK9 A;  1X02 A;  2Q4U A;  3I5H C;  2L5Y A;  4WRI A;  2F2P A;  3SS4 A;  4YI9 A;  2PMY A;  2H61 C;  2L4H A;  1SCV A;  1R2U A;  1XFV O;  4PT1 A;  1ZMZ A;  2E6W A;  2JZI A;  2QEH A;  3CZ2 A;  4PHJ A;  2JT8 A;  4MLW A;  1PVA A;  3WXA A;  1OOF A;  4I5L B;  2HQ8 A;  1ZAC A;  1S6C A;  3HX4 A;  3PLF B;  4JQ0 D;  1K9K A;  3D77 A;  1P28 A;  1E8A A;  4M2O A;  1UHI A;  2MHH A;  4YBH B;  1CFF A;  3GOF A;  1J7Q A;  2L2C A;  2QEV A;  3BOW A;  1TUZ A;  4GGN A;  3EK7 A;  2KGB C;  3B88 A;  3VRP A;  2Q91 A;  1K95 A;  2BCB A;  2LHI A;  3I5H B;  4PDZ A;  1OOJ A;  2M7L A;  4DS7 A;  1CNP A;  4PAL A;  3FE8 A;  4QJ4 B;  1OW4 A;  2L2E A;  2L0P A;  1BMO A;  5CSI A;  2NZ0 A;  1U5I B;  4CPV A;  4OZD A;  2G9B A;  1CM4 A;  1LS8 A;  1JF0 A;  5I2L A;  1CMF A;  1EL4 A;  4QJ3 B;  2K8M B;  3CYZ A;  2NXQ A;  1DT7 B;  1AK8 A;  3CZ1 A;  2OTG B;  2EHB A;  1JC2 A;  3EKH A;  2K0J A;  1H4B A;  3DVE A;  4N5X A;  2LNK A;  3CZ0 A;  3PAL A;  5I2Q A;  1A03 A;  2VRG A;  4DCK A;  2TN4 A;  3BYA A;  3H4S E;  2F3Y A;  4OR9 B;  1NCY A;  2JU0 A;  1XYD A;  5HKW A;  1OQP A;  5B8I B;  1D1O A;  1BU3 A;  1MF8 B;  1S5G Z;  1XK4 A;  2Y1N A;  4PE1 A;  2QEB A;  4YGD B;  1YX8 A;  3JVT B;  1CFP A;  2GGM A;  3BUN B;  4C0K A;  1IQ3 A;  1SCM C;  1YUS A;  1F70 A;  1A75 B;  1TNQ A;  1CKK A;  1YRU B;  3SS5 A;  1WRL A;  3HCM A;  2BL0 C;  3OHM B;  1NCX A;  5FI2 A;  1G4Y R;  2BKI B;  2KDH A;  2I7A A;  1S3P A;  3WNX B;  2FCD A;  1CFC A;  1DGV A;  2M29 A;  2JXC A;  2LE9 B;  2RGI A;  3OX5 A;  1JWD A;  2WCK A;  3VGO A;  3Q8I A;  1QAS A;  2H61 A;  4XJK A;  1GGZ A;  1OZO A;  1SW8 A;  2AAO A;  3S0B A;  2ERB A;  2KI4 B;  2NCO A;  1MR8 A;  1TNP A;  1IIO A;  1DTL A;  4C0J A;  1K9U A;  4HRE E;  1TWO A;  3L4A A;  2JPT A;  2V53 A;  4DUQ A;  5HL1 A;  5DKR A;  3VRR A;  4MRX A;  5HLV A;  1IH0 A;  2LAN A;  1C7W A;  1SCM B;  5CSJ A;  1VRK A;  1S6J A;  3ICB A;  5DIC A;  2M0R A;  1AVS A;  1A4P A;  2KYF A;  1TN4 A;  1MHO A;  3FWC A;  4D1E A;  1A75 A;  2LM5 A;  1JFK A;  3BUX B;  1HQV A;  5D3O A;  2M9G A;  3VRN A;  4DRW A;  2KFG A;  1FW4 A;  3CR5 X;  1SR6 B;  1YUU A;  1EG4 A;  1HT9 A;  2PAL A;  2LC5 A;  1CDP A;  3FE9 A;  4N1G A;  2I94 A;  4ICB A;  4TNC A;  3GK1 A;  2LLU A;  1CDM A;  1SL7 A;  5TNC A;  3N7H A;  1RWY A;  1V1G A;  4MBE A;  3O2P A;  1W9Z A;  4MSP A;  1LKJ A;  3CAB A;  2CTN A;  2QPT A;  3D78 A;  1UWO A;  4ORB B;  1J7O A;  2KI6 C;  1G33 A;  2E30 A;  3TZ1 A;  1Q80 A;  4R1E A;  2JPO A;  4INX A;  1BLQ A;  2KGR A;  1QTX A;  1KWO B;  1W7I B;  2K7B A;  5AEQ A;  4BY5 A;  1BG1 A;  3SIA A;  2LMV A;  3TDI A;  5FI7 A;  1B9A A;  1XA5 A;  1OZS A;  3EK4 A;  1IGV A;  4CLN A;  1QLK A;  1QIV A;  1TNX A;  2KSP A;  4I5N B;  3EVU A;  4YGB B;  4CFQ A;  3CLN A;  5AAN A;  1KCY A;  2ZN9 A;  1OOI X;  1WLM A;  2AMI A;  3E3R A;  3BUO B;  3CZT X;  2K61 A;  1RTP 1;  4GUK A;  1RFJ A;  4NDD A;  1XFR A;  4Q04 A;  1C07 A;  3DZT A;  3D74 A;  2F3Z A;  2LMU A;  3CR2 A;  3TDZ A;  5HLO A;  4MZL A;  1UP5 A;  1TOP A;  2KFH A;  1REC A;  5EL2 A;  2CBL A;  2PQL A;  1SL8 A;  2PSR A;  3A4U B;  1SBJ A;  2KAX A;  2WND A;  4GGF C;  3OBV A;  3WHU B;  2ZN8 A;  2I2R E;  1CDL A;  3OP0 A;  1PK0 D;  1KFX L;  2R2I A;  2MBX A;  2ISD A;  1DC1 A;  1YVH A;  3KHE A;  3LK1 A;  4PCW A;  1AHR A;  1YUR A;  2JNF A;  2KFF A;  3ZNI A;  3JTD C;  1DEK A;  5KSZ A;  2LP2 A;  2KBM A;  1M46 A;  1TIZ A;  2KYC A;  1YR5 A;  2WCB A;  1ZUZ A;  1J7R A;  1KQV A;  3NXA A;  2GV5 A;  1K96 A;  1DJY A;  1N2D A;  2CCM A;  1TCO B;  2ZFD A;  4OKH A;  4INW A;  2ZRT A;  5G08 A;  2WCF A;  4I5J A;  1PSR A;  3D0Y B;  2LLS A;  2L4I A;  3EG5 B;  4CFR A;  3KF9 A;  1Y0V H;  4FTG A;  2LHL A;  3AAJ A;  3VRO A;  2Y1M A;  3TS5 C;  4XJK B;  1KFU L;  1KQM C;  5CSN A;  1LA0 A;  3DYE A;  4QJ5 B;  3SG4 A;  1LA3 A;  1S1E A;  4XYN A;  1EJ3 A;  1WY9 A;  1B7T Y;  4HRG A;  1S26 D;  5AER A;  2KI6 D;  1AP4 A;  3EK8 A;  4MZJ A;  3SG7 A;  1IG5 A;  1K8U A;  5AXI A;  1K90 D;  1OMV A;  2ZRS A;  3FIA A;  3FWB A;  4YI8 A;  1LVC D;  2FJU B;  1L2O C;  5GQQ C;  5IBW A;  1KK7 Y;  5CPV A;  4M2Q A;  1TUJ A;  2ZNE A;  4GNK B;  1YUT A;  2JRF A;  4IL1 A;  3D0Y A;  1UUR A;  2M49 B;  3KPX A;  1SKT A;  1PRW A;  3BUW B;  1F54 A;  1B47 A;  2FCE A;  3IQQ A;  1SSE B;  4E68 A;  2D8N A;  1MUX A;  4USL A;  2JNX A;  4GGF A;  1PAL A;  5PAL A;  1C3Y A;  4MVF A;  1JBA A;  2K7O A;  2OPO A;  3B6X A;  1MQ1 A;  1F55 A;  1F4O A;  1DJW A;  3LK0 A;  1FF1 A;  2L5X B;  3QME A;  2NLN A;  2B1U A;  2WOR A;  3CWG A;  3ZWH A;  2KQY A;  4A4B A;  2FJY A;  2LVJ A;  2LMT A;  2BKH B;  4F7F A;  1TRF A;  4YGC B;  1S36 A;  2HET A;  1Y6W A;  1L2O B;  1SY9 A;  1DJI A;  1CB1 A;  1NP8 A;  3V2L A;  2BL0 B;  1Z2C B;  1ALW A;  1SL9 A;  3D75 A;  1W7J B;  2JXL A;  4PHN A;  1ZFS A;  1XO5 A;  2GTE A;  2BEC A;  2P71 A;  3OGN A;  2MA2 A;  3D10 A;  4A4C A;  3PFV A;  2IS9 A;  3IF7 A;  3DY9 A;  3SG3 A;  1DMO A;  5FI6 A;  5I94 A;  4OVN F;  3RM1 A;  1H8B A;  4BY4 A;  1QV1 A;  1AUI B;  2KBI A;  5AFP A;  1QX7 A;  1B7T Z;  1MXL C;  3EVV A;  1DQE A;  1MWN A;  2BBM A;  1YX7 A;  1CM1 A;  2EC6 C;  2JWW A;  2WCM A;  3IVT A;  1OE9 B;  3B87 A;  3CDN A;  2A4J A;  2BE6 A;  3S0A A;  1DF0 B;  2WC5 A;  3AKA A;  1G8I A;  4JPZ B;  2LAP A;  1ALV A;  4JWQ A;  1QAT A;  1K94 A;  2BAP A;  5FYX A;  3RZS A;  1GM0 A;  3AKB A;  2KQ6 A;  3GK4 X;  1PVB A;  1WDC C;  1KK7 Z;  1YTZ C;  2K7D A;  1Z4H A;  1NX0 A;  2LCP A;  1OMR A;  2HQW A;  2MJW B;  1IJ6 A;  3B86 A;  3K21 A;  1CDN A;  4ORC B;  4YGA A;  1TNW A;  1XFU O;  1F71 A;  5K89 A;  2BBN A;  5HKY A;  3K1E A;  1ZOT B;  1EXR A;  2WCE A;  2K60 A;  1JFJ A;  4ZCU A;  5D7F A;  3BFB A;  2HPS A;  2MLF C;  3EKJ A;  3BFH A;  3GK2 A;  1NUB A;  1AJ5 A;  1SYM A;  2COL B;  1KK8 C;  2G2B A;  2FOT A;  1J7P A;  1B8R A;  1F4Q A;  1OSA A;  1NSH A;  1K2H A;  1QXP A;  1IWQ A;  3AAK A;  3NSO A;  1EH2 A;  3O6B A;  4GAO A;  3SJS A;  1UUS A;  1B4C A;  1V1F A;  1DF0 A;  1DGU A;  1C3Z A;  2PYQ A;  1Y1U A;  3WHT B;  5I8N A;  1WDC B;  4PE7 A;  3L4L A;  1OMD A;  2QEO A;  5HYD A;  1GQM A;  1IQ5 A;  2KNE A;  1KSO A;  3S0D A;  5DKQ A;  4GFT A;  3L47 A;  2M3W A;  2WCH A;  2WCL A;  3NHI A;  3NSK A;  3SG5 A;  1XK4 C;  3DF0 A;  1IRJ A;  1GJY A;  3O78 A;  3DVM A;  4GPL B;  2O60 A;  2KAY A;  5I2O A;  4N1F A;  5F6T A;  5J3X A;  2F8P A;  2WC6 A;  1FI6 A;  1QS7 A;  3BUM B;  4JD9 A;  4AQJ A;  1DVI A;  1DEL A;  2LV7 A;  2H8V A;  2KHN A;  3CTN A;  1NIW A;  1BOD A;  3C1V A;  3FS7 A;  3CR4 X;  3NSL A;  2I18 A;  4NQG A;  3OB1 B;  3DXL A;  2PVB A;  1TTX A;  2OTG C;  4UPG A;  1J1D A;  2L51 A;  4P2Y B;  2LVV A;  3VRQ A;  5KU1 A;  1SPY A;  2K2F A;  1CTR A;  1R6P A;  2OS8 C;  3NGV A;  1WRZ A;  2BNX A;  1CLL A;  3PM2 A;  2M7N A;  3PM8 A;  5HKZ A;  3SS3 A;  1FBV A;  1Y1A A;  2O5G A;  3JTD B;  1DJZ A;  3R72 A;  3I5G C;  2LVI A;  2K7C A;  2KLD A;  1UHJ A;  3B7A A;  1N0Y A;  2JOJ A;  2M97 A;  3JVT C;  1QLS A;  3M0W A;  1M63 B;  2HF5 A;  2QDI A;  3OB2 B;  1QIW A;  3R1P A;  4NDB A;  1L7Z A;  4FQO A;  4PE0 A;  2PAS A;  1CLM A;  3TUY C;  4WQ3 A;  3KEV A;  2WOS A;  2JTT A;  3DVK A;  3D76 A;  1M45 A;  2P6B B;  3QRX A;  3BQ3 A;  3PAT A;  1UHN A;  2JQ6 A;  3TS5 B;  3KO0 A;  3SG2 A;  1KQM B; 
#chains in the Genus database with same CATH homology
 1SRA A;  3DD4 A;  4L9M A;  2OS8 B;  4MRY A;  2KI4 C;  4GBA A;  1LIN A;  1FI5 A;  1EG3 A;  1NWD A;  4NDC A;  1BOC A;  1UHK A;  4OV2 A;  1B8L A;  1YVL A;  1JSA A;  3I5G B;  1SK6 D;  3CGA A;  3MSE B;  5CSF A;  4U8D A;  2JTZ A;  2BCA A;  4MN0 A;  1IJ5 A;  3LL8 B;  1S6I A;  2MLE C;  5ER4 X;  4AOM A;  3PN7 C;  2Y4Q A;  3TUY B;  1BT6 A;  2SAS A;  4WQ2 A;  1PUL A;  1CFD A;  3I5I C;  3OX6 A;  1B8C A;  2BE4 A;  2F2O A;  5BPJ A;  1J55 A;  5JJG A;  2CNP A;  1NX3 A;  2L50 A;  4MZK A;  1QX5 B;  1SR6 C;  1XFY O;  1WRK A;  1NCZ A;  1XFX O;  4PHM A;  1BF5 A;  1QVI Y;  1SNL A;  1U5I A;  1Y1X A;  2MRD A;  1M31 A;  2LP3 A;  1K9P A;  2AUC A;  1JF2 A;  4YRU A;  1PSB A;  1QX2 A;  1BR1 B;  3A8R A;  2H2K A;  3I5F C;  2K2A A;  2Y5I A;  2GGZ A;  1XFW O;  1XVJ A;  1BJF A;  3LLE A;  1F8H A;  1M39 A;  4OCI A;  4M2P A;  4HRH A;  2PRU A;  3SG6 A;  1RRO A;  1SMG A;  4HSZ A;  1LXF C;  3PN7 B;  4MEW A;  2M1K B;  2JT0 A;  1WLZ A;  3F45 A;  2KOT A;  2NCP A;  2CT9 A;  1MXE A;  2DOQ A;  2MAZ A;  3DVJ A;  4ETO A;  1KSM A;  3I5I B;  2M8U A;  1JUO A;  4I5K A;  2F33 A;  1KWO C;  1DJG A;  1RJV A;  3IQO A;  5KTY A;  4ORA B;  1K93 D;  1TCF A;  1XFZ O;  2L98 A;  1B1G A;  1NX1 A;  2LVK A;  3DF0 B;  2BCX A;  2JT3 A;  3RLZ A;  1GGW A;  3I5F B;  1C7V A;  1KFX S;  2SCP A;  2LUC A;  3PSR A;  5JOL A;  4F0Z B;  2JC2 A;  1CMG A;  1QJT A;  4YGE B;  1NX2 A;  2EC6 B;  2ZND A;  5ER5 A;  5DKN A;  2KAV A;  2M1U A;  2EGD A;  4ZCV A;  1QV0 A;  2LUX A;  4P5O E;  4PE4 A;  1DJX A;  1IKU A;  1BR4 B;  1N65 A;  1A29 A;  1ODB A;  3NSI A;  1NYA A;  1CLB A;  2CXJ A;  4AQI A;  2LLT A;  1A2X A;  3O4Y A;  1KFU S;  3SIB A;  3BXK A;  4CID A;  1NPQ A;  1QVI Z;  3EVR A;  4PHK A;  4C0L A;  4DIR A;  1FPW A;  3BOW B;  3TDU A;  1S5G Y;  3LCP C;  3CS1 A;  1J1E A;  1UHH A;  2JUL A;  1AJ4 A;  2QAC A;  5D69 A;  2WC8 A;  1KK8 B;  1DJH A;  2ZKM X;  1YRT B;  1RK9 A;  1X02 A;  2Q4U A;  3I5H C;  4WRI A;  2F2P A;  4YI9 A;  2PMY A;  2H61 C;  2L4H A;  1SCV A;  1R2U A;  1XFV O;  1ZMZ A;  2E6W A;  2JZI A;  4PHJ A;  2JT8 A;  4MLW A;  1PVA A;  3WXA A;  4I5L B;  2HQ8 A;  1ZAC A;  1S6C A;  3HX4 A;  3PLF B;  4JQ0 D;  1K9K A;  1E8A A;  4M2O A;  1UHI A;  2MHH A;  4YBH B;  1CFF A;  3GOF A;  1J7Q A;  3BOW A;  4GGN A;  3EK7 A;  2KGB C;  3VRP A;  2Q91 A;  1K95 A;  2BCB A;  2LHI A;  3I5H B;  4PDZ A;  1OOJ A;  2M7L A;  4DS7 A;  1CNP A;  4PAL A;  4QJ4 B;  2L2E A;  2L0P A;  1BMO A;  5CSI A;  2NZ0 A;  1U5I B;  4CPV A;  2G9B A;  1CM4 A;  1JF0 A;  5I2L A;  1CMF A;  1EL4 A;  4QJ3 B;  2K8M B;  1AK8 A;  2NXQ A;  1DT7 B;  2OTG B;  2EHB A;  1JC2 A;  3EKH A;  2K0J A;  1H4B A;  3DVE A;  4N5X A;  2LNK A;  3PAL A;  1A03 A;  5I2Q A;  2VRG A;  4DCK A;  2TN4 A;  3BYA A;  3H4S E;  2F3Y A;  4OR9 B;  1NCY A;  2JU0 A;  1XYD A;  5HKW A;  1OQP A;  5B8I B;  1D1O A;  1BU3 A;  1MF8 B;  1S5G Z;  1XK4 A;  2Y1N A;  4PE1 A;  4YGD B;  1YX8 A;  3JVT B;  1CFP A;  2GGM A;  3BUN B;  4C0K A;  1IQ3 A;  1SCM C;  1YUS A;  1F70 A;  1A75 B;  1TNQ A;  1CKK A;  1YRU B;  1WRL A;  3HCM A;  2BL0 C;  3OHM B;  1NCX A;  1G4Y R;  2BKI B;  2KDH A;  2I7A A;  1S3P A;  3WNX B;  2FCD A;  1CFC A;  1DGV A;  2M29 A;  2JXC A;  2LE9 B;  2RGI A;  3OX5 A;  1JWD A;  3VGO A;  1QAS A;  2H61 A;  4XJK A;  1GGZ A;  1OZO A;  1SW8 A;  2AAO A;  2KI4 B;  2NCO A;  1MR8 A;  1TNP A;  1DTL A;  4C0J A;  1K9U A;  4HRE E;  2JPT A;  2V53 A;  4DUQ A;  5DKR A;  3VRR A;  4MRX A;  5HLV A;  1IH0 A;  2LAN A;  1C7W A;  1SCM B;  5CSJ A;  1VRK A;  1S6J A;  3ICB A;  2M0R A;  1AVS A;  1A4P A;  2KYF A;  1TN4 A;  1MHO A;  3FWC A;  4D1E A;  1A75 A;  2LM5 A;  1JFK A;  3BUX B;  1HQV A;  2M9G A;  3VRN A;  4DRW A;  2KFG A;  1FW4 A;  3CR5 X;  1SR6 B;  1EG4 A;  1HT9 A;  1YUU A;  2PAL A;  2LC5 A;  1CDP A;  4N1G A;  2I94 A;  4ICB A;  4TNC A;  3GK1 A;  2LLU A;  1CDM A;  1SL7 A;  5TNC A;  1RWY A;  1V1G A;  4MBE A;  3O2P A;  4MSP A;  1LKJ A;  2CTN A;  2QPT A;  1UWO A;  4ORB B;  1J7O A;  2KI6 C;  1G33 A;  2E30 A;  3TZ1 A;  1Q80 A;  4R1E A;  1BLQ A;  2KGR A;  1QTX A;  1KWO B;  1W7I B;  2K7B A;  5AEQ A;  4BY5 A;  1BG1 A;  3SIA A;  2LMV A;  3TDI A;  1B9A A;  1XA5 A;  1OZS A;  3EK4 A;  1IGV A;  4CLN A;  1QLK A;  1QIV A;  1TNX A;  2KSP A;  4I5N B;  3EVU A;  4YGB B;  4CFQ A;  3CLN A;  5AAN A;  1KCY A;  2ZN9 A;  1WLM A;  2AMI A;  3E3R A;  3BUO B;  3CZT X;  2K61 A;  1RTP 1;  4GUK A;  1RFJ A;  4NDD A;  4Q04 A;  1C07 A;  2F3Z A;  2LMU A;  3CR2 A;  3TDZ A;  5HLO A;  4MZL A;  1UP5 A;  1TOP A;  2KFH A;  1REC A;  2CBL A;  1SL8 A;  2PSR A;  3A4U B;  1SBJ A;  2KAX A;  2WND A;  4GGF C;  3WHU B;  2ZN8 A;  2I2R E;  1CDL A;  3OP0 A;  1PK0 D;  1KFX L;  2R2I A;  2MBX A;  2ISD A;  1YVH A;  3KHE A;  3LK1 A;  4PCW A;  1AHR A;  1YUR A;  2JNF A;  2KFF A;  3ZNI A;  3JTD C;  5KSZ A;  2LP2 A;  2KBM A;  1M46 A;  1TIZ A;  2KYC A;  1YR5 A;  2WCB A;  1ZUZ A;  1J7R A;  1KQV A;  3NXA A;  2GV5 A;  1K96 A;  2CCM A;  1DJY A;  1N2D A;  1TCO B;  2ZFD A;  4OKH A;  2ZRT A;  5G08 A;  2WCF A;  4I5J A;  1PSR A;  3D0Y B;  2LLS A;  2L4I A;  4CFR A;  3KF9 A;  1Y0V H;  4FTG A;  2LHL A;  3AAJ A;  3VRO A;  2Y1M A;  3TS5 C;  4XJK B;  1KFU L;  1KQM C;  5CSN A;  1LA0 A;  4QJ5 B;  3SG4 A;  1LA3 A;  1S1E A;  4XYN A;  1EJ3 A;  1WY9 A;  1B7T Y;  4HRG A;  1S26 D;  5AER A;  2KI6 D;  1AP4 A;  3EK8 A;  4MZJ A;  3SG7 A;  1IG5 A;  1K8U A;  5AXI A;  1K90 D;  1OMV A;  2ZRS A;  3FIA A;  3FWB A;  4YI8 A;  1LVC D;  2FJU B;  1L2O C;  5GQQ C;  5IBW A;  1KK7 Y;  5CPV A;  4M2Q A;  4GNK B;  2ZNE A;  1YUT A;  2JRF A;  4IL1 A;  3D0Y A;  1UUR A;  2M49 B;  3KPX A;  1SKT A;  1PRW A;  3BUW B;  1F54 A;  1B47 A;  2FCE A;  3IQQ A;  4E68 A;  2D8N A;  1MUX A;  4USL A;  2JNX A;  4GGF A;  1PAL A;  5PAL A;  4MVF A;  1JBA A;  2K7O A;  2OPO A;  1MQ1 A;  1F55 A;  1F4O A;  1DJW A;  3LK0 A;  1FF1 A;  2L5X B;  2NLN A;  2B1U A;  2WOR A;  3CWG A;  3ZWH A;  2KQY A;  4A4B A;  2LVJ A;  2LMT A;  2BKH B;  1TRF A;  4YGC B;  1S36 A;  2HET A;  1Y6W A;  1L2O B;  1SY9 A;  1DJI A;  1CB1 A;  1NP8 A;  2BL0 B;  1ALW A;  1SL9 A;  1W7J B;  2JXL A;  4PHN A;  1ZFS A;  1XO5 A;  2BEC A;  2MA2 A;  3D10 A;  4A4C A;  3PFV A;  2IS9 A;  3IF7 A;  3SG3 A;  1DMO A;  4OVN F;  3RM1 A;  1H8B A;  4BY4 A;  1QV1 A;  1AUI B;  2KBI A;  5AFP A;  1QX7 A;  1B7T Z;  1MXL C;  3EVV A;  2JWW A;  1MWN A;  2BBM A;  1YX7 A;  1CM1 A;  2EC6 C;  3QRX A;  1OE9 B;  2A4J A;  2BE6 A;  1DF0 B;  3AKA A;  1G8I A;  4JPZ B;  2LAP A;  1ALV A;  4JWQ A;  1QAT A;  1K94 A;  5FYX A;  3AKB A;  2KQ6 A;  3GK4 X;  1PVB A;  1WDC C;  1KK7 Z;  1YTZ C;  2K7D A;  1NX0 A;  2LCP A;  2MJW B;  1OMR A;  2HQW A;  1CDN A;  1IJ6 A;  3K21 A;  4ORC B;  4YGA A;  1TNW A;  1XFU O;  1F71 A;  5K89 A;  2BBN A;  5HKY A;  1ZOT B;  1EXR A;  2WCE A;  1JFJ A;  4ZCU A;  5D7F A;  2HPS A;  2MLF C;  3EKJ A;  3GK2 A;  1NUB A;  1AJ5 A;  1SYM A;  2COL B;  1KK8 C;  2G2B A;  2FOT A;  1J7P A;  1B8R A;  1F4Q A;  1OSA A;  1NSH A;  1K2H A;  1QXP A;  1IWQ A;  3AAK A;  3NSO A;  1EH2 A;  3O6B A;  4GAO A;  3SJS A;  1UUS A;  1B4C A;  1V1F A;  1DF0 A;  1DGU A;  3WHT B;  5I8N A;  1Y1U A;  1WDC B;  4PE7 A;  1OMD A;  5HYD A;  1GQM A;  1IQ5 A;  2KNE A;  1KSO A;  5DKQ A;  4GFT A;  2M3W A;  3NSK A;  3SG5 A;  1XK4 C;  3DF0 A;  1IRJ A;  1GJY A;  3O78 A;  3DVM A;  4GPL B;  2O60 A;  2KAY A;  5I2O A;  4N1F A;  5F6T A;  5J3X A;  2F8P A;  1FI6 A;  1QS7 A;  3BUM B;  4AQJ A;  1DVI A;  2LV7 A;  2KHN A;  3CTN A;  1NIW A;  1BOD A;  3C1V A;  3FS7 A;  3CR4 X;  3NSL A;  2I18 A;  4NQG A;  3OB1 B;  2PVB A;  1TTX A;  2OTG C;  4UPG A;  1J1D A;  2L51 A;  4P2Y B;  2LVV A;  3VRQ A;  5KU1 A;  1SPY A;  2K2F A;  1CTR A;  1R6P A;  2OS8 C;  1WRZ A;  1CLL A;  5HKZ A;  2M7N A;  3PM8 A;  1FBV A;  1Y1A A;  2O5G A;  3JTD B;  1DJZ A;  3I5G C;  2LVI A;  2K7C A;  1UHJ A;  1N0Y A;  2JOJ A;  2M97 A;  3JVT C;  1QLS A;  3M0W A;  1M63 B;  2HF5 A;  3OB2 B;  4NDB A;  1QIW A;  1L7Z A;  4FQO A;  4PE0 A;  2PAS A;  1CLM A;  3TUY C;  4WQ3 A;  3KEV A;  2WOS A;  2JTT A;  3DVK A;  1M45 A;  2P6B B;  3BQ3 A;  3PAT A;  1UHN A;  2JQ6 A;  3TS5 B;  3KO0 A;  3SG2 A;  1KQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...