1H4BA

Solution structure of the birch pollen allergen bet v 4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLCALCIN BET V 4
publication title Solution Structure, Dynamics, and Hydrodynamics of the Calcium-Bound Cross-Reactive Birch Pollen Allergen Bet V 4 Reveal a Canonical Monomeric Two EF-Hand Assembly with a Regulatory Function
pubmed doi rcsb
source organism Betula verrucosa
molecule tags Allergen
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h4bA00
2K7CA 5D7FA 1S3PA 2B1UA 2M1UA 5K89A 3BUWB 2KBIA 1UWOA 2EGDA 1FI5A 1NCZA 2L0PA 5F6TA 3ICBA 3DVEA 4WRIA 1KWOB 1UHIA 1CLMA 1SL7A 1SMGA 4MZJA 1A4PA 3I5HB 4ORAB 3BUMB 2FCEA 1C07A 1DTLA 1WDCC 1XFUO 3MSEB 1FBVA 3I5IC 2JOJA 3ZNIA 1AK8A 3GK4X 4YGDB 4M2QA 1CKKA 5DKRA 3NSIA 4PE7A 4CFQA 2JWWA 2MRDA 4GPLB 2BKHB 4QJ5B 3VGOA 1CLLA 2L2EA 1FI6A 5CSJA 3I5GB 1IGVA 1WLMA 1OMDA 3HX4A 3VROA 1QX7A 2M97A 3CWGA 2K2AA 3OP0A 3DF0B 2M8UA 1S6CA 4GGFA 4GFTA 1AVSA 1UHHA 1KK7Y 2L98A 1S6IA 3ZWHA 2KHNA 2LANA 4I5LB 4XYNA 4C0LA 1NX1A 1PULA 4CLNA 1QVIY 1RJVA 1KFUL 1MXEA 1OMRA 4YGCB 2MA2A 2QPTA 2Y1NA 2L50A 2Y1MA 3PATA 1ZUZA 1M39A 1EG3A 2BL0B 1NP8A 4HRGA 1DJGA 1SY9A 4UPGA 4MSPA 1WLZA 2CXJA 4ZCVA 1QV0A 1OZOA 4DCKA 5CSFA 3BOWA 3C1VA 1YURA 1V1FA 2JQ6A 1F4QA 5ER5A 1F55A 1XO5A 2JULA 1LINA 2HF5A 3WHUB 2M9GA 1NSHA 1AHRA 1IG5A 1WDCB 3BYAA 4PDZA 2F8PA 2KFHA 3I5IB 3O6BA 3OB1B 4JPZB 2JXCA 1SL9A 1TOPA 3VRNA 1CMFA 1M31A 1XFXO 4MLWA 4C0JA 1JFJA 1XFZO 1EXRA 2AAOA 2L5XB 4HRHA 1PALA 2LAPA 4I5JA 1X02A 2L51A 4DS7A 1QASA 1SRAA 1NIWA 2LM5A 3LK0A 3SJSA 1DMOA 1SR6C 4QJ3B 2G9BA 3TZ1A 1DVIA 1F71A 2JTZA 3KPXA 3WNXB 2HQ8A 2TN4A 4OR9B 5FYXA 1FPWA 1QIVA 5HKYA 5D69A 5HLVA 3GK2A 2NCOA 1J7OA 4MVFA 1J55A 1YUTA 1JC2A 2FOTA 2LP2A 4HSZA 1K94A 1QXPA 3JTDC 2LUXA 3BUNB 4OCIA 1S36A 2M49B 1KWOC 3E3RA 1M63B 3TDUA 2OTGC 1NWDA 2K2FA 1MWNA 2ZN9A 4YI8A 1IRJA 4M2PA 1YUSA 1G33A 2PRUA 3DF0A 2EC6C 3VRRA 1CTRA 3SG6A 1SW8A 3K21A 3OHMB 1CLBA 1WRZA 4PE4A 3I5GC 2KAVA 5JJGA 2CT9A 1DJZA 2KFGA 1UHNA 1CFCA 1YX7A 1JBAA 1W7JB 1B47A 1S5GZ 1RTP1 1CMGA 1Y0VH 2JXLA 1BMOA 5AANA 1CFDA 1Y1AA 3DD4A 1LA0A 1SR6B 2KDHA 2PASA 2WCFA 4GBAA 1F8HA 5DKQA 1H4BA 1MQ1A 3OX6A 2BBNA 1RECA 1M45A 1TRFA 5TNCA 2WNDA 1MXLC 2DOQA 1W7IB 1YX8A 1TCFA 2F3ZA 1SKTA 3BXKA 4OVNF 4YGBB 4NDCA 1LKJA 2Y4QA 3JTDB 2WOSA 1GGWA 1KQMC 1U5IB 1MUXA 1YRUB 1JFKA 2M1KB 2OTGB 2L4IA 1BODA 1BR4B 1K95A 2L4HA 4MEWA 2Q91A 3LCPC 1PSRA 4XJKB 1D1OA 2MJWB 3O2PA 3O78A 3EK4A 5CSNA 2EC6B 1A2XA 1NCXA 2KNEA 5KTYA 2F3YA 1CFFA 2BKIB 3JVTC 1MR8A 2M0RA 2QACA 2BBMA 2PVBA 2BCXA 1KQVA 2GGMA 3D0YB 2ZFDA 1N65A 1H8BA 2LNKA 4ICBA 2MLEC 1OZSA 2KGRA 4M2OA 2HPSA 1CDMA 2AMIA 1F70A 1CDLA 5G08A 2JT0A 1B4CA 1YUUA 3SG2A 4P5OE 1RROA 3HCMA 1LVCD 2LCPA 1UUSA 3AAJA 2KYCA 1KSOA 1CNPA 1NPQA 2CBLA 4E68A 5HKWA 3VRPA 2LUCA 1FF1A 2I18A 1PVAA 2LVJA 4FTGA 2KAYA 2LLSA 4D1EA 1ZOTB 1N0YA 1EJ3A 2LMTA 1EH2A 1QS7A 2LVVA 1IQ5A 1F4OA 3AKBA 1DF0B 4OV2A 1QTXA 1KQMB 1ALWA 1BF5A 1DJYA 2KI6C 2HETA 5PALA 2AUCA 2G2BA 1K9PA 2LLTA 4U8DA 1EG4A 1HT9A 1OE9B 3PALA 3A8RA 1KK8C 3OX5A 1Y1XA 4Q04A 1YVLA 1UHKA 2LC5A 2LVKA 1TNXA 5GQQC 1B7TZ 3D10A 1OMVA 5I2QA 3TDIA 3TDZA 3JVTB 1B8CA 4GUKA 1YR5A 5KU1A 1XFYO 1YRTB 1WRLA 1XK4C 4BY5A 1LA3A 2KAXA 2JTTA 4ORCB 1ODBA 1S5GY 4A4BA 1J1DA 1KFUS 1U5IA 1K93D 3CTNA 3IQQA 1BG1A 2F2OA 2WORA 1A29A 4DUQA 4XJKA 1AJ5A 4PE1A 1V1GA 2KGBC 2BCAA 2GGZA 4R1EA 3CS1A 4AQIA 5BPJA 1B9AA 1TN4A 2ZRTA 2OS8C 2PALA 1SCMC 1QX5B 1JWDA 1NX2A 2CTNA 1XFVO 3D0YA 3QRXA 1QVIZ 2F2PA 3F45A 5AERA 1TNQA 2K7DA 4PHNA 2K7OA 3A4UB 3O4YA 2Q4UA 3EKJA 1AJ4A 1CFPA 2MLFC 1VRKA 2O5GA 1KSMA 1N2DA 1KK8B 1KFXL 1QX2A 1PVBA 2KQYA 2ZKMX 3SG5A 2CCMA 3KEVA 1OSAA 2ZN8A 1IH0A 1RWYA 1AP4A 1B1GA 1DGVA 1SL8A 4YI9A 3EVVA 1C7WA 1WRKA 3SG7A 4HREE 1KCYA 1NYAA 2CNPA 5JOLA 3AAKA 1EL4A 3BUOB 1B8LA 2KSPA 2OPOA 5IBWA 1K9UA 1QJTA 1JF0A 1XA5A 2BE6A 3DVKA 1DF0A 4CFRA 2BCBA 4AOMA 5CSIA 3FWCA 2H61C 1PSBA 3NXAA 2M7NA 1L2OC 2Y5IA 1CM4A 1OQPA 2O60A 1NCYA 2D8NA 2OS8B 1SCMB 1SPYA 2P6BB 3CLNA 4ZCUA 2EHBA 3RLZA 4I5NB 1K2HA 2JNFA 3VRQA 1DJIA 1KFXS 1R2UA 3GK1A 1TCOB 4GGNA 5B8IB 5J3XA 4F0ZB 3CR2A 1TIZA 3LLEA 2KQ6A 2KFFA 2K8MB 4GNKB 4YRUA 3PN7C 1TNWA 2LE9B 4ORBB 3TS5C 3RM1A 1CM1A 4BY4A 1DJXA 4NQGA 4WQ2A 5I8NA 2LMUA 3IF7A 1B7TY 4FQOA 1NX0A 3SIBA 1PRWA 3SG3A 2WC8A 4DRWA 2H2KA 2F33A 5AFPA 2KI6D 3EK7A 4QJ4B 2ZNEA 3I5FB 1XYDA 5AEQA 2LP3A 1UP5A 2KI4C 1BU3A 2M7LA 1IWQA 5HLOA 4CPVA 1K90D 2HQWA 4MRXA 4CIDA 2MHHA 3CR4X 1UHJA 3WXAA 1WY9A 3LL8B 2BE4A 2V53A 3KHEA 1L2OB 3KO0A 4NDDA 3PSRA 1GGZA 3NSOA 1FW4A 1XFWO 4MBEA 4N1GA 4P2YB 2K7BA 2R2IA 3LK1A 3EK8A 5CPVA 3SIAA 1IJ6A 4MZKA 1XK4A 4YGAA 1YTZC 1BR1B 1QATA 1YVHA 2JT8A 1QLKA 2JU0A 4N1FA 1IKUA 3CR5X 4GGFC 2ISDA 3NSLA 2JRFA 2I7AA 2M29A 2VRGA 3PLFB 2GV5A 2WCBA 2M3WA 3PN7B 5ER4X 2A4JA 2SCPA 1GJYA 1R6PA 2LHLA 3TS5B 2SASA 2E6WA 2LVIA 1A03A 3AKAA 4JWQA 4YBHB 1QV1A 2RGIA 4USLA 1ZMZA 1SK6D 3EVRA 1M46A 1SBJA 3FIAA 1K96A 1A75B 2JPTA 2I2RE 1NUBA 3GOFA 4JQ0D 1JF2A 1NX3A 3SG4A 4PE0A 1S26D 1TNPA 3PM8A 3TUYC 1E8AA 2KI4B 3NSKA 1S1EA 4IL1A 1LXFC 3IQOA 1IQ3A 4N5XA 2NZ0A 1DJWA 4A4CA 4WQ3A 1Y1UA 4ETOA 5I2LA 1GQMA 2K61A 3CZTX 5HYDA 3M0WA 1KK7Z 4PALA 2JZIA 2I94A 4PHKA 3BUXB 1TTXA 5DKNA 1BT6A 1DT7B 3WHTB 1B8RA 1K8UA 1G4YR 1F54A 4NDBA 1HQVA 2MAZA 1MHOA 2BECA 2PMYA 1QLSA 2IS9A 3PFVA 1SNLA 3EVUA 2LMVA 3FS7A 1Q80A 1BOCA 1RK9A 2ZRSA 1RFJA 5HKZA 2MBXA 1SCVA 1PK0D 2KBMA 1MF8B 4PHMA 2WCEA 2E30A 1J1EA 1IJ5A 1ZFSA 3EKHA 3I5HC 1BJFA 2H61A 3H4SE 4MN0A 2ZNDA 2LV7A 2JT3A 1UURA 1BLQA 1OOJA 3I5FC 2FJUB 2PSRA 3OB2B 1S6JA 2K0JA 3DVMA 1J7PA 1JSAA 4PHJA 1ZACA 1ALVA 2KOTA 1JUOA 3DVJA 2NLNA 1Y6WA 2NCPA 1C7VA 1G8IA 2JC2A 2LHIA 1K9KA 2JNXA 3TUYB 1AUIB 3KF9A 4DIRA 3CGAA 5KSZA 3BOWB 3BQ3A 2KYFA 4C0KA 4TNCA 2NXQA 2COLB 4GAOA 1L7ZA 5AXIA 1CB1A 1QIWA 1CDNA 2FCDA 1SYMA 4PCWA 4MZLA 1DGUA 4MRYA 1J7QA 4YGEB 2LLUA 3FWBA 1J7RA 4L9MA 4I5KA 4AQJA 1XVJA 2BL0C 1A75A 1CDPA 5I2OA 1DJHA 4OKHA
chains in the Genus database with same CATH superfamily
2K7CA 3NHTA 1QWVA 1S3PA 2B1UA 2M1UA 5D7FA 5K89A 3BUWB 2KBIA 1TWOA 1UWOA 2EGDA 1NCZA 1FI5A 2L0PA 5F6TA 3OBVA 3ICBA 3DVEA 3FE6A 4WRIA 1KWOB 1UHIA 1CLMA 1SL7A 1SMGA 4MZJA 1A4PA 3I5HB 3L4AA 4ORAB 3BUMB 2FCEA 1C07A 2WC6A 1DTLA 1WDCC 1XFUO 3MSEB 1FBVA 3I5IC 2JOJA 3ZNIA 1AK8A 3GK4X 2BNXA 4M2QA 4YGDB 5DKRA 1CKKA 3NSIA 4PE7A 4CFQA 2JWWA 3Q8IA 2MRDA 4GPLB 1Z4HA 3RZSA 5FI7A 2BKHB 4QJ5B 1Z2CB 3VGOA 1CLLA 2L2EA 5EL2A 1FI6A 5CSJA 3I5GB 1IGVA 1WLMA 1OMDA 3HX4A 3VROA 1QX7A 2M97A 3SS5A 3CWGA 2K2AA 3OP0A 3DF0B 2M8UA 1S6CA 4GGFA 4GFTA 1AVSA 1UHHA 1KK7Y 2L98A 1S6IA 3ZWHA 2KHNA 2LANA 4I5LB 4XYNA 4C0LA 1NX1A 1PULA 4CLNA 1QVIY 1RJVA 1KFUL 1MXEA 1OMRA 4YGCB 3OGNA 2MA2A 2QPTA 2Y1NA 2L50A 2Y1MA 3PATA 1ZUZA 1M39A 1EG3A 2BL0B 1NP8A 4HRGA 1DJGA 1SY9A 4UPGA 4MSPA 1WLZA 2CXJA 4ZCVA 1QV0A 1OZOA 4DCKA 1DC1A 5CSFA 3BFBA 3BOWA 3C1VA 1YURA 1V1FA 2JQ6A 1F4QA 5ER5A 2FJYA 4INWA 1F55A 3K1EA 1XO5A 2JULA 1LINA 2HF5A 3WHUB 2M9GA 1NSHA 1AHRA 1IG5A 1WDCB 3BYAA 4PDZA 2F8PA 2KFHA 2BAPA 3I5IB 3O6BA 3OB1B 2JXCA 4JPZB 1SL9A 1TOPA 3VRNA 1CMFA 1M31A 1XFXO 4MLWA 4C0JA 1JFJA 1XFZO 1EXRA 2AAOA 2L5XB 4HRHA 1PALA 2LAPA 4I5JA 1X02A 2L51A 4DS7A 1QASA 1SRAA 1NIWA 2LM5A 3LK0A 3SJSA 1DMOA 1SR6C 4QJ3B 2G9BA 1SSEB 3TZ1A 1DVIA 1F71A 2JTZA 3KPXA 3WNXB 2HQ8A 2TN4A 4OR9B 5FYXA 1FPWA 1QIVA 5HKYA 5D69A 5HLVA 3GK2A 2NCOA 5D3OA 3SS3A 4MVFA 1J55A 1J7OA 3D73A 1YUTA 3N7HA 1JC2A 2FOTA 2LP2A 4HSZA 1K94A 1QXPA 3JTDC 2LUXA 3BUNB 2WCKA 4OCIA 1S36A 2M49B 1KWOC 3E3RA 1M63B 3TDUA 2OTGC 1NWDA 2K2FA 1MWNA 2L2CA 2ZN9A 4YI8A 1IRJA 4M2PA 1YUSA 1G33A 2PRUA 3DF0A 2EC6C 3VRRA 1CTRA 3SG6A 1SW8A 3K21A 3OHMB 1CLBA 1WRZA 4PE4A 3I5GC 2KAVA 5JJGA 2CT9A 1DJZA 2KFGA 1UHNA 1CFCA 1YX7A 1JBAA 1W7JB 4KYNA 4PT1A 1B47A 1S5GZ 2WC5A 1RTP1 2JPOA 1CMGA 1Y0VH 2JXLA 1BMOA 5AANA 1CFDA 1Y1AA 3DD4A 1OW4A 1LA0A 1SR6B 2KDHA 2PASA 2WCFA 4GBAA 1F8HA 5DKQA 1H4BA 1MQ1A 3OX6A 2BBNA 1RECA 1M45A 1TRFA 5TNCA 2WNDA 1MXLC 3DXLA 2DOQA 1W7IB 1YX8A 1TCFA 2F3ZA 3B87A 1SKTA 3BXKA 4OVNF 4YGBB 4NDCA 1LKJA 2Y4QA 3CZ0A 3JTDB 2WOSA 1GGWA 3VB1A 1KQMC 3UO9A 1U5IB 1MUXA 1YRUB 1JFKA 2M1KB 2OTGB 2WCLA 2L4IA 1BODA 1BR4B 1K95A 2L4HA 4MEWA 2Q91A 3LCPC 1PSRA 4XJKB 1D1OA 3QMEA 2MJWB 3O2PA 3O78A 3EK4A 5CSNA 2EC6B 3L47A 1A2XA 1NCXA 2KNEA 5KTYA 2F3YA 1CFFA 2BKIB 3JVTC 1MR8A 2M0RA 2QACA 2BBMA 2PVBA 2BCXA 1KQVA 2GGMA 3D0YB 2ZFDA 2YGUA 1N65A 1H8BA 2LNKA 3S0GA 1ORGA 4ICBA 2MLEC 1OZSA 5FI6A 2KGRA 2K60A 4M2OA 2HPSA 3CZ1A 4F7FA 1CDMA 2AMIA 3R1PA 1CDLA 5G08A 2JT0A 1B4CA 1F70A 1YUUA 3SG2A 3S0DA 4P5OE 1RROA 3HCMA 3R72A 1LVCD 2LCPA 1UUSA 3AAJA 2KYCA 1KSOA 1CNPA 1NPQA 2CBLA 4E68A 2WCHA 5HKWA 3VRPA 2LUCA 1FF1A 2I18A 1PVAA 2LVJA 4FTGA 2KAYA 2LLSA 4D1EA 3B88A 1ZOTB 1N0YA 1EJ3A 2LMTA 1EH2A 4OZDA 1QS7A 2LVVA 1IQ5A 1F4OA 3AKBA 1DF0B 4OV2A 1QTXA 1KQMB 1ALWA 1BF5A 1DJYA 2KI6C 2HETA 5PALA 2AUCA 2G2BA 1K9PA 3B7AA 2LLTA 4U8DA 1EG4A 1HT9A 1OE9B 3PALA 3A8RA 1KK8C 3OX5A 1Y1XA 4Q04A 1YVLA 1UHKA 2LC5A 1TUZA 2LVKA 1TNXA 5GQQC 1B7TZ 3D10A 1OMVA 5I2QA 3TDIA 1W9ZA 3TDZA 3JVTB 1B8CA 4GUKA 1YR5A 5KU1A 1XFYO 1YRTB 1WRLA 1XK4C 4BY5A 1LA3A 2KAXA 2JTTA 3L4LA 4ORCB 1DELA 3CABA 1ODBA 4JD9A 1S5GY 4A4BA 1J1DA 1KFUS 1U5IA 1K93D 3CTNA 3IQQA 1BG1A 2F2OA 2WORA 3D76A 3S0AA 1A29A 4DUQA 4XJKA 1AJ5A 4PE1A 1V1GA 2KGBC 2BCAA 2GGZA 4R1EA 3CS1A 3IVTA 4AQIA 5BPJA 1C3YA 1B9AA 1TN4A 4IJ7A 2ZRTA 2OS8C 3S0FA 2PALA 1SCMC 1QX5B 1JWDA 1NX2A 2CTNA 1XFVO 3D0YA 3QRXA 1QVIZ 2F2PA 3F45A 5AERA 1TNQA 2K7DA 4PHNA 2K7OA 3A4UB 3O4YA 2Q4UA 3EKJA 1AJ4A 1CFPA 2MLFC 1VRKA 2O5GA 1KSMA 1N2DA 1KK8B 1KFXL 1QX2A 2QEBA 1PVBA 2KQYA 2ZKMX 3SG5A 2CCMA 3D78A 3KEVA 1OSAA 2ZN8A 1TUJA 1IH0A 1RWYA 1AP4A 1B1GA 1DGVA 1SL8A 1LS8A 4YI9A 3EVVA 1C7WA 1WRKA 3SG7A 4HREE 1KCYA 1NYAA 2CNPA 5JOLA 1XFRA 3AAKA 1EL4A 3BUOB 1B8LA 2KSPA 2OPOA 5IBWA 1OOHA 1K9UA 1QJTA 1JF0A 1XA5A 2BE6A 3DVKA 1DF0A 4CFRA 2BCBA 2P70A 4AOMA 3CYZA 5CSIA 3FWCA 2H61C 1PSBA 2GTEA 3NXAA 2M7NA 1L2OC 3S0BA 3CDNA 2Y5IA 1CM4A 1OQPA 2O60A 1NCYA 2D8NA 2OS8B 1SCMB 1SPYA 2P6BB 3CLNA 3NHIA 4ZCUA 2EHBA 3RLZA 4I5NB 1DQEA 2JNFA 3VRQA 1K2HA 1DJIA 5HL1A 1KFXS 1R2UA 3GK1A 1TCOB 4GGNA 5B8IB 5J3XA 4F0ZB 3CR2A 3B6XA 1TIZA 3LLEA 2KQ6A 2KFFA 2K8MB 4GNKB 4YRUA 3PN7C 1TNWA 2LE9B 4ORBB 3TS5C 3RM1A 1CM1A 4BY4A 1DJXA 3B86A 4NQGA 4WQ2A 5I8NA 2LMUA 3IF7A 1B7TY 4FQOA 1NX0A 3SIBA 1PRWA 3SG3A 2WC8A 4DRWA 2H2KA 2F33A 5AFPA 2PQLA 2KI6D 3EK7A 4QJ4B 2ZNEA 3I5FB 1XYDA 5AEQA 2LP3A 1T14A 1UP5A 2KI4C 4INXA 1BU3A 2M7LA 1IWQA 5HLOA 4CPVA 1K90D 2HQWA 2KPHA 4MRXA 3D74A 2MHHA 4CIDA 3CR4X 1UHJA 2ERBA 3WXAA 1WY9A 3LL8B 2H8VA 2BE4A 2V53A 3KHEA 1L2OB 3KO0A 4NDDA 3DY9A 2KLEA 2QEHA 3PSRA 1GGZA 3NSOA 1IIOA 1FW4A 1XFWO 4MBEA 4N1GA 4P2YB 2K7BA 2R2IA 3LK1A 3EK8A 5CPVA 3SIAA 1IJ6A 1GM0A 4MZKA 1XK4A 4YGAA 1YTZC 1BR1B 1P28A 1QATA 1YVHA 4JKTA 2JT8A 1QLKA 2JU0A 4N1FA 1IKUA 3CR5X 4GGFC 2ISDA 3NSLA 2JRFA 2I7AA 2M29A 2VRGA 3PLFB 2GV5A 2WCBA 2M3WA 3PN7B 5ER4X 2A4JA 2SCPA 1GJYA 1R6PA 2LHLA 3TS5B 2SASA 2E6WA 2LVIA 3CZ2A 1A03A 3AKAA 3PM2A 4JWQA 4YBHB 1QV1A 5I94A 2RGIA 4USLA 1ZMZA 1SK6D 3EVRA 1M46A 1SBJA 3FIAA 1K96A 1A75B 2JPTA 2I2RE 1C3ZA 1NUBA 3GOFA 4JQ0D 1JF2A 1NX3A 3SG4A 3SS4A 4PE0A 2KLDA 1S26D 2QDIA 1TNPA 3PM8A 3TUYC 2QEOA 5DICA 1E8AA 2KI4B 3FE8A 1S1EA 3NSKA 1LXFC 3D75A 3IQOA 3NGVA 4IL1A 1IQ3A 4N5XA 2NZ0A 1DJWA 3EG5B 4A4CA 4WQ3A 1Y1UA 4ETOA 5I2LA 1GQMA 2K61A 3CZTX 5HYDA 3M0WA 1KK7Z 4PALA 2JZIA 2I94A 4PHKA 3BUXB 1TTXA 5DKNA 1BT6A 1DT7B 3WHTB 1B8RA 1OOFA 3S0EA 1K8UA 1G4YR 1F54A 1OOIX 4NDBA 1HQVA 2MAZA 1MHOA 2BECA 2P71A 1QLSA 2PMYA 2IS9A 3BFAA 1SNLA 3PFVA 3EVUA 3O4XA 3BJHA 2LMVA 3FS7A 1Q80A 1BOCA 1RK9A 3DYEA 3UNWA 3R1OA 2ZRSA 1RFJA 5HKZA 2L5YA 2MBXA 3V2LA 1SCVA 1PK0D 2KBMA 1MF8B 4PHMA 2WCEA 3FE9A 2E30A 1J1EA 1IJ5A 1ZFSA 3EKHA 3I5HC 1OOGA 1BJFA 2H61A 3H4SE 4MN0A 2ZNDA 2LV7A 2JT3A 3D77A 1UURA 1BLQA 1OOJA 3I5FC 2FJUB 2PSRA 3OB2B 1S6JA 2K0JA 3DVMA 1J7PA 1JSAA 4PHJA 1ZACA 5FI2A 1ALVA 2KOTA 1JUOA 2PYQA 3DVJA 2NLNA 1Y6WA 2NCPA 1C7VA 3BFHA 1G8IA 2JC2A 2LHIA 1K9KA 2JNXA 3TUYB 1AUIB 3KF9A 4DIRA 3CGAA 5KSZA 3BOWB 3BQ3A 2KYFA 4C0KA 4TNCA 3PJIA 1DEKA 2WCMA 2NXQA 2QEVA 2COLB 4GAOA 1L7ZA 5AXIA 1CB1A 1QIWA 1CDNA 2FCDA 1SYMA 4PCWA 4MZLA 1DGUA 2WCJA 4MRYA 1J7QA 4YGEB 2LLUA 3FWBA 1J7RA 4L9MA 4I5KA 4AQJA 3DZTA 1XVJA 2BL0C 1A75A 1CDPA 4FQTA 5I2OA 1DJHA 3R1VA 4OKHA
chains in the Genus database with same CATH topology
2K7CA 5D7FA 1S3PA 2B1UA 2M1UA 5K89A 3BUWB 2KBIA 1UWOA 2EGDA 1FI5A 1NCZA 2L0PA 5F6TA 3ICBA 3DVEA 4WRIA 1KWOB 1UHIA 1CLMA 1SL7A 1SMGA 4MZJA 1A4PA 3I5HB 4ORAB 3BUMB 2FCEA 1C07A 1DTLA 1WDCC 1XFUO 3MSEB 1FBVA 3I5IC 2JOJA 3ZNIA 1AK8A 3GK4X 4YGDB 4M2QA 1CKKA 5DKRA 3NSIA 4PE7A 4CFQA 2JWWA 2MRDA 4GPLB 2BKHB 4QJ5B 3VGOA 1CLLA 2L2EA 1FI6A 5CSJA 3I5GB 1IGVA 1WLMA 1OMDA 3HX4A 3VROA 1QX7A 2M97A 3CWGA 2K2AA 3OP0A 3DF0B 2M8UA 1S6CA 4GGFA 4GFTA 1AVSA 1UHHA 1KK7Y 2L98A 1S6IA 3ZWHA 2KHNA 2LANA 4I5LB 4XYNA 4C0LA 1NX1A 1PULA 4CLNA 1QVIY 1RJVA 1KFUL 1MXEA 1OMRA 4YGCB 2MA2A 2QPTA 2Y1NA 2L50A 2Y1MA 3PATA 1ZUZA 1M39A 1EG3A 2BL0B 1NP8A 4HRGA 1DJGA 1SY9A 4UPGA 4MSPA 1WLZA 2CXJA 4ZCVA 1QV0A 1OZOA 4DCKA 5CSFA 3BOWA 3C1VA 1YURA 1V1FA 2JQ6A 1F4QA 5ER5A 1F55A 1XO5A 2JULA 1LINA 2HF5A 3WHUB 2M9GA 1NSHA 1AHRA 1IG5A 1WDCB 3BYAA 4PDZA 2F8PA 2KFHA 3I5IB 3O6BA 3OB1B 4JPZB 2JXCA 1SL9A 1TOPA 3VRNA 1CMFA 1M31A 1XFXO 4MLWA 4C0JA 1JFJA 1XFZO 1EXRA 2AAOA 2L5XB 4HRHA 1PALA 2LAPA 4I5JA 1X02A 2L51A 4DS7A 1QASA 1SRAA 1NIWA 2LM5A 3LK0A 3SJSA 1DMOA 1SR6C 4QJ3B 2G9BA 3TZ1A 1DVIA 1F71A 2JTZA 3KPXA 3WNXB 2HQ8A 2TN4A 4OR9B 5FYXA 1FPWA 1QIVA 5HKYA 5D69A 5HLVA 3GK2A 2NCOA 1J7OA 4MVFA 1J55A 1YUTA 1JC2A 2FOTA 2LP2A 4HSZA 1K94A 1QXPA 3JTDC 2LUXA 3BUNB 4OCIA 1S36A 2M49B 1KWOC 3E3RA 1M63B 3TDUA 2OTGC 1NWDA 2K2FA 1MWNA 2ZN9A 4YI8A 1IRJA 4M2PA 1YUSA 1G33A 2PRUA 3DF0A 2EC6C 3VRRA 1CTRA 3SG6A 1SW8A 3K21A 3OHMB 1CLBA 1WRZA 4PE4A 3I5GC 2KAVA 5JJGA 2CT9A 1DJZA 2KFGA 1UHNA 1CFCA 1YX7A 1JBAA 1W7JB 1B47A 1S5GZ 1RTP1 1CMGA 1Y0VH 2JXLA 1BMOA 5AANA 1CFDA 1Y1AA 3DD4A 1LA0A 1SR6B 2KDHA 2PASA 2WCFA 4GBAA 1F8HA 5DKQA 1H4BA 1MQ1A 3OX6A 2BBNA 1RECA 1M45A 1TRFA 5TNCA 2WNDA 1MXLC 2DOQA 1W7IB 1YX8A 1TCFA 2F3ZA 1SKTA 3BXKA 4OVNF 4YGBB 4NDCA 1LKJA 2Y4QA 3JTDB 2WOSA 1GGWA 1KQMC 1U5IB 1MUXA 1YRUB 1JFKA 2M1KB 2OTGB 2L4IA 1BODA 1BR4B 1K95A 2L4HA 4MEWA 2Q91A 3LCPC 1PSRA 4XJKB 1D1OA 2MJWB 3O2PA 3O78A 3EK4A 5CSNA 2EC6B 1A2XA 1NCXA 2KNEA 5KTYA 2F3YA 1CFFA 2BKIB 3JVTC 1MR8A 2M0RA 2QACA 2BBMA 2PVBA 2BCXA 1KQVA 2GGMA 3D0YB 2ZFDA 1N65A 1H8BA 2LNKA 4ICBA 2MLEC 1OZSA 2KGRA 4M2OA 2HPSA 1CDMA 2AMIA 1F70A 1CDLA 5G08A 2JT0A 1B4CA 1YUUA 3SG2A 4P5OE 1RROA 3HCMA 1LVCD 2LCPA 1UUSA 3AAJA 2KYCA 1KSOA 1CNPA 1NPQA 2CBLA 4E68A 5HKWA 3VRPA 2LUCA 1FF1A 2I18A 1PVAA 2LVJA 4FTGA 2KAYA 2LLSA 4D1EA 1ZOTB 1N0YA 1EJ3A 2LMTA 1EH2A 1QS7A 2LVVA 1IQ5A 1F4OA 3AKBA 1DF0B 4OV2A 1QTXA 1KQMB 1ALWA 1BF5A 1DJYA 2KI6C 2HETA 5PALA 2AUCA 2G2BA 1K9PA 2LLTA 4U8DA 1EG4A 1HT9A 1OE9B 3PALA 3A8RA 1KK8C 3OX5A 1Y1XA 4Q04A 1YVLA 1UHKA 2LC5A 2LVKA 1TNXA 5GQQC 1B7TZ 3D10A 1OMVA 5I2QA 3TDIA 3TDZA 3JVTB 1B8CA 4GUKA 1YR5A 5KU1A 1XFYO 1YRTB 1WRLA 1XK4C 4BY5A 1LA3A 2KAXA 2JTTA 4ORCB 1ODBA 1S5GY 4A4BA 1J1DA 1KFUS 1U5IA 1K93D 3CTNA 3IQQA 1BG1A 2F2OA 2WORA 1A29A 4DUQA 4XJKA 1AJ5A 4PE1A 1V1GA 2KGBC 2BCAA 2GGZA 4R1EA 3CS1A 4AQIA 5BPJA 1B9AA 1TN4A 2ZRTA 2OS8C 2PALA 1SCMC 1QX5B 1JWDA 1NX2A 2CTNA 1XFVO 3D0YA 3QRXA 1QVIZ 2F2PA 3F45A 5AERA 1TNQA 2K7DA 4PHNA 2K7OA 3A4UB 3O4YA 2Q4UA 3EKJA 1AJ4A 1CFPA 2MLFC 1VRKA 2O5GA 1KSMA 1N2DA 1KK8B 1KFXL 1QX2A 1PVBA 2KQYA 2ZKMX 3SG5A 2CCMA 3KEVA 1OSAA 2ZN8A 1IH0A 1RWYA 1AP4A 1B1GA 1DGVA 1SL8A 4YI9A 3EVVA 1C7WA 1WRKA 3SG7A 4HREE 1KCYA 1NYAA 2CNPA 5JOLA 3AAKA 1EL4A 3BUOB 1B8LA 2KSPA 2OPOA 5IBWA 1K9UA 1QJTA 1JF0A 1XA5A 2BE6A 3DVKA 1DF0A 4CFRA 2BCBA 4AOMA 5CSIA 3FWCA 2H61C 1PSBA 3NXAA 2M7NA 1L2OC 2Y5IA 1CM4A 1OQPA 2O60A 1NCYA 2D8NA 2OS8B 1SCMB 1SPYA 2P6BB 3CLNA 4ZCUA 2EHBA 3RLZA 4I5NB 1K2HA 2JNFA 3VRQA 1DJIA 1KFXS 1R2UA 3GK1A 1TCOB 4GGNA 5B8IB 5J3XA 4F0ZB 3CR2A 1TIZA 3LLEA 2KQ6A 2KFFA 2K8MB 4GNKB 4YRUA 3PN7C 1TNWA 2LE9B 4ORBB 3TS5C 3RM1A 1CM1A 4BY4A 1DJXA 4NQGA 4WQ2A 5I8NA 2LMUA 3IF7A 1B7TY 4FQOA 1NX0A 3SIBA 1PRWA 3SG3A 2WC8A 4DRWA 2H2KA 2F33A 5AFPA 2KI6D 3EK7A 4QJ4B 2ZNEA 3I5FB 1XYDA 5AEQA 2LP3A 1UP5A 2KI4C 1BU3A 2M7LA 1IWQA 5HLOA 4CPVA 1K90D 2HQWA 4MRXA 4CIDA 2MHHA 3CR4X 1UHJA 3WXAA 1WY9A 3LL8B 2BE4A 2V53A 3KHEA 1L2OB 3KO0A 4NDDA 3PSRA 1GGZA 3NSOA 1FW4A 1XFWO 4MBEA 4N1GA 4P2YB 2K7BA 2R2IA 3LK1A 3EK8A 5CPVA 3SIAA 1IJ6A 4MZKA 1XK4A 4YGAA 1YTZC 1BR1B 1QATA 1YVHA 2JT8A 1QLKA 2JU0A 4N1FA 1IKUA 3CR5X 4GGFC 2ISDA 3NSLA 2JRFA 2I7AA 2M29A 2VRGA 3PLFB 2GV5A 2WCBA 2M3WA 3PN7B 5ER4X 2A4JA 2SCPA 1GJYA 1R6PA 2LHLA 3TS5B 2SASA 2E6WA 2LVIA 1A03A 3AKAA 4JWQA 4YBHB 1QV1A 2RGIA 4USLA 1ZMZA 1SK6D 3EVRA 1M46A 1SBJA 3FIAA 1K96A 1A75B 2JPTA 2I2RE 1NUBA 3GOFA 4JQ0D 1JF2A 1NX3A 3SG4A 4PE0A 1S26D 1TNPA 3PM8A 3TUYC 1E8AA 2KI4B 3NSKA 1S1EA 4IL1A 1LXFC 3IQOA 1IQ3A 4N5XA 2NZ0A 1DJWA 4A4CA 4WQ3A 1Y1UA 4ETOA 5I2LA 1GQMA 2K61A 3CZTX 5HYDA 3M0WA 1KK7Z 4PALA 2JZIA 2I94A 4PHKA 3BUXB 1TTXA 5DKNA 1BT6A 1DT7B 3WHTB 1B8RA 1K8UA 1G4YR 1F54A 4NDBA 1HQVA 2MAZA 1MHOA 2BECA 2PMYA 1QLSA 2IS9A 3PFVA 1SNLA 3EVUA 2LMVA 3FS7A 1Q80A 1BOCA 1RK9A 2ZRSA 1RFJA 5HKZA 2MBXA 1SCVA 1PK0D 2KBMA 1MF8B 4PHMA 2WCEA 2E30A 1J1EA 1IJ5A 1ZFSA 3EKHA 3I5HC 1BJFA 2H61A 3H4SE 4MN0A 2ZNDA 2LV7A 2JT3A 1UURA 1BLQA 1OOJA 3I5FC 2FJUB 2PSRA 3OB2B 1S6JA 2K0JA 3DVMA 1J7PA 1JSAA 4PHJA 1ZACA 1ALVA 2KOTA 1JUOA 3DVJA 2NLNA 1Y6WA 2NCPA 1C7VA 1G8IA 2JC2A 2LHIA 1K9KA 2JNXA 3TUYB 1AUIB 3KF9A 4DIRA 3CGAA 5KSZA 3BOWB 3BQ3A 2KYFA 4C0KA 4TNCA 2NXQA 2COLB 4GAOA 1L7ZA 5AXIA 1CB1A 1QIWA 1CDNA 2FCDA 1SYMA 4PCWA 4MZLA 1DGUA 4MRYA 1J7QA 4YGEB 2LLUA 3FWBA 1J7RA 4L9MA 4I5KA 4AQJA 1XVJA 2BL0C 1A75A 1CDPA 5I2OA 1DJHA 4OKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7C A;  5D7F A;  1S3P A;  2B1U A;  2M1U A;  5K89 A;  3BUW B;  2KBI A;  1UWO A;  2EGD A;  1FI5 A;  1NCZ A;  2L0P A;  5F6T A;  3ICB A;  3DVE A;  4WRI A;  1KWO B;  1UHI A;  1CLM A;  1SL7 A;  1SMG A;  4MZJ A;  1A4P A;  3I5H B;  4ORA B;  3BUM B;  2FCE A;  1C07 A;  1DTL A;  1WDC C;  1XFU O;  3MSE B;  1FBV A;  3I5I C;  2JOJ A;  3ZNI A;  1AK8 A;  3GK4 X;  4YGD B;  4M2Q A;  1CKK A;  5DKR A;  3NSI A;  4PE7 A;  4CFQ A;  2JWW A;  2MRD A;  4GPL B;  2BKH B;  4QJ5 B;  3VGO A;  1CLL A;  2L2E A;  1FI6 A;  5CSJ A;  3I5G B;  1IGV A;  1WLM A;  1OMD A;  3HX4 A;  3VRO A;  1QX7 A;  2M97 A;  3CWG A;  2K2A A;  3OP0 A;  3DF0 B;  2M8U A;  1S6C A;  4GGF A;  4GFT A;  1AVS A;  1UHH A;  1KK7 Y;  2L98 A;  1S6I A;  3ZWH A;  2KHN A;  2LAN A;  4I5L B;  4XYN A;  4C0L A;  1NX1 A;  1PUL A;  4CLN A;  1QVI Y;  1RJV A;  1KFU L;  1MXE A;  1OMR A;  4YGC B;  2MA2 A;  2QPT A;  2Y1N A;  2L50 A;  2Y1M A;  3PAT A;  1ZUZ A;  1M39 A;  1EG3 A;  2BL0 B;  1NP8 A;  4HRG A;  1DJG A;  1SY9 A;  4UPG A;  4MSP A;  1WLZ A;  2CXJ A;  4ZCV A;  1QV0 A;  1OZO A;  4DCK A;  5CSF A;  3BOW A;  3C1V A;  1YUR A;  1V1F A;  2JQ6 A;  1F4Q A;  5ER5 A;  1F55 A;  1XO5 A;  2JUL A;  1LIN A;  2HF5 A;  3WHU B;  2M9G A;  1NSH A;  1AHR A;  1IG5 A;  1WDC B;  3BYA A;  4PDZ A;  2F8P A;  2KFH A;  3I5I B;  3O6B A;  3OB1 B;  4JPZ B;  2JXC A;  1SL9 A;  1TOP A;  3VRN A;  1CMF A;  1M31 A;  1XFX O;  4MLW A;  4C0J A;  1JFJ A;  1XFZ O;  1EXR A;  2AAO A;  2L5X B;  4HRH A;  1PAL A;  2LAP A;  4I5J A;  1X02 A;  2L51 A;  4DS7 A;  1QAS A;  1SRA A;  1NIW A;  2LM5 A;  3LK0 A;  3SJS A;  1DMO A;  1SR6 C;  4QJ3 B;  2G9B A;  3TZ1 A;  1DVI A;  1F71 A;  2JTZ A;  3KPX A;  3WNX B;  2HQ8 A;  2TN4 A;  4OR9 B;  5FYX A;  1FPW A;  1QIV A;  5HKY A;  5D69 A;  5HLV A;  3GK2 A;  2NCO A;  1J7O A;  4MVF A;  1J55 A;  1YUT A;  1JC2 A;  2FOT A;  2LP2 A;  4HSZ A;  1K94 A;  1QXP A;  3JTD C;  2LUX A;  3BUN B;  4OCI A;  1S36 A;  2M49 B;  1KWO C;  3E3R A;  1M63 B;  3TDU A;  2OTG C;  1NWD A;  2K2F A;  1MWN A;  2ZN9 A;  4YI8 A;  1IRJ A;  4M2P A;  1YUS A;  1G33 A;  2PRU A;  3DF0 A;  2EC6 C;  3VRR A;  1CTR A;  3SG6 A;  1SW8 A;  3K21 A;  3OHM B;  1CLB A;  1WRZ A;  4PE4 A;  3I5G C;  2KAV A;  5JJG A;  2CT9 A;  1DJZ A;  2KFG A;  1UHN A;  1CFC A;  1YX7 A;  1JBA A;  1W7J B;  1B47 A;  1S5G Z;  1RTP 1;  1CMG A;  1Y0V H;  2JXL A;  1BMO A;  5AAN A;  1CFD A;  1Y1A A;  3DD4 A;  1LA0 A;  1SR6 B;  2KDH A;  2PAS A;  2WCF A;  4GBA A;  1F8H A;  5DKQ A;  1H4B A;  1MQ1 A;  3OX6 A;  2BBN A;  1REC A;  1M45 A;  1TRF A;  5TNC A;  2WND A;  1MXL C;  2DOQ A;  1W7I B;  1YX8 A;  1TCF A;  2F3Z A;  1SKT A;  3BXK A;  4OVN F;  4YGB B;  4NDC A;  1LKJ A;  2Y4Q A;  3JTD B;  2WOS A;  1GGW A;  1KQM C;  1U5I B;  1MUX A;  1YRU B;  1JFK A;  2M1K B;  2OTG B;  2L4I A;  1BOD A;  1BR4 B;  1K95 A;  2L4H A;  4MEW A;  2Q91 A;  3LCP C;  1PSR A;  4XJK B;  1D1O A;  2MJW B;  3O2P A;  3O78 A;  3EK4 A;  5CSN A;  2EC6 B;  1A2X A;  1NCX A;  2KNE A;  5KTY A;  2F3Y A;  1CFF A;  2BKI B;  3JVT C;  1MR8 A;  2M0R A;  2QAC A;  2BBM A;  2PVB A;  2BCX A;  1KQV A;  2GGM A;  3D0Y B;  2ZFD A;  1N65 A;  1H8B A;  2LNK A;  4ICB A;  2MLE C;  1OZS A;  2KGR A;  4M2O A;  2HPS A;  1CDM A;  2AMI A;  1F70 A;  1CDL A;  5G08 A;  2JT0 A;  1B4C A;  1YUU A;  3SG2 A;  4P5O E;  1RRO A;  3HCM A;  1LVC D;  2LCP A;  1UUS A;  3AAJ A;  2KYC A;  1KSO A;  1CNP A;  1NPQ A;  2CBL A;  4E68 A;  5HKW A;  3VRP A;  2LUC A;  1FF1 A;  2I18 A;  1PVA A;  2LVJ A;  4FTG A;  2KAY A;  2LLS A;  4D1E A;  1ZOT B;  1N0Y A;  1EJ3 A;  2LMT A;  1EH2 A;  1QS7 A;  2LVV A;  1IQ5 A;  1F4O A;  3AKB A;  1DF0 B;  4OV2 A;  1QTX A;  1KQM B;  1ALW A;  1BF5 A;  1DJY A;  2KI6 C;  2HET A;  5PAL A;  2AUC A;  2G2B A;  1K9P A;  2LLT A;  4U8D A;  1EG4 A;  1HT9 A;  1OE9 B;  3PAL A;  3A8R A;  1KK8 C;  3OX5 A;  1Y1X A;  4Q04 A;  1YVL A;  1UHK A;  2LC5 A;  2LVK A;  1TNX A;  5GQQ C;  1B7T Z;  3D10 A;  1OMV A;  5I2Q A;  3TDI A;  3TDZ A;  3JVT B;  1B8C A;  4GUK A;  1YR5 A;  5KU1 A;  1XFY O;  1YRT B;  1WRL A;  1XK4 C;  4BY5 A;  1LA3 A;  2KAX A;  2JTT A;  4ORC B;  1ODB A;  1S5G Y;  4A4B A;  1J1D A;  1KFU S;  1U5I A;  1K93 D;  3CTN A;  3IQQ A;  1BG1 A;  2F2O A;  2WOR A;  1A29 A;  4DUQ A;  4XJK A;  1AJ5 A;  4PE1 A;  1V1G A;  2KGB C;  2BCA A;  2GGZ A;  4R1E A;  3CS1 A;  4AQI A;  5BPJ A;  1B9A A;  1TN4 A;  2ZRT A;  2OS8 C;  2PAL A;  1SCM C;  1QX5 B;  1JWD A;  1NX2 A;  2CTN A;  1XFV O;  3D0Y A;  3QRX A;  1QVI Z;  2F2P A;  3F45 A;  5AER A;  1TNQ A;  2K7D A;  4PHN A;  2K7O A;  3A4U B;  3O4Y A;  2Q4U A;  3EKJ A;  1AJ4 A;  1CFP A;  2MLF C;  1VRK A;  2O5G A;  1KSM A;  1N2D A;  1KK8 B;  1KFX L;  1QX2 A;  1PVB A;  2KQY A;  2ZKM X;  3SG5 A;  2CCM A;  3KEV A;  1OSA A;  2ZN8 A;  1IH0 A;  1RWY A;  1AP4 A;  1B1G A;  1DGV A;  1SL8 A;  4YI9 A;  3EVV A;  1C7W A;  1WRK A;  3SG7 A;  4HRE E;  1KCY A;  1NYA A;  2CNP A;  5JOL A;  3AAK A;  1EL4 A;  3BUO B;  1B8L A;  2KSP A;  2OPO A;  5IBW A;  1K9U A;  1QJT A;  1JF0 A;  1XA5 A;  2BE6 A;  3DVK A;  1DF0 A;  4CFR A;  2BCB A;  4AOM A;  5CSI A;  3FWC A;  2H61 C;  1PSB A;  3NXA A;  2M7N A;  1L2O C;  2Y5I A;  1CM4 A;  1OQP A;  2O60 A;  1NCY A;  2D8N A;  2OS8 B;  1SCM B;  1SPY A;  2P6B B;  3CLN A;  4ZCU A;  2EHB A;  3RLZ A;  4I5N B;  1K2H A;  2JNF A;  3VRQ A;  1DJI A;  1KFX S;  1R2U A;  3GK1 A;  1TCO B;  4GGN A;  5B8I B;  5J3X A;  4F0Z B;  3CR2 A;  1TIZ A;  3LLE A;  2KQ6 A;  2KFF A;  2K8M B;  4GNK B;  4YRU A;  3PN7 C;  1TNW A;  2LE9 B;  4ORB B;  3TS5 C;  3RM1 A;  1CM1 A;  4BY4 A;  1DJX A;  4NQG A;  4WQ2 A;  5I8N A;  2LMU A;  3IF7 A;  1B7T Y;  4FQO A;  1NX0 A;  3SIB A;  1PRW A;  3SG3 A;  2WC8 A;  4DRW A;  2H2K A;  2F33 A;  5AFP A;  2KI6 D;  3EK7 A;  4QJ4 B;  2ZNE A;  3I5F B;  1XYD A;  5AEQ A;  2LP3 A;  1UP5 A;  2KI4 C;  1BU3 A;  2M7L A;  1IWQ A;  5HLO A;  4CPV A;  1K90 D;  2HQW A;  4MRX A;  4CID A;  2MHH A;  3CR4 X;  1UHJ A;  3WXA A;  1WY9 A;  3LL8 B;  2BE4 A;  2V53 A;  3KHE A;  1L2O B;  3KO0 A;  4NDD A;  3PSR A;  1GGZ A;  3NSO A;  1FW4 A;  1XFW O;  4MBE A;  4N1G A;  4P2Y B;  2K7B A;  2R2I A;  3LK1 A;  3EK8 A;  5CPV A;  3SIA A;  1IJ6 A;  4MZK A;  1XK4 A;  4YGA A;  1YTZ C;  1BR1 B;  1QAT A;  1YVH A;  2JT8 A;  1QLK A;  2JU0 A;  4N1F A;  1IKU A;  3CR5 X;  4GGF C;  2ISD A;  3NSL A;  2JRF A;  2I7A A;  2M29 A;  2VRG A;  3PLF B;  2GV5 A;  2WCB A;  2M3W A;  3PN7 B;  5ER4 X;  2A4J A;  2SCP A;  1GJY A;  1R6P A;  2LHL A;  3TS5 B;  2SAS A;  2E6W A;  2LVI A;  1A03 A;  3AKA A;  4JWQ A;  4YBH B;  1QV1 A;  2RGI A;  4USL A;  1ZMZ A;  1SK6 D;  3EVR A;  1M46 A;  1SBJ A;  3FIA A;  1K96 A;  1A75 B;  2JPT A;  2I2R E;  1NUB A;  3GOF A;  4JQ0 D;  1JF2 A;  1NX3 A;  3SG4 A;  4PE0 A;  1S26 D;  1TNP A;  3PM8 A;  3TUY C;  1E8A A;  2KI4 B;  3NSK A;  1S1E A;  4IL1 A;  1LXF C;  3IQO A;  1IQ3 A;  4N5X A;  2NZ0 A;  1DJW A;  4A4C A;  4WQ3 A;  1Y1U A;  4ETO A;  5I2L A;  1GQM A;  2K61 A;  3CZT X;  5HYD A;  3M0W A;  1KK7 Z;  4PAL A;  2JZI A;  2I94 A;  4PHK A;  3BUX B;  1TTX A;  5DKN A;  1BT6 A;  1DT7 B;  3WHT B;  1B8R A;  1K8U A;  1G4Y R;  1F54 A;  4NDB A;  1HQV A;  2MAZ A;  1MHO A;  2BEC A;  2PMY A;  1QLS A;  2IS9 A;  3PFV A;  1SNL A;  3EVU A;  2LMV A;  3FS7 A;  1Q80 A;  1BOC A;  1RK9 A;  2ZRS A;  1RFJ A;  5HKZ A;  2MBX A;  1SCV A;  1PK0 D;  2KBM A;  1MF8 B;  4PHM A;  2WCE A;  2E30 A;  1J1E A;  1IJ5 A;  1ZFS A;  3EKH A;  3I5H C;  1BJF A;  2H61 A;  3H4S E;  4MN0 A;  2ZND A;  2LV7 A;  2JT3 A;  1UUR A;  1BLQ A;  1OOJ A;  3I5F C;  2FJU B;  2PSR A;  3OB2 B;  1S6J A;  2K0J A;  3DVM A;  1J7P A;  1JSA A;  4PHJ A;  1ZAC A;  1ALV A;  2KOT A;  1JUO A;  3DVJ A;  2NLN A;  1Y6W A;  2NCP A;  1C7V A;  1G8I A;  2JC2 A;  2LHI A;  1K9K A;  2JNX A;  3TUY B;  1AUI B;  3KF9 A;  4DIR A;  3CGA A;  5KSZ A;  3BOW B;  3BQ3 A;  2KYF A;  4C0K A;  4TNC A;  2NXQ A;  2COL B;  4GAO A;  1L7Z A;  5AXI A;  1CB1 A;  1QIW A;  1CDN A;  2FCD A;  1SYM A;  4PCW A;  4MZL A;  1DGU A;  4MRY A;  1J7Q A;  4YGE B;  2LLU A;  3FWB A;  1J7R A;  4L9M A;  4I5K A;  4AQJ A;  1XVJ A;  2BL0 C;  1A75 A;  1CDP A;  5I2O A;  1DJH A;  4OKH A; 
#chains in the Genus database with same CATH topology
 2K7C A;  3NHT A;  1QWV A;  1S3P A;  2B1U A;  2M1U A;  5D7F A;  5K89 A;  3BUW B;  2KBI A;  1TWO A;  1UWO A;  2EGD A;  1NCZ A;  1FI5 A;  2L0P A;  5F6T A;  3OBV A;  3ICB A;  3DVE A;  3FE6 A;  4WRI A;  1KWO B;  1UHI A;  1CLM A;  1SL7 A;  1SMG A;  4MZJ A;  1A4P A;  3I5H B;  3L4A A;  4ORA B;  3BUM B;  2FCE A;  1C07 A;  2WC6 A;  1DTL A;  1WDC C;  1XFU O;  3MSE B;  1FBV A;  3I5I C;  2JOJ A;  3ZNI A;  1AK8 A;  3GK4 X;  2BNX A;  4M2Q A;  4YGD B;  5DKR A;  1CKK A;  3NSI A;  4PE7 A;  4CFQ A;  2JWW A;  3Q8I A;  2MRD A;  4GPL B;  1Z4H A;  3RZS A;  5FI7 A;  2BKH B;  4QJ5 B;  1Z2C B;  3VGO A;  1CLL A;  2L2E A;  5EL2 A;  1FI6 A;  5CSJ A;  3I5G B;  1IGV A;  1WLM A;  1OMD A;  3HX4 A;  3VRO A;  1QX7 A;  2M97 A;  3SS5 A;  3CWG A;  2K2A A;  3OP0 A;  3DF0 B;  2M8U A;  1S6C A;  4GGF A;  4GFT A;  1AVS A;  1UHH A;  1KK7 Y;  2L98 A;  1S6I A;  3ZWH A;  2KHN A;  2LAN A;  4I5L B;  4XYN A;  4C0L A;  1NX1 A;  1PUL A;  4CLN A;  1QVI Y;  1RJV A;  1KFU L;  1MXE A;  1OMR A;  4YGC B;  3OGN A;  2MA2 A;  2QPT A;  2Y1N A;  2L50 A;  2Y1M A;  3PAT A;  1ZUZ A;  1M39 A;  1EG3 A;  2BL0 B;  1NP8 A;  4HRG A;  1DJG A;  1SY9 A;  4UPG A;  4MSP A;  1WLZ A;  2CXJ A;  4ZCV A;  1QV0 A;  1OZO A;  4DCK A;  1DC1 A;  5CSF A;  3BFB A;  3BOW A;  3C1V A;  1YUR A;  1V1F A;  2JQ6 A;  1F4Q A;  5ER5 A;  2FJY A;  4INW A;  1F55 A;  3K1E A;  1XO5 A;  2JUL A;  1LIN A;  2HF5 A;  3WHU B;  2M9G A;  1NSH A;  1AHR A;  1IG5 A;  1WDC B;  3BYA A;  4PDZ A;  2F8P A;  2KFH A;  2BAP A;  3I5I B;  3O6B A;  3OB1 B;  2JXC A;  4JPZ B;  1SL9 A;  1TOP A;  3VRN A;  1CMF A;  1M31 A;  1XFX O;  4MLW A;  4C0J A;  1JFJ A;  1XFZ O;  1EXR A;  2AAO A;  2L5X B;  4HRH A;  1PAL A;  2LAP A;  4I5J A;  1X02 A;  2L51 A;  4DS7 A;  1QAS A;  1SRA A;  1NIW A;  2LM5 A;  3LK0 A;  3SJS A;  1DMO A;  1SR6 C;  4QJ3 B;  2G9B A;  1SSE B;  3TZ1 A;  1DVI A;  1F71 A;  2JTZ A;  3KPX A;  3WNX B;  2HQ8 A;  2TN4 A;  4OR9 B;  5FYX A;  1FPW A;  1QIV A;  5HKY A;  5D69 A;  5HLV A;  3GK2 A;  2NCO A;  5D3O A;  3SS3 A;  4MVF A;  1J55 A;  1J7O A;  3D73 A;  1YUT A;  3N7H A;  1JC2 A;  2FOT A;  2LP2 A;  4HSZ A;  1K94 A;  1QXP A;  3JTD C;  2LUX A;  3BUN B;  2WCK A;  4OCI A;  1S36 A;  2M49 B;  1KWO C;  3E3R A;  1M63 B;  3TDU A;  2OTG C;  1NWD A;  2K2F A;  1MWN A;  2L2C A;  2ZN9 A;  4YI8 A;  1IRJ A;  4M2P A;  1YUS A;  1G33 A;  2PRU A;  3DF0 A;  2EC6 C;  3VRR A;  1CTR A;  3SG6 A;  1SW8 A;  3K21 A;  3OHM B;  1CLB A;  1WRZ A;  4PE4 A;  3I5G C;  2KAV A;  5JJG A;  2CT9 A;  1DJZ A;  2KFG A;  1UHN A;  1CFC A;  1YX7 A;  1JBA A;  1W7J B;  4KYN A;  4PT1 A;  1B47 A;  1S5G Z;  2WC5 A;  1RTP 1;  2JPO A;  1CMG A;  1Y0V H;  2JXL A;  1BMO A;  5AAN A;  1CFD A;  1Y1A A;  3DD4 A;  1OW4 A;  1LA0 A;  1SR6 B;  2KDH A;  2PAS A;  2WCF A;  4GBA A;  1F8H A;  5DKQ A;  1H4B A;  1MQ1 A;  3OX6 A;  2BBN A;  1REC A;  1M45 A;  1TRF A;  5TNC A;  2WND A;  1MXL C;  3DXL A;  2DOQ A;  1W7I B;  1YX8 A;  1TCF A;  2F3Z A;  3B87 A;  1SKT A;  3BXK A;  4OVN F;  4YGB B;  4NDC A;  1LKJ A;  2Y4Q A;  3CZ0 A;  3JTD B;  2WOS A;  1GGW A;  3VB1 A;  1KQM C;  3UO9 A;  1U5I B;  1MUX A;  1YRU B;  1JFK A;  2M1K B;  2OTG B;  2WCL A;  2L4I A;  1BOD A;  1BR4 B;  1K95 A;  2L4H A;  4MEW A;  2Q91 A;  3LCP C;  1PSR A;  4XJK B;  1D1O A;  3QME A;  2MJW B;  3O2P A;  3O78 A;  3EK4 A;  5CSN A;  2EC6 B;  3L47 A;  1A2X A;  1NCX A;  2KNE A;  5KTY A;  2F3Y A;  1CFF A;  2BKI B;  3JVT C;  1MR8 A;  2M0R A;  2QAC A;  2BBM A;  2PVB A;  2BCX A;  1KQV A;  2GGM A;  3D0Y B;  2ZFD A;  2YGU A;  1N65 A;  1H8B A;  2LNK A;  3S0G A;  1ORG A;  4ICB A;  2MLE C;  1OZS A;  5FI6 A;  2KGR A;  2K60 A;  4M2O A;  2HPS A;  3CZ1 A;  4F7F A;  1CDM A;  2AMI A;  3R1P A;  1CDL A;  5G08 A;  2JT0 A;  1B4C A;  1F70 A;  1YUU A;  3SG2 A;  3S0D A;  4P5O E;  1RRO A;  3HCM A;  3R72 A;  1LVC D;  2LCP A;  1UUS A;  3AAJ A;  2KYC A;  1KSO A;  1CNP A;  1NPQ A;  2CBL A;  4E68 A;  2WCH A;  5HKW A;  3VRP A;  2LUC A;  1FF1 A;  2I18 A;  1PVA A;  2LVJ A;  4FTG A;  2KAY A;  2LLS A;  4D1E A;  3B88 A;  1ZOT B;  1N0Y A;  1EJ3 A;  2LMT A;  1EH2 A;  4OZD A;  1QS7 A;  2LVV A;  1IQ5 A;  1F4O A;  3AKB A;  1DF0 B;  4OV2 A;  1QTX A;  1KQM B;  1ALW A;  1BF5 A;  1DJY A;  2KI6 C;  2HET A;  5PAL A;  2AUC A;  2G2B A;  1K9P A;  3B7A A;  2LLT A;  4U8D A;  1EG4 A;  1HT9 A;  1OE9 B;  3PAL A;  3A8R A;  1KK8 C;  3OX5 A;  1Y1X A;  4Q04 A;  1YVL A;  1UHK A;  2LC5 A;  1TUZ A;  2LVK A;  1TNX A;  5GQQ C;  1B7T Z;  3D10 A;  1OMV A;  5I2Q A;  3TDI A;  1W9Z A;  3TDZ A;  3JVT B;  1B8C A;  4GUK A;  1YR5 A;  5KU1 A;  1XFY O;  1YRT B;  1WRL A;  1XK4 C;  4BY5 A;  1LA3 A;  2KAX A;  2JTT A;  3L4L A;  4ORC B;  1DEL A;  3CAB A;  1ODB A;  4JD9 A;  1S5G Y;  4A4B A;  1J1D A;  1KFU S;  1U5I A;  1K93 D;  3CTN A;  3IQQ A;  1BG1 A;  2F2O A;  2WOR A;  3D76 A;  3S0A A;  1A29 A;  4DUQ A;  4XJK A;  1AJ5 A;  4PE1 A;  1V1G A;  2KGB C;  2BCA A;  2GGZ A;  4R1E A;  3CS1 A;  3IVT A;  4AQI A;  5BPJ A;  1C3Y A;  1B9A A;  1TN4 A;  4IJ7 A;  2ZRT A;  2OS8 C;  3S0F A;  2PAL A;  1SCM C;  1QX5 B;  1JWD A;  1NX2 A;  2CTN A;  1XFV O;  3D0Y A;  3QRX A;  1QVI Z;  2F2P A;  3F45 A;  5AER A;  1TNQ A;  2K7D A;  4PHN A;  2K7O A;  3A4U B;  3O4Y A;  2Q4U A;  3EKJ A;  1AJ4 A;  1CFP A;  2MLF C;  1VRK A;  2O5G A;  1KSM A;  1N2D A;  1KK8 B;  1KFX L;  1QX2 A;  2QEB A;  1PVB A;  2KQY A;  2ZKM X;  3SG5 A;  2CCM A;  3D78 A;  3KEV A;  1OSA A;  2ZN8 A;  1TUJ A;  1IH0 A;  1RWY A;  1AP4 A;  1B1G A;  1DGV A;  1SL8 A;  1LS8 A;  4YI9 A;  3EVV A;  1C7W A;  1WRK A;  3SG7 A;  4HRE E;  1KCY A;  1NYA A;  2CNP A;  5JOL A;  1XFR A;  3AAK A;  1EL4 A;  3BUO B;  1B8L A;  2KSP A;  2OPO A;  5IBW A;  1OOH A;  1K9U A;  1QJT A;  1JF0 A;  1XA5 A;  2BE6 A;  3DVK A;  1DF0 A;  4CFR A;  2BCB A;  2P70 A;  4AOM A;  3CYZ A;  5CSI A;  3FWC A;  2H61 C;  1PSB A;  2GTE A;  3NXA A;  2M7N A;  1L2O C;  3S0B A;  3CDN A;  2Y5I A;  1CM4 A;  1OQP A;  2O60 A;  1NCY A;  2D8N A;  2OS8 B;  1SCM B;  1SPY A;  2P6B B;  3CLN A;  3NHI A;  4ZCU A;  2EHB A;  3RLZ A;  4I5N B;  1DQE A;  2JNF A;  3VRQ A;  1K2H A;  1DJI A;  5HL1 A;  1KFX S;  1R2U A;  3GK1 A;  1TCO B;  4GGN A;  5B8I B;  5J3X A;  4F0Z B;  3CR2 A;  3B6X A;  1TIZ A;  3LLE A;  2KQ6 A;  2KFF A;  2K8M B;  4GNK B;  4YRU A;  3PN7 C;  1TNW A;  2LE9 B;  4ORB B;  3TS5 C;  3RM1 A;  1CM1 A;  4BY4 A;  1DJX A;  3B86 A;  4NQG A;  4WQ2 A;  5I8N A;  2LMU A;  3IF7 A;  1B7T Y;  4FQO A;  1NX0 A;  3SIB A;  1PRW A;  3SG3 A;  2WC8 A;  4DRW A;  2H2K A;  2F33 A;  5AFP A;  2PQL A;  2KI6 D;  3EK7 A;  4QJ4 B;  2ZNE A;  3I5F B;  1XYD A;  5AEQ A;  2LP3 A;  1T14 A;  1UP5 A;  2KI4 C;  4INX A;  1BU3 A;  2M7L A;  1IWQ A;  5HLO A;  4CPV A;  1K90 D;  2HQW A;  2KPH A;  4MRX A;  3D74 A;  2MHH A;  4CID A;  3CR4 X;  1UHJ A;  2ERB A;  3WXA A;  1WY9 A;  3LL8 B;  2H8V A;  2BE4 A;  2V53 A;  3KHE A;  1L2O B;  3KO0 A;  4NDD A;  3DY9 A;  2KLE A;  2QEH A;  3PSR A;  1GGZ A;  3NSO A;  1IIO A;  1FW4 A;  1XFW O;  4MBE A;  4N1G A;  4P2Y B;  2K7B A;  2R2I A;  3LK1 A;  3EK8 A;  5CPV A;  3SIA A;  1IJ6 A;  1GM0 A;  4MZK A;  1XK4 A;  4YGA A;  1YTZ C;  1BR1 B;  1P28 A;  1QAT A;  1YVH A;  4JKT A;  2JT8 A;  1QLK A;  2JU0 A;  4N1F A;  1IKU A;  3CR5 X;  4GGF C;  2ISD A;  3NSL A;  2JRF A;  2I7A A;  2M29 A;  2VRG A;  3PLF B;  2GV5 A;  2WCB A;  2M3W A;  3PN7 B;  5ER4 X;  2A4J A;  2SCP A;  1GJY A;  1R6P A;  2LHL A;  3TS5 B;  2SAS A;  2E6W A;  2LVI A;  3CZ2 A;  1A03 A;  3AKA A;  3PM2 A;  4JWQ A;  4YBH B;  1QV1 A;  5I94 A;  2RGI A;  4USL A;  1ZMZ A;  1SK6 D;  3EVR A;  1M46 A;  1SBJ A;  3FIA A;  1K96 A;  1A75 B;  2JPT A;  2I2R E;  1C3Z A;  1NUB A;  3GOF A;  4JQ0 D;  1JF2 A;  1NX3 A;  3SG4 A;  3SS4 A;  4PE0 A;  2KLD A;  1S26 D;  2QDI A;  1TNP A;  3PM8 A;  3TUY C;  2QEO A;  5DIC A;  1E8A A;  2KI4 B;  3FE8 A;  1S1E A;  3NSK A;  1LXF C;  3D75 A;  3IQO A;  3NGV A;  4IL1 A;  1IQ3 A;  4N5X A;  2NZ0 A;  1DJW A;  3EG5 B;  4A4C A;  4WQ3 A;  1Y1U A;  4ETO A;  5I2L A;  1GQM A;  2K61 A;  3CZT X;  5HYD A;  3M0W A;  1KK7 Z;  4PAL A;  2JZI A;  2I94 A;  4PHK A;  3BUX B;  1TTX A;  5DKN A;  1BT6 A;  1DT7 B;  3WHT B;  1B8R A;  1OOF A;  3S0E A;  1K8U A;  1G4Y R;  1F54 A;  1OOI X;  4NDB A;  1HQV A;  2MAZ A;  1MHO A;  2BEC A;  2P71 A;  1QLS A;  2PMY A;  2IS9 A;  3BFA A;  1SNL A;  3PFV A;  3EVU A;  3O4X A;  3BJH A;  2LMV A;  3FS7 A;  1Q80 A;  1BOC A;  1RK9 A;  3DYE A;  3UNW A;  3R1O A;  2ZRS A;  1RFJ A;  5HKZ A;  2L5Y A;  2MBX A;  3V2L A;  1SCV A;  1PK0 D;  2KBM A;  1MF8 B;  4PHM A;  2WCE A;  3FE9 A;  2E30 A;  1J1E A;  1IJ5 A;  1ZFS A;  3EKH A;  3I5H C;  1OOG A;  1BJF A;  2H61 A;  3H4S E;  4MN0 A;  2ZND A;  2LV7 A;  2JT3 A;  3D77 A;  1UUR A;  1BLQ A;  1OOJ A;  3I5F C;  2FJU B;  2PSR A;  3OB2 B;  1S6J A;  2K0J A;  3DVM A;  1J7P A;  1JSA A;  4PHJ A;  1ZAC A;  5FI2 A;  1ALV A;  2KOT A;  1JUO A;  2PYQ A;  3DVJ A;  2NLN A;  1Y6W A;  2NCP A;  1C7V A;  3BFH A;  1G8I A;  2JC2 A;  2LHI A;  1K9K A;  2JNX A;  3TUY B;  1AUI B;  3KF9 A;  4DIR A;  3CGA A;  5KSZ A;  3BOW B;  3BQ3 A;  2KYF A;  4C0K A;  4TNC A;  3PJI A;  1DEK A;  2WCM A;  2NXQ A;  2QEV A;  2COL B;  4GAO A;  1L7Z A;  5AXI A;  1CB1 A;  1QIW A;  1CDN A;  2FCD A;  1SYM A;  4PCW A;  4MZL A;  1DGU A;  2WCJ A;  4MRY A;  1J7Q A;  4YGE B;  2LLU A;  3FWB A;  1J7R A;  4L9M A;  4I5K A;  4AQJ A;  3DZT A;  1XVJ A;  2BL0 C;  1A75 A;  1CDP A;  4FQT A;  5I2O A;  1DJH A;  3R1V A;  4OKH A; 
#chains in the Genus database with same CATH homology
 2K7C A;  5D7F A;  1S3P A;  2B1U A;  2M1U A;  5K89 A;  3BUW B;  2KBI A;  1UWO A;  2EGD A;  1FI5 A;  1NCZ A;  2L0P A;  5F6T A;  3ICB A;  3DVE A;  4WRI A;  1KWO B;  1UHI A;  1CLM A;  1SL7 A;  1SMG A;  4MZJ A;  1A4P A;  3I5H B;  4ORA B;  3BUM B;  2FCE A;  1C07 A;  1DTL A;  1WDC C;  1XFU O;  3MSE B;  1FBV A;  3I5I C;  2JOJ A;  3ZNI A;  1AK8 A;  3GK4 X;  4YGD B;  4M2Q A;  1CKK A;  5DKR A;  3NSI A;  4PE7 A;  4CFQ A;  2JWW A;  2MRD A;  4GPL B;  2BKH B;  4QJ5 B;  3VGO A;  1CLL A;  2L2E A;  1FI6 A;  5CSJ A;  3I5G B;  1IGV A;  1WLM A;  1OMD A;  3HX4 A;  3VRO A;  1QX7 A;  2M97 A;  3CWG A;  2K2A A;  3OP0 A;  3DF0 B;  2M8U A;  1S6C A;  4GGF A;  4GFT A;  1AVS A;  1UHH A;  1KK7 Y;  2L98 A;  1S6I A;  3ZWH A;  2KHN A;  2LAN A;  4I5L B;  4XYN A;  4C0L A;  1NX1 A;  1PUL A;  4CLN A;  1QVI Y;  1RJV A;  1KFU L;  1MXE A;  1OMR A;  4YGC B;  2MA2 A;  2QPT A;  2Y1N A;  2L50 A;  2Y1M A;  3PAT A;  1ZUZ A;  1M39 A;  1EG3 A;  2BL0 B;  1NP8 A;  4HRG A;  1DJG A;  1SY9 A;  4UPG A;  4MSP A;  1WLZ A;  2CXJ A;  4ZCV A;  1QV0 A;  1OZO A;  4DCK A;  5CSF A;  3BOW A;  3C1V A;  1YUR A;  1V1F A;  2JQ6 A;  1F4Q A;  5ER5 A;  1F55 A;  1XO5 A;  2JUL A;  1LIN A;  2HF5 A;  3WHU B;  2M9G A;  1NSH A;  1AHR A;  1IG5 A;  1WDC B;  3BYA A;  4PDZ A;  2F8P A;  2KFH A;  3I5I B;  3O6B A;  3OB1 B;  4JPZ B;  2JXC A;  1SL9 A;  1TOP A;  3VRN A;  1CMF A;  1M31 A;  1XFX O;  4MLW A;  4C0J A;  1JFJ A;  1XFZ O;  1EXR A;  2AAO A;  2L5X B;  4HRH A;  1PAL A;  2LAP A;  4I5J A;  1X02 A;  2L51 A;  4DS7 A;  1QAS A;  1SRA A;  1NIW A;  2LM5 A;  3LK0 A;  3SJS A;  1DMO A;  1SR6 C;  4QJ3 B;  2G9B A;  3TZ1 A;  1DVI A;  1F71 A;  2JTZ A;  3KPX A;  3WNX B;  2HQ8 A;  2TN4 A;  4OR9 B;  5FYX A;  1FPW A;  1QIV A;  5HKY A;  5D69 A;  5HLV A;  3GK2 A;  2NCO A;  1J7O A;  4MVF A;  1J55 A;  1YUT A;  1JC2 A;  2FOT A;  2LP2 A;  4HSZ A;  1K94 A;  1QXP A;  3JTD C;  2LUX A;  3BUN B;  4OCI A;  1S36 A;  2M49 B;  1KWO C;  3E3R A;  1M63 B;  3TDU A;  2OTG C;  1NWD A;  2K2F A;  1MWN A;  2ZN9 A;  4YI8 A;  1IRJ A;  4M2P A;  1YUS A;  1G33 A;  2PRU A;  3DF0 A;  2EC6 C;  3VRR A;  1CTR A;  3SG6 A;  1SW8 A;  3K21 A;  3OHM B;  1CLB A;  1WRZ A;  4PE4 A;  3I5G C;  2KAV A;  5JJG A;  2CT9 A;  1DJZ A;  2KFG A;  1UHN A;  1CFC A;  1YX7 A;  1JBA A;  1W7J B;  1B47 A;  1S5G Z;  1RTP 1;  1CMG A;  1Y0V H;  2JXL A;  1BMO A;  5AAN A;  1CFD A;  1Y1A A;  3DD4 A;  1LA0 A;  1SR6 B;  2KDH A;  2PAS A;  2WCF A;  4GBA A;  1F8H A;  5DKQ A;  1H4B A;  1MQ1 A;  3OX6 A;  2BBN A;  1REC A;  1M45 A;  1TRF A;  5TNC A;  2WND A;  1MXL C;  2DOQ A;  1W7I B;  1YX8 A;  1TCF A;  2F3Z A;  1SKT A;  3BXK A;  4OVN F;  4YGB B;  4NDC A;  1LKJ A;  2Y4Q A;  3JTD B;  2WOS A;  1GGW A;  1KQM C;  1U5I B;  1MUX A;  1YRU B;  1JFK A;  2M1K B;  2OTG B;  2L4I A;  1BOD A;  1BR4 B;  1K95 A;  2L4H A;  4MEW A;  2Q91 A;  3LCP C;  1PSR A;  4XJK B;  1D1O A;  2MJW B;  3O2P A;  3O78 A;  3EK4 A;  5CSN A;  2EC6 B;  1A2X A;  1NCX A;  2KNE A;  5KTY A;  2F3Y A;  1CFF A;  2BKI B;  3JVT C;  1MR8 A;  2M0R A;  2QAC A;  2BBM A;  2PVB A;  2BCX A;  1KQV A;  2GGM A;  3D0Y B;  2ZFD A;  1N65 A;  1H8B A;  2LNK A;  4ICB A;  2MLE C;  1OZS A;  2KGR A;  4M2O A;  2HPS A;  1CDM A;  2AMI A;  1F70 A;  1CDL A;  5G08 A;  2JT0 A;  1B4C A;  1YUU A;  3SG2 A;  4P5O E;  1RRO A;  3HCM A;  1LVC D;  2LCP A;  1UUS A;  3AAJ A;  2KYC A;  1KSO A;  1CNP A;  1NPQ A;  2CBL A;  4E68 A;  5HKW A;  3VRP A;  2LUC A;  1FF1 A;  2I18 A;  1PVA A;  2LVJ A;  4FTG A;  2KAY A;  2LLS A;  4D1E A;  1ZOT B;  1N0Y A;  1EJ3 A;  2LMT A;  1EH2 A;  1QS7 A;  2LVV A;  1IQ5 A;  1F4O A;  3AKB A;  1DF0 B;  4OV2 A;  1QTX A;  1KQM B;  1ALW A;  1BF5 A;  1DJY A;  2KI6 C;  2HET A;  5PAL A;  2AUC A;  2G2B A;  1K9P A;  2LLT A;  4U8D A;  1EG4 A;  1HT9 A;  1OE9 B;  3PAL A;  3A8R A;  1KK8 C;  3OX5 A;  1Y1X A;  4Q04 A;  1YVL A;  1UHK A;  2LC5 A;  2LVK A;  1TNX A;  5GQQ C;  1B7T Z;  3D10 A;  1OMV A;  5I2Q A;  3TDI A;  3TDZ A;  3JVT B;  1B8C A;  4GUK A;  1YR5 A;  5KU1 A;  1XFY O;  1YRT B;  1WRL A;  1XK4 C;  4BY5 A;  1LA3 A;  2KAX A;  2JTT A;  4ORC B;  1ODB A;  1S5G Y;  4A4B A;  1J1D A;  1KFU S;  1U5I A;  1K93 D;  3CTN A;  3IQQ A;  1BG1 A;  2F2O A;  2WOR A;  1A29 A;  4DUQ A;  4XJK A;  1AJ5 A;  4PE1 A;  1V1G A;  2KGB C;  2BCA A;  2GGZ A;  4R1E A;  3CS1 A;  4AQI A;  5BPJ A;  1B9A A;  1TN4 A;  2ZRT A;  2OS8 C;  2PAL A;  1SCM C;  1QX5 B;  1JWD A;  1NX2 A;  2CTN A;  1XFV O;  3D0Y A;  3QRX A;  1QVI Z;  2F2P A;  3F45 A;  5AER A;  1TNQ A;  2K7D A;  4PHN A;  2K7O A;  3A4U B;  3O4Y A;  2Q4U A;  3EKJ A;  1AJ4 A;  1CFP A;  2MLF C;  1VRK A;  2O5G A;  1KSM A;  1N2D A;  1KK8 B;  1KFX L;  1QX2 A;  1PVB A;  2KQY A;  2ZKM X;  3SG5 A;  2CCM A;  3KEV A;  1OSA A;  2ZN8 A;  1IH0 A;  1RWY A;  1AP4 A;  1B1G A;  1DGV A;  1SL8 A;  4YI9 A;  3EVV A;  1C7W A;  1WRK A;  3SG7 A;  4HRE E;  1KCY A;  1NYA A;  2CNP A;  5JOL A;  3AAK A;  1EL4 A;  3BUO B;  1B8L A;  2KSP A;  2OPO A;  5IBW A;  1K9U A;  1QJT A;  1JF0 A;  1XA5 A;  2BE6 A;  3DVK A;  1DF0 A;  4CFR A;  2BCB A;  4AOM A;  5CSI A;  3FWC A;  2H61 C;  1PSB A;  3NXA A;  2M7N A;  1L2O C;  2Y5I A;  1CM4 A;  1OQP A;  2O60 A;  1NCY A;  2D8N A;  2OS8 B;  1SCM B;  1SPY A;  2P6B B;  3CLN A;  4ZCU A;  2EHB A;  3RLZ A;  4I5N B;  1K2H A;  2JNF A;  3VRQ A;  1DJI A;  1KFX S;  1R2U A;  3GK1 A;  1TCO B;  4GGN A;  5B8I B;  5J3X A;  4F0Z B;  3CR2 A;  1TIZ A;  3LLE A;  2KQ6 A;  2KFF A;  2K8M B;  4GNK B;  4YRU A;  3PN7 C;  1TNW A;  2LE9 B;  4ORB B;  3TS5 C;  3RM1 A;  1CM1 A;  4BY4 A;  1DJX A;  4NQG A;  4WQ2 A;  5I8N A;  2LMU A;  3IF7 A;  1B7T Y;  4FQO A;  1NX0 A;  3SIB A;  1PRW A;  3SG3 A;  2WC8 A;  4DRW A;  2H2K A;  2F33 A;  5AFP A;  2KI6 D;  3EK7 A;  4QJ4 B;  2ZNE A;  3I5F B;  1XYD A;  5AEQ A;  2LP3 A;  1UP5 A;  2KI4 C;  1BU3 A;  2M7L A;  1IWQ A;  5HLO A;  4CPV A;  1K90 D;  2HQW A;  4MRX A;  4CID A;  2MHH A;  3CR4 X;  1UHJ A;  3WXA A;  1WY9 A;  3LL8 B;  2BE4 A;  2V53 A;  3KHE A;  1L2O B;  3KO0 A;  4NDD A;  3PSR A;  1GGZ A;  3NSO A;  1FW4 A;  1XFW O;  4MBE A;  4N1G A;  4P2Y B;  2K7B A;  2R2I A;  3LK1 A;  3EK8 A;  5CPV A;  3SIA A;  1IJ6 A;  4MZK A;  1XK4 A;  4YGA A;  1YTZ C;  1BR1 B;  1QAT A;  1YVH A;  2JT8 A;  1QLK A;  2JU0 A;  4N1F A;  1IKU A;  3CR5 X;  4GGF C;  2ISD A;  3NSL A;  2JRF A;  2I7A A;  2M29 A;  2VRG A;  3PLF B;  2GV5 A;  2WCB A;  2M3W A;  3PN7 B;  5ER4 X;  2A4J A;  2SCP A;  1GJY A;  1R6P A;  2LHL A;  3TS5 B;  2SAS A;  2E6W A;  2LVI A;  1A03 A;  3AKA A;  4JWQ A;  4YBH B;  1QV1 A;  2RGI A;  4USL A;  1ZMZ A;  1SK6 D;  3EVR A;  1M46 A;  1SBJ A;  3FIA A;  1K96 A;  1A75 B;  2JPT A;  2I2R E;  1NUB A;  3GOF A;  4JQ0 D;  1JF2 A;  1NX3 A;  3SG4 A;  4PE0 A;  1S26 D;  1TNP A;  3PM8 A;  3TUY C;  1E8A A;  2KI4 B;  3NSK A;  1S1E A;  4IL1 A;  1LXF C;  3IQO A;  1IQ3 A;  4N5X A;  2NZ0 A;  1DJW A;  4A4C A;  4WQ3 A;  1Y1U A;  4ETO A;  5I2L A;  1GQM A;  2K61 A;  3CZT X;  5HYD A;  3M0W A;  1KK7 Z;  4PAL A;  2JZI A;  2I94 A;  4PHK A;  3BUX B;  1TTX A;  5DKN A;  1BT6 A;  1DT7 B;  3WHT B;  1B8R A;  1K8U A;  1G4Y R;  1F54 A;  4NDB A;  1HQV A;  2MAZ A;  1MHO A;  2BEC A;  2PMY A;  1QLS A;  2IS9 A;  3PFV A;  1SNL A;  3EVU A;  2LMV A;  3FS7 A;  1Q80 A;  1BOC A;  1RK9 A;  2ZRS A;  1RFJ A;  5HKZ A;  2MBX A;  1SCV A;  1PK0 D;  2KBM A;  1MF8 B;  4PHM A;  2WCE A;  2E30 A;  1J1E A;  1IJ5 A;  1ZFS A;  3EKH A;  3I5H C;  1BJF A;  2H61 A;  3H4S E;  4MN0 A;  2ZND A;  2LV7 A;  2JT3 A;  1UUR A;  1BLQ A;  1OOJ A;  3I5F C;  2FJU B;  2PSR A;  3OB2 B;  1S6J A;  2K0J A;  3DVM A;  1J7P A;  1JSA A;  4PHJ A;  1ZAC A;  1ALV A;  2KOT A;  1JUO A;  3DVJ A;  2NLN A;  1Y6W A;  2NCP A;  1C7V A;  1G8I A;  2JC2 A;  2LHI A;  1K9K A;  2JNX A;  3TUY B;  1AUI B;  3KF9 A;  4DIR A;  3CGA A;  5KSZ A;  3BOW B;  3BQ3 A;  2KYF A;  4C0K A;  4TNC A;  2NXQ A;  2COL B;  4GAO A;  1L7Z A;  5AXI A;  1CB1 A;  1QIW A;  1CDN A;  2FCD A;  1SYM A;  4PCW A;  4MZL A;  1DGU A;  4MRY A;  1J7Q A;  4YGE B;  2LLU A;  3FWB A;  1J7R A;  4L9M A;  4I5K A;  4AQJ A;  1XVJ A;  2BL0 C;  1A75 A;  1CDP A;  5I2O A;  1DJH A;  4OKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...