1H4BA

Solution structure of the birch pollen allergen bet v 4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords POLCALCIN BET V 4
publication title Solution Structure, Dynamics, and Hydrodynamics of the Calcium-Bound Cross-Reactive Birch Pollen Allergen Bet V 4 Reveal a Canonical Monomeric Two EF-Hand Assembly with a Regulatory Function
pubmed doi rcsb
source organism Betula verrucosa
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h4bA00
2LE9B 1UUSA 2KBIA 3O2PA 4XJKB 2MAZA 2I2RE 5ER5A 1FPWA 4BY5A 2WNDA 1IQ5A 2OTGB 1EG4A 2HF5A 3JTDB 5HKZA 1TNQA 3EVRA 1OZSA 1BLQA 1CDMA 3LLEA 4M2PA 2K7DA 4PDZA 3JVTB 2JXCA 1RK9A 5B8IB 1WRZA 1S6IA 4OVNF 2K0JA 4GUKA 1NX1A 4GPLB 2ISDA 1J1EA 1AP4A 1FBVA 1SK6D 4A4BA 4YGBB 3PN7B 4MSPA 4M2QA 5DKQA 1MHOA 1NCXA 1LXFC 5HYDA 4MZKA 1M39A 4MZLA 3SG2A 4CFQA 1IQ3A 2QPTA 3KF9A 3SJSA 3NSLA 3O4YA 1SCMC 2MLEC 1SL7A 3CS1A 2P6BB 1FF1A 4MLWA 3WHTB 1TOPA 5I2QA 2NZ0A 4U8DA 1NCYA 2M8UA 2MHHA 1F4QA 1DF0B 4XJKA 3TUYB 5DKNA 1DGUA 2ZKMX 3F45A 4AOMA 5JJGA 1CDNA 2Y5IA 2K2FA 2GV5A 2H61A 1QX7A 1DJXA 2COLB 2E6WA 2BCBA 2Y4QA 1QJTA 2CXJA 3KO0A 3VRRA 2G2BA 3TZ1A 2ZNDA 1K9KA 1QV0A 3DF0B 3EKJA 4IL1A 4OR9B 2DOQA 2LVKA 5HLVA 1LKJA 1QIVA 5PALA 1KQMB 2AAOA 1ZMZA 4NQGA 1CLMA 2PMYA 3SIAA 1A2XA 4JPZB 2LUXA 1CLLA 1G33A 1KK8B 1C7WA 2BBNA 1VRKA 1TCOB 2VRGA 4PHMA 1YUSA 1TN4A 2LMTA 1QX5B 1A29A 2OTGC 1PSBA 1AJ4A 1QATA 2MA2A 3I5GB 4QJ5B 1CLBA 2AUCA 2H61C 1K9UA 1UP5A 1B8CA 3DVKA 1EH2A 1GGZA 1U5IA 1F4OA 3JVTC 1CFPA 4MN0A 1QLKA 2BCAA 1FI5A 4JQ0D 2L50A 1RWYA 1EJ3A 5I2OA 1B1GA 1DJHA 4JWQA 1C07A 3OB1B 1QV1A 4GAOA 2LM5A 2RGIA 2JTZA 1DJIA 1BOCA 2KOTA 1NPQA 2M7NA 1DF0A 1XFUO 3IQOA 1MXEA 1XFXO 1JWDA 3HX4A 3PN7C 1KFXS 3FWCA 3PM8A 4YGDB 5BPJA 4GNKB 2F2OA 2M0RA 4ICBA 4PHKA 1DVIA 1Y0VH 1B7TZ 1Y1UA 4C0KA 3RM1A 2LMVA 1DMOA 2PVBA 4Q04A 3PALA 4PCWA 4OCIA 1AK8A 1YTZC 3BUWB 3DF0A 1SR6B 1LVCD 1DJWA 2KAVA 1JF2A 2D8NA 2L51A 1J7OA 1YVHA 1K2HA 2K61A 3QRXA 2KI4B 1DGVA 2SCPA 1BMOA 4I5LB 5IBWA 1K8UA 1SRAA 2KGBC 1ZACA 1YUUA 2GGZA 3VRNA 5CSIA 3TUYC 1OZOA 1SBJA 1HT9A 3PATA 1Y1XA 1DT7B 1MXLC 4P5OE 4GGFA 1SMGA 1M46A 3I5IB 5HLOA 1KCYA 1AUIB 3SIBA 1CB1A 1WLZA 1YR5A 1ZUZA 1XFZO 2K7OA 3OB2B 4C0JA 1TNPA 2B1UA 4FTGA 1J7PA 1KQMC 1BR1B 1NYAA 2AMIA 4NDBA 2PALA 4HSZA 1S6CA 4QJ4B 1WRLA 3CR5X 1KK8C 2HETA 3BUXB 3FIAA 1EL4A 2LV7A 3CGAA 3KHEA 1Y1AA 3EKHA 3SG6A 3VROA 5DKRA 4XYNA 2KDHA 3VGOA 1XVJA 3I5GC 4GGFC 3SG5A 2M29A 2KI6C 3D0YB 2ZFDA 4CLNA 1UURA 1OSAA 4YI8A 5FYXA 2BECA 1FW4A 3AAJA 2K7CA 3BUMB 5D7FA 5KSZA 1B47A 1K95A 2HQ8A 5F6TA 2IS9A 1JUOA 1OQPA 2KYCA 4FQOA 2LCPA 1W7IB 1V1FA 1UHKA 2CTNA 1MF8B 2QACA 2CBLA 2OS8B 2LC5A 2WORA 3WHUB 1Y6WA 4D1EA 4TNCA 4N1GA 1ALWA 4PE7A 4QJ3B 1IH0A 2ZRSA 2BE6A 3A4UB 2JC2A 3NXAA 4NDCA 3SG4A 2E30A 1F71A 1CKKA 2NXQA 2LVVA 3BOWA 1K93D 2Q4UA 2EHBA 1IJ5A 4PE4A 2H2KA 2JOJA 2ZRTA 4GBAA 1SR6C 2JZIA 4ZCVA 2LHLA 5KTYA 1YX7A 3GK1A 1ZFSA 2JT0A 4GGNA 1CM4A 1JF0A 4PE0A 1B7TY 5TNCA 1UWOA 3CTNA 2K8MB 1JFJA 1JFKA 1OOJA 1H4BA 1H8BA 3CWGA 2JT8A 1E8AA 1W7JB 1N2DA 1KSMA 3AKBA 4MRYA 3OHMB 3SG7A 2K7BA 1KWOB 3GOFA 4MRXA 4N1FA 3I5IC 5HKWA 3D0YA 2WC8A 1CNPA 1MR8A 1QS7A 2PSRA 2L2EA 1S6JA 3O78A 2WCBA 4ETOA 2I94A 3OP0A 1XO5A 4ORAB 3LK0A 2HQWA 3TS5B 3JTDC 1SYMA 4MBEA 3DVJA 1G4YR 3NSOA 1CFCA 1SL8A 2BKHB 1YRUB 1F55A 3CR2A 1XFWO 1HQVA 1KSOA 2BL0B 3AKAA 1DJYA 4C0LA 2LNKA 1YURA 4R1EA 1TNWA 2JNXA 3IQQA 2FCDA 2A4JA 3CR4X 1IGVA 1QVIZ 3KPXA 1KFUL 3I5HB 2OS8C 1CMFA 2Q91A 3EK7A 1SPYA 1A03A 2CNPA 3EVVA 1XFVO 2L98A 3TDZA 4DUQA 1GGWA 4CPVA 2V53A 1IRJA 1NWDA 5CSJA 4DS7A 1D1OA 1NX3A 2ZNEA 2KNEA 1CM1A 1YUTA 2JU0A 1B4CA 4MZJA 1TCFA 1SKTA 4OKHA 5GQQC 2LAPA 5AEQA 3CZTX 3WNXB 2F33A 2JWWA 4MVFA 4CFRA 1MUXA 1JC2A 2M1KB 3EK4A 1B9AA 1KQVA 4P2YB 2LP3A 1SW8A 4AQIA 1NIWA 3OX5A 4AQJA 5K89A 1UHNA 2O60A 1K90D 3BQ3A 1BODA 1LA0A 2KBMA 5I8NA 1JBAA 2OPOA 3NSKA 5CPVA 4I5KA 4OV2A 4USLA 1DJZA 1WDCB 2JTTA 4WQ3A 3PSRA 3D10A 4YGCB 4N5XA 2M1UA 1OMRA 3BYAA 1A75B 1KK7Z 2EC6B 2M49B 1UHJA 1YRTB 1NX0A 3GK4X 3TS5C 1KFXL 3H4SE 2L5XB 4YBHB 2KFHA 3BUNB 1CDPA 1L7ZA 1PVAA 1WY9A 2CCMA 1RROA 3MSEB 1PULA 4F0ZB 2BCXA 2KSPA 2ZN8A 3EK8A 1WRKA 2BKIB 1M45A 1F70A 1OMDA 2BL0C 3DVEA 2R2IA 1S3PA 4L9MA 2M9GA 2Y1MA 1BF5A 1XFYO 1BJFA 5CSFA 1G8IA 4HRHA 2KAYA 1MWNA 2F8PA 4CIDA 1YVLA 3FS7A 1QLSA 3KEVA 1XYDA 2BE4A 2Y1NA 3HCMA 4I5NB 2BBMA 5ER4X 3VRPA 4YI9A 1A4PA 1IKUA 1B8RA 4YGAA 2NCPA 2JULA 2G9BA 5AERA 3I5HC 3AAKA 3WXAA 2WCEA 1YX8A 2FCEA 2JPTA 1EXRA 1CFDA 1QIWA 1QVIY 1LA3A 3IF7A 4PHJA 1LINA 3O6BA 1J7QA 5KU1A 3EVUA 2KI4C 1R6PA 1U5IB 4PE1A 1CFFA 1S36A 1QTXA 4PALA 2GGMA 4WRIA 2LLUA 4I5JA 1A75A 4UPGA 1PVBA 2KAXA 4HREE 4WQ2A 1S5GZ 5J3XA 1S1EA 3DD4A 5AFPA 1RECA 1EG3A 1IG5A 1MQ1A 1L2OB 1J7RA 1NP8A 1XK4A 2WCFA 3RLZA 4DIRA 1ZOTB 2LVJA 3LL8B 4M2OA 5G08A 3ZWHA 1F8HA 1AVSA 3A8RA 4A4CA 3DVMA 1J1DA 1KFUS 2L4IA 1JSAA 3ZNIA 3BUOB 2MLFC 1K94A 1CMGA 3I5FB 3K21A 1WDCC 5HKYA 2NCOA 1BT6A 4DCKA 5D69A 2TN4A 2FJUB 2M97A 1ALVA 2KQYA 2LANA 1K96A 2EC6C 2LP2A 2M7LA 2LLSA 2CT9A 2O5GA 2NLNA 1RJVA 2SASA 1CTRA 1TRFA 1XK4C 1GQMA 1NSHA 1SNLA 1IJ6A 2LVIA 1RFJA 1J55A 1V1GA 3CLNA 1AJ5A 2F2PA 1PALA 1KK7Y 2JXLA 1M63B 1BG1A 3PFVA 1N65A 2JT3A 2KI6D 1DJGA 2LHIA 1SCVA 1DTLA 2EGDA 4PHNA 1R2UA 2KHNA 2MJWB 1FI6A 1TIZA 2LUCA 4HRGA 4YGEB 1PK0D 3M0WA 4E68A 1PRWA 1S26D 1B8LA 1BR4B 3FWBA 4BY4A 5AANA 1SY9A 3TDIA 2L0PA 3LK1A 2L4HA 1TTXA 1QX2A 2PASA 4YRUA 3PLFB 2HPSA 2JNFA 1NX2A 1XA5A 4ORCB 1NCZA 2F3ZA 2LLTA 1SCMB 1RTP1 3TDUA 2KYFA 3VRQA 2ZN9A 2F3YA 2WOSA 2MBXA 1C7VA 4NDDA 2KGRA 2PRUA 2I7AA 1AHRA 1GJYA 4ORBB 1WLMA 2KQ6A 2LMUA 3ICBA 1BU3A 2K2AA 5I2LA 2FOTA 1IWQA 1F54A 1UHIA 3BXKA 4DRWA 1NUBA 2I18A 1SL9A 1ODBA 2KFGA 1KWOC 2KFFA 5CSNA 1L2OC 1OMVA 1QXPA 1PSRA 1CDLA 1OE9B 4GFTA 2M3WA 3C1VA 1TNXA 2JQ6A 3SG3A 1M31A 1X02A 5AXIA 1UHHA 1S5GY 4ZCUA 4MEWA 2JRFA 2MRDA 5JOLA 1N0YA 3NSIA 1QASA 3E3RA 3I5FC 3BOWB 1Q80A 3LCPC 1K9PA 3GK2A 3OX6A
chains in the Genus database with same CATH superfamily
2LE9B 1UUSA 2KBIA 3DY9A 3O2PA 3N7HA 2MAZA 2I2RE 4XJKB 5ER5A 1FPWA 4BY5A 2WNDA 1IQ5A 2OTGB 1EG4A 2HF5A 2FJYA 3JTDB 5HKZA 1TNQA 3Q8IA 3EVRA 1OZSA 1BLQA 3B86A 1CDMA 3LLEA 4M2PA 2K7DA 4PDZA 3D75A 3JVTB 2JXCA 1RK9A 5B8IB 1WRZA 3DYEA 1S6IA 4OVNF 2K0JA 4GUKA 1NX1A 4GPLB 2ISDA 1J1EA 2BAPA 1AP4A 1FBVA 3NGVA 1SK6D 4A4BA 4YGBB 3PN7B 4MSPA 5I94A 4M2QA 5DKQA 1MHOA 3D74A 2L5YA 1NCXA 1LXFC 5HYDA 4MZKA 1M39A 4MZLA 3SG2A 4CFQA 1IQ3A 2QPTA 3KF9A 3D73A 3SJSA 3NSLA 3O4YA 1SCMC 2MLEC 3O4XA 1SL7A 3CS1A 1QWVA 2P6BB 1FF1A 4MLWA 3WHTB 1TOPA 5FI2A 2NZ0A 4U8DA 1NCYA 5I2QA 2M8UA 2MHHA 1F4QA 2WCKA 3CABA 1DF0B 4XJKA 3CYZA 3FE9A 3TUYB 5DKNA 1DGUA 2ZKMX 3F45A 4AOMA 3UO9A 3D77A 5JJGA 2Y5IA 1CDNA 2K2FA 2GV5A 2H61A 1QX7A 1DJXA 2COLB 2E6WA 2BCBA 2Y4QA 1QJTA 2CXJA 2P71A 3KO0A 3VRRA 2G2BA 3TZ1A 2ZNDA 1K9KA 1QV0A 3DF0B 3EKJA 4IL1A 4JD9A 2DOQA 2LVKA 2WCJA 1LKJA 1QIVA 5HLVA 1KQMB 5PALA 2AAOA 1ZMZA 4NQGA 1CLMA 2PMYA 3SIAA 1A2XA 4JPZB 2LUXA 1CLLA 1G33A 1KK8B 1C7WA 3R72A 2ERBA 2BBNA 1VRKA 1TCOB 2VRGA 4PHMA 1YUSA 1TN4A 2LMTA 1QX5B 3L47A 1A29A 2OTGC 3S0AA 1PSBA 1AJ4A 1QATA 2MA2A 3R1PA 3I5GB 4QJ5B 1CLBA 2AUCA 2H61C 1K9UA 1UP5A 1B8CA 3DVKA 1EH2A 1GGZA 1U5IA 1F4OA 1SSEB 3JVTC 3PJIA 4MN0A 1CFPA 1QLKA 2BCAA 3FE6A 1FI5A 4JQ0D 2L50A 1RWYA 1EJ3A 2WCHA 5I2OA 1DJHA 4JWQA 1B1GA 3OB1B 1QV1A 1C07A 4GAOA 2LM5A 2RGIA 2JTZA 1DJIA 1BOCA 2KOTA 1NPQA 2M7NA 1DF0A 2GTEA 1XFUO 3IQOA 1MXEA 1XFXO 1JWDA 3HX4A 3PN7C 3S0BA 2WC6A 1KFXS 1T14A 1ORGA 3FWCA 3PM8A 4YGDB 5BPJA 4GNKB 4FQTA 3B87A 2F2OA 2M0RA 4ICBA 4PHKA 1DVIA 1Y0VH 1B7TZ 1Y1UA 4C0KA 3RM1A 2LMVA 4OR9B 1DMOA 2PVBA 3L4AA 4Q04A 3PALA 4PCWA 4OCIA 2WCMA 2WC5A 1YTZC 3BUWB 3DF0A 1AK8A 1SR6B 1LVCD 1DJWA 2KAVA 3R1VA 1JF2A 2D8NA 2L51A 1J7OA 1YVHA 1OOFA 1K2HA 1C3ZA 2K61A 3QRXA 2KI4B 1DGVA 2SCPA 1BMOA 4I5LB 5IBWA 1K8UA 1SRAA 2KGBC 1ZACA 1YUUA 2GGZA 3VRNA 5CSIA 3TUYC 1OZOA 1SBJA 1HT9A 3PATA 1Y1XA 1DELA 1DT7B 1MXLC 4P5OE 4GGFA 1SMGA 1M46A 3I5IB 5HLOA 1KCYA 1AUIB 3SIBA 1DQEA 1CB1A 1WLZA 1Z4HA 1YR5A 1ZUZA 1XFZO 2K7OA 3OB2B 1OOIX 1TNPA 1TUJA 2B1UA 4FTGA 4C0JA 1J7PA 1KQMC 1BR1B 1NYAA 2AMIA 4NDBA 2PALA 4HSZA 1S6CA 3SS3A 4QJ4B 1WRLA 3CR5X 1KK8C 2HETA 3BUXB 3FIAA 1EL4A 2LV7A 3CGAA 3KHEA 1Y1AA 3EKHA 3SG6A 3VROA 5DKRA 4XYNA 2KDHA 3VGOA 1XVJA 3I5GC 4GGFC 3SG5A 2M29A 2H8VA 2KI6C 3D0YB 2ZFDA 4CLNA 1UURA 1OSAA 4YI8A 5FYXA 1LS8A 2BECA 1FW4A 3AAJA 2K7CA 3BUMB 5D7FA 2QEBA 3S0EA 5KSZA 1B47A 1K95A 2HQ8A 5F6TA 2IS9A 1JUOA 1OQPA 2KYCA 4FQOA 2P70A 2LCPA 1W7IB 1V1FA 1UHKA 2CTNA 1MF8B 2KLEA 2QACA 2CBLA 2OS8B 2LC5A 2WORA 3WHUB 3RZSA 1W9ZA 1Y6WA 3QMEA 4TNCA 4D1EA 4N1GA 1ALWA 4PE7A 4QJ3B 1IH0A 2ZRSA 2PQLA 2BE6A 3A4UB 2JC2A 3NHTA 3NXAA 4NDCA 3SG4A 2E30A 1F71A 1CKKA 2NXQA 2LVVA 4INXA 3BOWA 1K93D 2Q4UA 2EHBA 1IJ5A 4PE4A 2H2KA 2JOJA 2ZRTA 4GBAA 3CZ0A 1SR6C 2JZIA 4ZCVA 2LHLA 5KTYA 1YX7A 3GK1A 1ZFSA 2JT0A 4GGNA 1CM4A 1JF0A 4PE0A 1B7TY 5FI7A 1UWOA 5TNCA 3CTNA 2K8MB 2QEVA 1JFJA 1JFKA 5EL2A 1OOJA 1H4BA 1H8BA 3CWGA 2JT8A 1E8AA 1W7JB 1N2DA 1KSMA 3AKBA 3NHIA 1OOGA 2KPHA 4MRYA 3OHMB 3SG7A 2K7BA 1KWOB 3GOFA 4MRXA 4N1FA 3I5IC 5HKWA 3CDNA 2WC8A 3D0YA 1MR8A 1CNPA 1QS7A 2PSRA 2L2EA 1S6JA 3O78A 2WCBA 1XFRA 4ETOA 2I94A 3S0FA 3OGNA 1XO5A 3OP0A 3LK0A 2HQWA 4ORAB 3TS5B 3JTDC 3BFBA 1SYMA 2JPOA 4JKTA 4MBEA 3DVJA 1G4YR 3NSOA 1CFCA 3CZ2A 1SL8A 2BKHB 1YRUB 2WCLA 1F55A 3CR2A 1XFWO 3UNWA 1HQVA 1KSOA 2BL0B 3AKAA 1DJYA 4C0LA 2LNKA 4F7FA 1YURA 4R1EA 1TNWA 2JNXA 3IQQA 2FCDA 2A4JA 2K60A 3CR4X 1IGVA 1P28A 1QVIZ 3KPXA 2QDIA 3B88A 1KFUL 3I5HB 2OS8C 1CMFA 2Q91A 3EK7A 1SPYA 1A03A 2CNPA 3EVVA 1XFVO 2L98A 3TDZA 4DUQA 1GGWA 4CPVA 2V53A 1IRJA 3D78A 1NWDA 4INWA 5CSJA 4DS7A 1D1OA 1NX3A 2ZNEA 2KNEA 1CM1A 1YUTA 2JU0A 1B4CA 4MZJA 1TCFA 1SKTA 4OKHA 5GQQC 2LAPA 5AEQA 3CZTX 3WNXB 2F33A 2JWWA 3DZTA 4MVFA 4CFRA 1MUXA 1JC2A 3IVTA 2M1KB 3EK4A 1B9AA 1KQVA 4P2YB 2LP3A 1SW8A 3B6XA 5DICA 4AQIA 1NIWA 3OX5A 3BJHA 4AQJA 3S0GA 5K89A 1UHNA 2O60A 1DC1A 1K90D 3BQ3A 1BODA 1LA0A 3K1EA 5HL1A 2KBMA 5I8NA 1JBAA 2OPOA 3NSKA 5CPVA 4I5KA 4OV2A 4USLA 1DJZA 1WDCB 2JTTA 4WQ3A 3PSRA 3D10A 4YGCB 4N5XA 1GM0A 1IIOA 2M1UA 1OMRA 3BYAA 1A75B 1KK7Z 2EC6B 2M49B 1UHJA 3OBVA 1YRTB 1NX0A 3GK4X 3TS5C 1KFXL 3H4SE 2L5XB 4YBHB 2KFHA 3BUNB 1CDPA 1L7ZA 1PVAA 1WY9A 2CCMA 1RROA 3MSEB 3D76A 1PULA 4F0ZB 2BCXA 2KSPA 2ZN8A 3EK8A 1WRKA 2BKIB 1M45A 1F70A 1OMDA 2BL0C 3DVEA 2R2IA 1S3PA 4L9MA 2M9GA 2Y1MA 1BF5A 1XFYO 1BJFA 5CSFA 1G8IA 2KLDA 2KAYA 4HRHA 1MWNA 2F8PA 3V2LA 4CIDA 1YVLA 3FS7A 1QLSA 3KEVA 1XYDA 2BE4A 2Y1NA 3HCMA 4I5NB 2BBMA 5ER4X 3VRPA 4YI9A 1A4PA 1OW4A 1IKUA 1B8RA 4YGAA 2NCPA 1DEKA 2JULA 2G9BA 5AERA 3I5HC 3AAKA 3WXAA 4OZDA 2WCEA 1YX8A 2PYQA 2QEOA 2FCEA 2JPTA 1EXRA 1CFDA 1QIWA 1QVIY 1LA3A 3CZ1A 3IF7A 4PHJA 1C3YA 1LINA 3O6BA 1J7QA 5KU1A 3EVUA 2KI4C 1R6PA 1U5IB 2BNXA 4PE1A 1CFFA 1S36A 1QTXA 4PALA 2L2CA 2GGMA 4WRIA 2LLUA 3BFHA 1A75A 4I5JA 4UPGA 1PVBA 2KAXA 4HREE 4WQ2A 1S5GZ 5J3XA 1S1EA 3DD4A 5AFPA 1RECA 1EG3A 1IG5A 1MQ1A 1L2OB 1J7RA 1NP8A 1XK4A 2QEHA 2WCFA 3RLZA 4DIRA 1ZOTB 2LVJA 3FE8A 3LL8B 4M2OA 5G08A 3ZWHA 1F8HA 1AVSA 3A8RA 3SS4A 3R1OA 4A4CA 3DVMA 1J1DA 1KFUS 2L4IA 1JSAA 3ZNIA 3BUOB 2MLFC 1K94A 1CMGA 3I5FB 3K21A 1WDCC 5HKYA 2NCOA 1BT6A 1TWOA 4DCKA 5D69A 2TN4A 2FJUB 2M97A 1ALVA 2KQYA 2LANA 1K96A 2EC6C 3L4LA 2LP2A 3PM2A 2M7LA 2LLSA 2CT9A 2O5GA 2NLNA 1RJVA 2SASA 1CTRA 4PT1A 1TRFA 1XK4C 1GQMA 1NSHA 1SNLA 1IJ6A 2LVIA 1RFJA 1J55A 1V1GA 3CLNA 1AJ5A 1TUZA 2F2PA 1PALA 1KK7Y 2JXLA 1M63B 1Z2CB 4KYNA 1BG1A 3PFVA 1N65A 2JT3A 2KI6D 1DJGA 2LHIA 1SCVA 1DTLA 2EGDA 4PHNA 1R2UA 2KHNA 2MJWB 3BFAA 1TIZA 2LUCA 1FI6A 4HRGA 4YGEB 1PK0D 3M0WA 4E68A 1PRWA 1S26D 1B8LA 1BR4B 3FWBA 4BY4A 5AANA 1SY9A 3TDIA 2L0PA 3LK1A 2L4HA 5FI6A 1TTXA 1QX2A 2PASA 4YRUA 3PLFB 3VB1A 2HPSA 2JNFA 1NX2A 1XA5A 4ORCB 1NCZA 2YGUA 2F3ZA 2LLTA 1SCMB 1RTP1 3TDUA 2KYFA 3VRQA 2ZN9A 2F3YA 2WOSA 2MBXA 1C7VA 4NDDA 2KGRA 2PRUA 2I7AA 1AHRA 5D3OA 3S0DA 1GJYA 4ORBB 1WLMA 2KQ6A 2LMUA 3ICBA 1BU3A 2K2AA 5I2LA 2FOTA 1IWQA 1F54A 1UHIA 3BXKA 4DRWA 1NUBA 2I18A 1SL9A 1ODBA 2KFGA 1KWOC 2KFFA 1OOHA 5CSNA 1L2OC 1OMVA 1QXPA 1PSRA 1CDLA 1OE9B 4GFTA 2M3WA 4IJ7A 3C1VA 1TNXA 2JQ6A 3SG3A 1M31A 1X02A 3B7AA 5AXIA 1UHHA 3EG5B 1S5GY 4ZCUA 3SS5A 4MEWA 2JRFA 2MRDA 5JOLA 1N0YA 3NSIA 1QASA 3E3RA 3I5FC 3BOWB 1Q80A 3LCPC 1K9PA 3GK2A 3DXLA 3OX6A
chains in the Genus database with same CATH topology
2LE9B 1UUSA 2KBIA 3O2PA 4XJKB 2MAZA 2I2RE 5ER5A 1FPWA 4BY5A 2WNDA 1IQ5A 2OTGB 1EG4A 2HF5A 3JTDB 5HKZA 1TNQA 3EVRA 1OZSA 1BLQA 1CDMA 3LLEA 4M2PA 2K7DA 4PDZA 3JVTB 2JXCA 1RK9A 5B8IB 1WRZA 1S6IA 4OVNF 2K0JA 4GUKA 1NX1A 4GPLB 2ISDA 1J1EA 1AP4A 1FBVA 1SK6D 4A4BA 4YGBB 3PN7B 4MSPA 4M2QA 5DKQA 1MHOA 1NCXA 1LXFC 5HYDA 4MZKA 1M39A 4MZLA 3SG2A 4CFQA 1IQ3A 2QPTA 3KF9A 3SJSA 3NSLA 3O4YA 1SCMC 2MLEC 1SL7A 3CS1A 2P6BB 1FF1A 4MLWA 3WHTB 1TOPA 5I2QA 2NZ0A 4U8DA 1NCYA 2M8UA 2MHHA 1F4QA 1DF0B 4XJKA 3TUYB 5DKNA 1DGUA 2ZKMX 3F45A 4AOMA 5JJGA 1CDNA 2Y5IA 2K2FA 2GV5A 2H61A 1QX7A 1DJXA 2COLB 2E6WA 2BCBA 2Y4QA 1QJTA 2CXJA 3KO0A 3VRRA 2G2BA 3TZ1A 2ZNDA 1K9KA 1QV0A 3DF0B 3EKJA 4IL1A 4OR9B 2DOQA 2LVKA 5HLVA 1LKJA 1QIVA 5PALA 1KQMB 2AAOA 1ZMZA 4NQGA 1CLMA 2PMYA 3SIAA 1A2XA 4JPZB 2LUXA 1CLLA 1G33A 1KK8B 1C7WA 2BBNA 1VRKA 1TCOB 2VRGA 4PHMA 1YUSA 1TN4A 2LMTA 1QX5B 1A29A 2OTGC 1PSBA 1AJ4A 1QATA 2MA2A 3I5GB 4QJ5B 1CLBA 2AUCA 2H61C 1K9UA 1UP5A 1B8CA 3DVKA 1EH2A 1GGZA 1U5IA 1F4OA 3JVTC 1CFPA 4MN0A 1QLKA 2BCAA 1FI5A 4JQ0D 2L50A 1RWYA 1EJ3A 5I2OA 1B1GA 1DJHA 4JWQA 1C07A 3OB1B 1QV1A 4GAOA 2LM5A 2RGIA 2JTZA 1DJIA 1BOCA 2KOTA 1NPQA 2M7NA 1DF0A 1XFUO 3IQOA 1MXEA 1XFXO 1JWDA 3HX4A 3PN7C 1KFXS 3FWCA 3PM8A 4YGDB 5BPJA 4GNKB 2F2OA 2M0RA 4ICBA 4PHKA 1DVIA 1Y0VH 1B7TZ 1Y1UA 4C0KA 3RM1A 2LMVA 1DMOA 2PVBA 4Q04A 3PALA 4PCWA 4OCIA 1AK8A 1YTZC 3BUWB 3DF0A 1SR6B 1LVCD 1DJWA 2KAVA 1JF2A 2D8NA 2L51A 1J7OA 1YVHA 1K2HA 2K61A 3QRXA 2KI4B 1DGVA 2SCPA 1BMOA 4I5LB 5IBWA 1K8UA 1SRAA 2KGBC 1ZACA 1YUUA 2GGZA 3VRNA 5CSIA 3TUYC 1OZOA 1SBJA 1HT9A 3PATA 1Y1XA 1DT7B 1MXLC 4P5OE 4GGFA 1SMGA 1M46A 3I5IB 5HLOA 1KCYA 1AUIB 3SIBA 1CB1A 1WLZA 1YR5A 1ZUZA 1XFZO 2K7OA 3OB2B 4C0JA 1TNPA 2B1UA 4FTGA 1J7PA 1KQMC 1BR1B 1NYAA 2AMIA 4NDBA 2PALA 4HSZA 1S6CA 4QJ4B 1WRLA 3CR5X 1KK8C 2HETA 3BUXB 3FIAA 1EL4A 2LV7A 3CGAA 3KHEA 1Y1AA 3EKHA 3SG6A 3VROA 5DKRA 4XYNA 2KDHA 3VGOA 1XVJA 3I5GC 4GGFC 3SG5A 2M29A 2KI6C 3D0YB 2ZFDA 4CLNA 1UURA 1OSAA 4YI8A 5FYXA 2BECA 1FW4A 3AAJA 2K7CA 3BUMB 5D7FA 5KSZA 1B47A 1K95A 2HQ8A 5F6TA 2IS9A 1JUOA 1OQPA 2KYCA 4FQOA 2LCPA 1W7IB 1V1FA 1UHKA 2CTNA 1MF8B 2QACA 2CBLA 2OS8B 2LC5A 2WORA 3WHUB 1Y6WA 4D1EA 4TNCA 4N1GA 1ALWA 4PE7A 4QJ3B 1IH0A 2ZRSA 2BE6A 3A4UB 2JC2A 3NXAA 4NDCA 3SG4A 2E30A 1F71A 1CKKA 2NXQA 2LVVA 3BOWA 1K93D 2Q4UA 2EHBA 1IJ5A 4PE4A 2H2KA 2JOJA 2ZRTA 4GBAA 1SR6C 2JZIA 4ZCVA 2LHLA 5KTYA 1YX7A 3GK1A 1ZFSA 2JT0A 4GGNA 1CM4A 1JF0A 4PE0A 1B7TY 5TNCA 1UWOA 3CTNA 2K8MB 1JFJA 1JFKA 1OOJA 1H4BA 1H8BA 3CWGA 2JT8A 1E8AA 1W7JB 1N2DA 1KSMA 3AKBA 4MRYA 3OHMB 3SG7A 2K7BA 1KWOB 3GOFA 4MRXA 4N1FA 3I5IC 5HKWA 3D0YA 2WC8A 1CNPA 1MR8A 1QS7A 2PSRA 2L2EA 1S6JA 3O78A 2WCBA 4ETOA 2I94A 3OP0A 1XO5A 4ORAB 3LK0A 2HQWA 3TS5B 3JTDC 1SYMA 4MBEA 3DVJA 1G4YR 3NSOA 1CFCA 1SL8A 2BKHB 1YRUB 1F55A 3CR2A 1XFWO 1HQVA 1KSOA 2BL0B 3AKAA 1DJYA 4C0LA 2LNKA 1YURA 4R1EA 1TNWA 2JNXA 3IQQA 2FCDA 2A4JA 3CR4X 1IGVA 1QVIZ 3KPXA 1KFUL 3I5HB 2OS8C 1CMFA 2Q91A 3EK7A 1SPYA 1A03A 2CNPA 3EVVA 1XFVO 2L98A 3TDZA 4DUQA 1GGWA 4CPVA 2V53A 1IRJA 1NWDA 5CSJA 4DS7A 1D1OA 1NX3A 2ZNEA 2KNEA 1CM1A 1YUTA 2JU0A 1B4CA 4MZJA 1TCFA 1SKTA 4OKHA 5GQQC 2LAPA 5AEQA 3CZTX 3WNXB 2F33A 2JWWA 4MVFA 4CFRA 1MUXA 1JC2A 2M1KB 3EK4A 1B9AA 1KQVA 4P2YB 2LP3A 1SW8A 4AQIA 1NIWA 3OX5A 4AQJA 5K89A 1UHNA 2O60A 1K90D 3BQ3A 1BODA 1LA0A 2KBMA 5I8NA 1JBAA 2OPOA 3NSKA 5CPVA 4I5KA 4OV2A 4USLA 1DJZA 1WDCB 2JTTA 4WQ3A 3PSRA 3D10A 4YGCB 4N5XA 2M1UA 1OMRA 3BYAA 1A75B 1KK7Z 2EC6B 2M49B 1UHJA 1YRTB 1NX0A 3GK4X 3TS5C 1KFXL 3H4SE 2L5XB 4YBHB 2KFHA 3BUNB 1CDPA 1L7ZA 1PVAA 1WY9A 2CCMA 1RROA 3MSEB 1PULA 4F0ZB 2BCXA 2KSPA 2ZN8A 3EK8A 1WRKA 2BKIB 1M45A 1F70A 1OMDA 2BL0C 3DVEA 2R2IA 1S3PA 4L9MA 2M9GA 2Y1MA 1BF5A 1XFYO 1BJFA 5CSFA 1G8IA 4HRHA 2KAYA 1MWNA 2F8PA 4CIDA 1YVLA 3FS7A 1QLSA 3KEVA 1XYDA 2BE4A 2Y1NA 3HCMA 4I5NB 2BBMA 5ER4X 3VRPA 4YI9A 1A4PA 1IKUA 1B8RA 4YGAA 2NCPA 2JULA 2G9BA 5AERA 3I5HC 3AAKA 3WXAA 2WCEA 1YX8A 2FCEA 2JPTA 1EXRA 1CFDA 1QIWA 1QVIY 1LA3A 3IF7A 4PHJA 1LINA 3O6BA 1J7QA 5KU1A 3EVUA 2KI4C 1R6PA 1U5IB 4PE1A 1CFFA 1S36A 1QTXA 4PALA 2GGMA 4WRIA 2LLUA 4I5JA 1A75A 4UPGA 1PVBA 2KAXA 4HREE 4WQ2A 1S5GZ 5J3XA 1S1EA 3DD4A 5AFPA 1RECA 1EG3A 1IG5A 1MQ1A 1L2OB 1J7RA 1NP8A 1XK4A 2WCFA 3RLZA 4DIRA 1ZOTB 2LVJA 3LL8B 4M2OA 5G08A 3ZWHA 1F8HA 1AVSA 3A8RA 4A4CA 3DVMA 1J1DA 1KFUS 2L4IA 1JSAA 3ZNIA 3BUOB 2MLFC 1K94A 1CMGA 3I5FB 3K21A 1WDCC 5HKYA 2NCOA 1BT6A 4DCKA 5D69A 2TN4A 2FJUB 2M97A 1ALVA 2KQYA 2LANA 1K96A 2EC6C 2LP2A 2M7LA 2LLSA 2CT9A 2O5GA 2NLNA 1RJVA 2SASA 1CTRA 1TRFA 1XK4C 1GQMA 1NSHA 1SNLA 1IJ6A 2LVIA 1RFJA 1J55A 1V1GA 3CLNA 1AJ5A 2F2PA 1PALA 1KK7Y 2JXLA 1M63B 1BG1A 3PFVA 1N65A 2JT3A 2KI6D 1DJGA 2LHIA 1SCVA 1DTLA 2EGDA 4PHNA 1R2UA 2KHNA 2MJWB 1FI6A 1TIZA 2LUCA 4HRGA 4YGEB 1PK0D 3M0WA 4E68A 1PRWA 1S26D 1B8LA 1BR4B 3FWBA 4BY4A 5AANA 1SY9A 3TDIA 2L0PA 3LK1A 2L4HA 1TTXA 1QX2A 2PASA 4YRUA 3PLFB 2HPSA 2JNFA 1NX2A 1XA5A 4ORCB 1NCZA 2F3ZA 2LLTA 1SCMB 1RTP1 3TDUA 2KYFA 3VRQA 2ZN9A 2F3YA 2WOSA 2MBXA 1C7VA 4NDDA 2KGRA 2PRUA 2I7AA 1AHRA 1GJYA 4ORBB 1WLMA 2KQ6A 2LMUA 3ICBA 1BU3A 2K2AA 5I2LA 2FOTA 1IWQA 1F54A 1UHIA 3BXKA 4DRWA 1NUBA 2I18A 1SL9A 1ODBA 2KFGA 1KWOC 2KFFA 5CSNA 1L2OC 1OMVA 1QXPA 1PSRA 1CDLA 1OE9B 4GFTA 2M3WA 3C1VA 1TNXA 2JQ6A 3SG3A 1M31A 1X02A 5AXIA 1UHHA 1S5GY 4ZCUA 4MEWA 2JRFA 2MRDA 5JOLA 1N0YA 3NSIA 1QASA 3E3RA 3I5FC 3BOWB 1Q80A 3LCPC 1K9PA 3GK2A 3OX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE9 B;  1UUS A;  2KBI A;  3O2P A;  4XJK B;  2MAZ A;  2I2R E;  5ER5 A;  1FPW A;  4BY5 A;  2WND A;  1IQ5 A;  2OTG B;  1EG4 A;  2HF5 A;  3JTD B;  5HKZ A;  1TNQ A;  3EVR A;  1OZS A;  1BLQ A;  1CDM A;  3LLE A;  4M2P A;  2K7D A;  4PDZ A;  3JVT B;  2JXC A;  1RK9 A;  5B8I B;  1WRZ A;  1S6I A;  4OVN F;  2K0J A;  4GUK A;  1NX1 A;  4GPL B;  2ISD A;  1J1E A;  1AP4 A;  1FBV A;  1SK6 D;  4A4B A;  4YGB B;  3PN7 B;  4MSP A;  4M2Q A;  5DKQ A;  1MHO A;  1NCX A;  1LXF C;  5HYD A;  4MZK A;  1M39 A;  4MZL A;  3SG2 A;  4CFQ A;  1IQ3 A;  2QPT A;  3KF9 A;  3SJS A;  3NSL A;  3O4Y A;  1SCM C;  2MLE C;  1SL7 A;  3CS1 A;  2P6B B;  1FF1 A;  4MLW A;  3WHT B;  1TOP A;  5I2Q A;  2NZ0 A;  4U8D A;  1NCY A;  2M8U A;  2MHH A;  1F4Q A;  1DF0 B;  4XJK A;  3TUY B;  5DKN A;  1DGU A;  2ZKM X;  3F45 A;  4AOM A;  5JJG A;  1CDN A;  2Y5I A;  2K2F A;  2GV5 A;  2H61 A;  1QX7 A;  1DJX A;  2COL B;  2E6W A;  2BCB A;  2Y4Q A;  1QJT A;  2CXJ A;  3KO0 A;  3VRR A;  2G2B A;  3TZ1 A;  2ZND A;  1K9K A;  1QV0 A;  3DF0 B;  3EKJ A;  4IL1 A;  4OR9 B;  2DOQ A;  2LVK A;  5HLV A;  1LKJ A;  1QIV A;  5PAL A;  1KQM B;  2AAO A;  1ZMZ A;  4NQG A;  1CLM A;  2PMY A;  3SIA A;  1A2X A;  4JPZ B;  2LUX A;  1CLL A;  1G33 A;  1KK8 B;  1C7W A;  2BBN A;  1VRK A;  1TCO B;  2VRG A;  4PHM A;  1YUS A;  1TN4 A;  2LMT A;  1QX5 B;  1A29 A;  2OTG C;  1PSB A;  1AJ4 A;  1QAT A;  2MA2 A;  3I5G B;  4QJ5 B;  1CLB A;  2AUC A;  2H61 C;  1K9U A;  1UP5 A;  1B8C A;  3DVK A;  1EH2 A;  1GGZ A;  1U5I A;  1F4O A;  3JVT C;  1CFP A;  4MN0 A;  1QLK A;  2BCA A;  1FI5 A;  4JQ0 D;  2L50 A;  1RWY A;  1EJ3 A;  5I2O A;  1B1G A;  1DJH A;  4JWQ A;  1C07 A;  3OB1 B;  1QV1 A;  4GAO A;  2LM5 A;  2RGI A;  2JTZ A;  1DJI A;  1BOC A;  2KOT A;  1NPQ A;  2M7N A;  1DF0 A;  1XFU O;  3IQO A;  1MXE A;  1XFX O;  1JWD A;  3HX4 A;  3PN7 C;  1KFX S;  3FWC A;  3PM8 A;  4YGD B;  5BPJ A;  4GNK B;  2F2O A;  2M0R A;  4ICB A;  4PHK A;  1DVI A;  1Y0V H;  1B7T Z;  1Y1U A;  4C0K A;  3RM1 A;  2LMV A;  1DMO A;  2PVB A;  4Q04 A;  3PAL A;  4PCW A;  4OCI A;  1AK8 A;  1YTZ C;  3BUW B;  3DF0 A;  1SR6 B;  1LVC D;  1DJW A;  2KAV A;  1JF2 A;  2D8N A;  2L51 A;  1J7O A;  1YVH A;  1K2H A;  2K61 A;  3QRX A;  2KI4 B;  1DGV A;  2SCP A;  1BMO A;  4I5L B;  5IBW A;  1K8U A;  1SRA A;  2KGB C;  1ZAC A;  1YUU A;  2GGZ A;  3VRN A;  5CSI A;  3TUY C;  1OZO A;  1SBJ A;  1HT9 A;  3PAT A;  1Y1X A;  1DT7 B;  1MXL C;  4P5O E;  4GGF A;  1SMG A;  1M46 A;  3I5I B;  5HLO A;  1KCY A;  1AUI B;  3SIB A;  1CB1 A;  1WLZ A;  1YR5 A;  1ZUZ A;  1XFZ O;  2K7O A;  3OB2 B;  4C0J A;  1TNP A;  2B1U A;  4FTG A;  1J7P A;  1KQM C;  1BR1 B;  1NYA A;  2AMI A;  4NDB A;  2PAL A;  4HSZ A;  1S6C A;  4QJ4 B;  1WRL A;  3CR5 X;  1KK8 C;  2HET A;  3BUX B;  3FIA A;  1EL4 A;  2LV7 A;  3CGA A;  3KHE A;  1Y1A A;  3EKH A;  3SG6 A;  3VRO A;  5DKR A;  4XYN A;  2KDH A;  3VGO A;  1XVJ A;  3I5G C;  4GGF C;  3SG5 A;  2M29 A;  2KI6 C;  3D0Y B;  2ZFD A;  4CLN A;  1UUR A;  1OSA A;  4YI8 A;  5FYX A;  2BEC A;  1FW4 A;  3AAJ A;  2K7C A;  3BUM B;  5D7F A;  5KSZ A;  1B47 A;  1K95 A;  2HQ8 A;  5F6T A;  2IS9 A;  1JUO A;  1OQP A;  2KYC A;  4FQO A;  2LCP A;  1W7I B;  1V1F A;  1UHK A;  2CTN A;  1MF8 B;  2QAC A;  2CBL A;  2OS8 B;  2LC5 A;  2WOR A;  3WHU B;  1Y6W A;  4D1E A;  4TNC A;  4N1G A;  1ALW A;  4PE7 A;  4QJ3 B;  1IH0 A;  2ZRS A;  2BE6 A;  3A4U B;  2JC2 A;  3NXA A;  4NDC A;  3SG4 A;  2E30 A;  1F71 A;  1CKK A;  2NXQ A;  2LVV A;  3BOW A;  1K93 D;  2Q4U A;  2EHB A;  1IJ5 A;  4PE4 A;  2H2K A;  2JOJ A;  2ZRT A;  4GBA A;  1SR6 C;  2JZI A;  4ZCV A;  2LHL A;  5KTY A;  1YX7 A;  3GK1 A;  1ZFS A;  2JT0 A;  4GGN A;  1CM4 A;  1JF0 A;  4PE0 A;  1B7T Y;  5TNC A;  1UWO A;  3CTN A;  2K8M B;  1JFJ A;  1JFK A;  1OOJ A;  1H4B A;  1H8B A;  3CWG A;  2JT8 A;  1E8A A;  1W7J B;  1N2D A;  1KSM A;  3AKB A;  4MRY A;  3OHM B;  3SG7 A;  2K7B A;  1KWO B;  3GOF A;  4MRX A;  4N1F A;  3I5I C;  5HKW A;  3D0Y A;  2WC8 A;  1CNP A;  1MR8 A;  1QS7 A;  2PSR A;  2L2E A;  1S6J A;  3O78 A;  2WCB A;  4ETO A;  2I94 A;  3OP0 A;  1XO5 A;  4ORA B;  3LK0 A;  2HQW A;  3TS5 B;  3JTD C;  1SYM A;  4MBE A;  3DVJ A;  1G4Y R;  3NSO A;  1CFC A;  1SL8 A;  2BKH B;  1YRU B;  1F55 A;  3CR2 A;  1XFW O;  1HQV A;  1KSO A;  2BL0 B;  3AKA A;  1DJY A;  4C0L A;  2LNK A;  1YUR A;  4R1E A;  1TNW A;  2JNX A;  3IQQ A;  2FCD A;  2A4J A;  3CR4 X;  1IGV A;  1QVI Z;  3KPX A;  1KFU L;  3I5H B;  2OS8 C;  1CMF A;  2Q91 A;  3EK7 A;  1SPY A;  1A03 A;  2CNP A;  3EVV A;  1XFV O;  2L98 A;  3TDZ A;  4DUQ A;  1GGW A;  4CPV A;  2V53 A;  1IRJ A;  1NWD A;  5CSJ A;  4DS7 A;  1D1O A;  1NX3 A;  2ZNE A;  2KNE A;  1CM1 A;  1YUT A;  2JU0 A;  1B4C A;  4MZJ A;  1TCF A;  1SKT A;  4OKH A;  5GQQ C;  2LAP A;  5AEQ A;  3CZT X;  3WNX B;  2F33 A;  2JWW A;  4MVF A;  4CFR A;  1MUX A;  1JC2 A;  2M1K B;  3EK4 A;  1B9A A;  1KQV A;  4P2Y B;  2LP3 A;  1SW8 A;  4AQI A;  1NIW A;  3OX5 A;  4AQJ A;  5K89 A;  1UHN A;  2O60 A;  1K90 D;  3BQ3 A;  1BOD A;  1LA0 A;  2KBM A;  5I8N A;  1JBA A;  2OPO A;  3NSK A;  5CPV A;  4I5K A;  4OV2 A;  4USL A;  1DJZ A;  1WDC B;  2JTT A;  4WQ3 A;  3PSR A;  3D10 A;  4YGC B;  4N5X A;  2M1U A;  1OMR A;  3BYA A;  1A75 B;  1KK7 Z;  2EC6 B;  2M49 B;  1UHJ A;  1YRT B;  1NX0 A;  3GK4 X;  3TS5 C;  1KFX L;  3H4S E;  2L5X B;  4YBH B;  2KFH A;  3BUN B;  1CDP A;  1L7Z A;  1PVA A;  1WY9 A;  2CCM A;  1RRO A;  3MSE B;  1PUL A;  4F0Z B;  2BCX A;  2KSP A;  2ZN8 A;  3EK8 A;  1WRK A;  2BKI B;  1M45 A;  1F70 A;  1OMD A;  2BL0 C;  3DVE A;  2R2I A;  1S3P A;  4L9M A;  2M9G A;  2Y1M A;  1BF5 A;  1XFY O;  1BJF A;  5CSF A;  1G8I A;  4HRH A;  2KAY A;  1MWN A;  2F8P A;  4CID A;  1YVL A;  3FS7 A;  1QLS A;  3KEV A;  1XYD A;  2BE4 A;  2Y1N A;  3HCM A;  4I5N B;  2BBM A;  5ER4 X;  3VRP A;  4YI9 A;  1A4P A;  1IKU A;  1B8R A;  4YGA A;  2NCP A;  2JUL A;  2G9B A;  5AER A;  3I5H C;  3AAK A;  3WXA A;  2WCE A;  1YX8 A;  2FCE A;  2JPT A;  1EXR A;  1CFD A;  1QIW A;  1QVI Y;  1LA3 A;  3IF7 A;  4PHJ A;  1LIN A;  3O6B A;  1J7Q A;  5KU1 A;  3EVU A;  2KI4 C;  1R6P A;  1U5I B;  4PE1 A;  1CFF A;  1S36 A;  1QTX A;  4PAL A;  2GGM A;  4WRI A;  2LLU A;  4I5J A;  1A75 A;  4UPG A;  1PVB A;  2KAX A;  4HRE E;  4WQ2 A;  1S5G Z;  5J3X A;  1S1E A;  3DD4 A;  5AFP A;  1REC A;  1EG3 A;  1IG5 A;  1MQ1 A;  1L2O B;  1J7R A;  1NP8 A;  1XK4 A;  2WCF A;  3RLZ A;  4DIR A;  1ZOT B;  2LVJ A;  3LL8 B;  4M2O A;  5G08 A;  3ZWH A;  1F8H A;  1AVS A;  3A8R A;  4A4C A;  3DVM A;  1J1D A;  1KFU S;  2L4I A;  1JSA A;  3ZNI A;  3BUO B;  2MLF C;  1K94 A;  1CMG A;  3I5F B;  3K21 A;  1WDC C;  5HKY A;  2NCO A;  1BT6 A;  4DCK A;  5D69 A;  2TN4 A;  2FJU B;  2M97 A;  1ALV A;  2KQY A;  2LAN A;  1K96 A;  2EC6 C;  2LP2 A;  2M7L A;  2LLS A;  2CT9 A;  2O5G A;  2NLN A;  1RJV A;  2SAS A;  1CTR A;  1TRF A;  1XK4 C;  1GQM A;  1NSH A;  1SNL A;  1IJ6 A;  2LVI A;  1RFJ A;  1J55 A;  1V1G A;  3CLN A;  1AJ5 A;  2F2P A;  1PAL A;  1KK7 Y;  2JXL A;  1M63 B;  1BG1 A;  3PFV A;  1N65 A;  2JT3 A;  2KI6 D;  1DJG A;  2LHI A;  1SCV A;  1DTL A;  2EGD A;  4PHN A;  1R2U A;  2KHN A;  2MJW B;  1FI6 A;  1TIZ A;  2LUC A;  4HRG A;  4YGE B;  1PK0 D;  3M0W A;  4E68 A;  1PRW A;  1S26 D;  1B8L A;  1BR4 B;  3FWB A;  4BY4 A;  5AAN A;  1SY9 A;  3TDI A;  2L0P A;  3LK1 A;  2L4H A;  1TTX A;  1QX2 A;  2PAS A;  4YRU A;  3PLF B;  2HPS A;  2JNF A;  1NX2 A;  1XA5 A;  4ORC B;  1NCZ A;  2F3Z A;  2LLT A;  1SCM B;  1RTP 1;  3TDU A;  2KYF A;  3VRQ A;  2ZN9 A;  2F3Y A;  2WOS A;  2MBX A;  1C7V A;  4NDD A;  2KGR A;  2PRU A;  2I7A A;  1AHR A;  1GJY A;  4ORB B;  1WLM A;  2KQ6 A;  2LMU A;  3ICB A;  1BU3 A;  2K2A A;  5I2L A;  2FOT A;  1IWQ A;  1F54 A;  1UHI A;  3BXK A;  4DRW A;  1NUB A;  2I18 A;  1SL9 A;  1ODB A;  2KFG A;  1KWO C;  2KFF A;  5CSN A;  1L2O C;  1OMV A;  1QXP A;  1PSR A;  1CDL A;  1OE9 B;  4GFT A;  2M3W A;  3C1V A;  1TNX A;  2JQ6 A;  3SG3 A;  1M31 A;  1X02 A;  5AXI A;  1UHH A;  1S5G Y;  4ZCU A;  4MEW A;  2JRF A;  2MRD A;  5JOL A;  1N0Y A;  3NSI A;  1QAS A;  3E3R A;  3I5F C;  3BOW B;  1Q80 A;  3LCP C;  1K9P A;  3GK2 A;  3OX6 A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  1UUS A;  2KBI A;  3DY9 A;  3O2P A;  3N7H A;  2MAZ A;  2I2R E;  4XJK B;  5ER5 A;  1FPW A;  4BY5 A;  2WND A;  1IQ5 A;  2OTG B;  1EG4 A;  2HF5 A;  2FJY A;  3JTD B;  5HKZ A;  1TNQ A;  3Q8I A;  3EVR A;  1OZS A;  1BLQ A;  3B86 A;  1CDM A;  3LLE A;  4M2P A;  2K7D A;  4PDZ A;  3D75 A;  3JVT B;  2JXC A;  1RK9 A;  5B8I B;  1WRZ A;  3DYE A;  1S6I A;  4OVN F;  2K0J A;  4GUK A;  1NX1 A;  4GPL B;  2ISD A;  1J1E A;  2BAP A;  1AP4 A;  1FBV A;  3NGV A;  1SK6 D;  4A4B A;  4YGB B;  3PN7 B;  4MSP A;  5I94 A;  4M2Q A;  5DKQ A;  1MHO A;  3D74 A;  2L5Y A;  1NCX A;  1LXF C;  5HYD A;  4MZK A;  1M39 A;  4MZL A;  3SG2 A;  4CFQ A;  1IQ3 A;  2QPT A;  3KF9 A;  3D73 A;  3SJS A;  3NSL A;  3O4Y A;  1SCM C;  2MLE C;  3O4X A;  1SL7 A;  3CS1 A;  1QWV A;  2P6B B;  1FF1 A;  4MLW A;  3WHT B;  1TOP A;  5FI2 A;  2NZ0 A;  4U8D A;  1NCY A;  5I2Q A;  2M8U A;  2MHH A;  1F4Q A;  2WCK A;  3CAB A;  1DF0 B;  4XJK A;  3CYZ A;  3FE9 A;  3TUY B;  5DKN A;  1DGU A;  2ZKM X;  3F45 A;  4AOM A;  3UO9 A;  3D77 A;  5JJG A;  2Y5I A;  1CDN A;  2K2F A;  2GV5 A;  2H61 A;  1QX7 A;  1DJX A;  2COL B;  2E6W A;  2BCB A;  2Y4Q A;  1QJT A;  2CXJ A;  2P71 A;  3KO0 A;  3VRR A;  2G2B A;  3TZ1 A;  2ZND A;  1K9K A;  1QV0 A;  3DF0 B;  3EKJ A;  4IL1 A;  4JD9 A;  2DOQ A;  2LVK A;  2WCJ A;  1LKJ A;  1QIV A;  5HLV A;  1KQM B;  5PAL A;  2AAO A;  1ZMZ A;  4NQG A;  1CLM A;  2PMY A;  3SIA A;  1A2X A;  4JPZ B;  2LUX A;  1CLL A;  1G33 A;  1KK8 B;  1C7W A;  3R72 A;  2ERB A;  2BBN A;  1VRK A;  1TCO B;  2VRG A;  4PHM A;  1YUS A;  1TN4 A;  2LMT A;  1QX5 B;  3L47 A;  1A29 A;  2OTG C;  3S0A A;  1PSB A;  1AJ4 A;  1QAT A;  2MA2 A;  3R1P A;  3I5G B;  4QJ5 B;  1CLB A;  2AUC A;  2H61 C;  1K9U A;  1UP5 A;  1B8C A;  3DVK A;  1EH2 A;  1GGZ A;  1U5I A;  1F4O A;  1SSE B;  3JVT C;  3PJI A;  4MN0 A;  1CFP A;  1QLK A;  2BCA A;  3FE6 A;  1FI5 A;  4JQ0 D;  2L50 A;  1RWY A;  1EJ3 A;  2WCH A;  5I2O A;  1DJH A;  4JWQ A;  1B1G A;  3OB1 B;  1QV1 A;  1C07 A;  4GAO A;  2LM5 A;  2RGI A;  2JTZ A;  1DJI A;  1BOC A;  2KOT A;  1NPQ A;  2M7N A;  1DF0 A;  2GTE A;  1XFU O;  3IQO A;  1MXE A;  1XFX O;  1JWD A;  3HX4 A;  3PN7 C;  3S0B A;  2WC6 A;  1KFX S;  1T14 A;  1ORG A;  3FWC A;  3PM8 A;  4YGD B;  5BPJ A;  4GNK B;  4FQT A;  3B87 A;  2F2O A;  2M0R A;  4ICB A;  4PHK A;  1DVI A;  1Y0V H;  1B7T Z;  1Y1U A;  4C0K A;  3RM1 A;  2LMV A;  4OR9 B;  1DMO A;  2PVB A;  3L4A A;  4Q04 A;  3PAL A;  4PCW A;  4OCI A;  2WCM A;  2WC5 A;  1YTZ C;  3BUW B;  3DF0 A;  1AK8 A;  1SR6 B;  1LVC D;  1DJW A;  2KAV A;  3R1V A;  1JF2 A;  2D8N A;  2L51 A;  1J7O A;  1YVH A;  1OOF A;  1K2H A;  1C3Z A;  2K61 A;  3QRX A;  2KI4 B;  1DGV A;  2SCP A;  1BMO A;  4I5L B;  5IBW A;  1K8U A;  1SRA A;  2KGB C;  1ZAC A;  1YUU A;  2GGZ A;  3VRN A;  5CSI A;  3TUY C;  1OZO A;  1SBJ A;  1HT9 A;  3PAT A;  1Y1X A;  1DEL A;  1DT7 B;  1MXL C;  4P5O E;  4GGF A;  1SMG A;  1M46 A;  3I5I B;  5HLO A;  1KCY A;  1AUI B;  3SIB A;  1DQE A;  1CB1 A;  1WLZ A;  1Z4H A;  1YR5 A;  1ZUZ A;  1XFZ O;  2K7O A;  3OB2 B;  1OOI X;  1TNP A;  1TUJ A;  2B1U A;  4FTG A;  4C0J A;  1J7P A;  1KQM C;  1BR1 B;  1NYA A;  2AMI A;  4NDB A;  2PAL A;  4HSZ A;  1S6C A;  3SS3 A;  4QJ4 B;  1WRL A;  3CR5 X;  1KK8 C;  2HET A;  3BUX B;  3FIA A;  1EL4 A;  2LV7 A;  3CGA A;  3KHE A;  1Y1A A;  3EKH A;  3SG6 A;  3VRO A;  5DKR A;  4XYN A;  2KDH A;  3VGO A;  1XVJ A;  3I5G C;  4GGF C;  3SG5 A;  2M29 A;  2H8V A;  2KI6 C;  3D0Y B;  2ZFD A;  4CLN A;  1UUR A;  1OSA A;  4YI8 A;  5FYX A;  1LS8 A;  2BEC A;  1FW4 A;  3AAJ A;  2K7C A;  3BUM B;  5D7F A;  2QEB A;  3S0E A;  5KSZ A;  1B47 A;  1K95 A;  2HQ8 A;  5F6T A;  2IS9 A;  1JUO A;  1OQP A;  2KYC A;  4FQO A;  2P70 A;  2LCP A;  1W7I B;  1V1F A;  1UHK A;  2CTN A;  1MF8 B;  2KLE A;  2QAC A;  2CBL A;  2OS8 B;  2LC5 A;  2WOR A;  3WHU B;  3RZS A;  1W9Z A;  1Y6W A;  3QME A;  4TNC A;  4D1E A;  4N1G A;  1ALW A;  4PE7 A;  4QJ3 B;  1IH0 A;  2ZRS A;  2PQL A;  2BE6 A;  3A4U B;  2JC2 A;  3NHT A;  3NXA A;  4NDC A;  3SG4 A;  2E30 A;  1F71 A;  1CKK A;  2NXQ A;  2LVV A;  4INX A;  3BOW A;  1K93 D;  2Q4U A;  2EHB A;  1IJ5 A;  4PE4 A;  2H2K A;  2JOJ A;  2ZRT A;  4GBA A;  3CZ0 A;  1SR6 C;  2JZI A;  4ZCV A;  2LHL A;  5KTY A;  1YX7 A;  3GK1 A;  1ZFS A;  2JT0 A;  4GGN A;  1CM4 A;  1JF0 A;  4PE0 A;  1B7T Y;  5FI7 A;  1UWO A;  5TNC A;  3CTN A;  2K8M B;  2QEV A;  1JFJ A;  1JFK A;  5EL2 A;  1OOJ A;  1H4B A;  1H8B A;  3CWG A;  2JT8 A;  1E8A A;  1W7J B;  1N2D A;  1KSM A;  3AKB A;  3NHI A;  1OOG A;  2KPH A;  4MRY A;  3OHM B;  3SG7 A;  2K7B A;  1KWO B;  3GOF A;  4MRX A;  4N1F A;  3I5I C;  5HKW A;  3CDN A;  2WC8 A;  3D0Y A;  1MR8 A;  1CNP A;  1QS7 A;  2PSR A;  2L2E A;  1S6J A;  3O78 A;  2WCB A;  1XFR A;  4ETO A;  2I94 A;  3S0F A;  3OGN A;  1XO5 A;  3OP0 A;  3LK0 A;  2HQW A;  4ORA B;  3TS5 B;  3JTD C;  3BFB A;  1SYM A;  2JPO A;  4JKT A;  4MBE A;  3DVJ A;  1G4Y R;  3NSO A;  1CFC A;  3CZ2 A;  1SL8 A;  2BKH B;  1YRU B;  2WCL A;  1F55 A;  3CR2 A;  1XFW O;  3UNW A;  1HQV A;  1KSO A;  2BL0 B;  3AKA A;  1DJY A;  4C0L A;  2LNK A;  4F7F A;  1YUR A;  4R1E A;  1TNW A;  2JNX A;  3IQQ A;  2FCD A;  2A4J A;  2K60 A;  3CR4 X;  1IGV A;  1P28 A;  1QVI Z;  3KPX A;  2QDI A;  3B88 A;  1KFU L;  3I5H B;  2OS8 C;  1CMF A;  2Q91 A;  3EK7 A;  1SPY A;  1A03 A;  2CNP A;  3EVV A;  1XFV O;  2L98 A;  3TDZ A;  4DUQ A;  1GGW A;  4CPV A;  2V53 A;  1IRJ A;  3D78 A;  1NWD A;  4INW A;  5CSJ A;  4DS7 A;  1D1O A;  1NX3 A;  2ZNE A;  2KNE A;  1CM1 A;  1YUT A;  2JU0 A;  1B4C A;  4MZJ A;  1TCF A;  1SKT A;  4OKH A;  5GQQ C;  2LAP A;  5AEQ A;  3CZT X;  3WNX B;  2F33 A;  2JWW A;  3DZT A;  4MVF A;  4CFR A;  1MUX A;  1JC2 A;  3IVT A;  2M1K B;  3EK4 A;  1B9A A;  1KQV A;  4P2Y B;  2LP3 A;  1SW8 A;  3B6X A;  5DIC A;  4AQI A;  1NIW A;  3OX5 A;  3BJH A;  4AQJ A;  3S0G A;  5K89 A;  1UHN A;  2O60 A;  1DC1 A;  1K90 D;  3BQ3 A;  1BOD A;  1LA0 A;  3K1E A;  5HL1 A;  2KBM A;  5I8N A;  1JBA A;  2OPO A;  3NSK A;  5CPV A;  4I5K A;  4OV2 A;  4USL A;  1DJZ A;  1WDC B;  2JTT A;  4WQ3 A;  3PSR A;  3D10 A;  4YGC B;  4N5X A;  1GM0 A;  1IIO A;  2M1U A;  1OMR A;  3BYA A;  1A75 B;  1KK7 Z;  2EC6 B;  2M49 B;  1UHJ A;  3OBV A;  1YRT B;  1NX0 A;  3GK4 X;  3TS5 C;  1KFX L;  3H4S E;  2L5X B;  4YBH B;  2KFH A;  3BUN B;  1CDP A;  1L7Z A;  1PVA A;  1WY9 A;  2CCM A;  1RRO A;  3MSE B;  3D76 A;  1PUL A;  4F0Z B;  2BCX A;  2KSP A;  2ZN8 A;  3EK8 A;  1WRK A;  2BKI B;  1M45 A;  1F70 A;  1OMD A;  2BL0 C;  3DVE A;  2R2I A;  1S3P A;  4L9M A;  2M9G A;  2Y1M A;  1BF5 A;  1XFY O;  1BJF A;  5CSF A;  1G8I A;  2KLD A;  2KAY A;  4HRH A;  1MWN A;  2F8P A;  3V2L A;  4CID A;  1YVL A;  3FS7 A;  1QLS A;  3KEV A;  1XYD A;  2BE4 A;  2Y1N A;  3HCM A;  4I5N B;  2BBM A;  5ER4 X;  3VRP A;  4YI9 A;  1A4P A;  1OW4 A;  1IKU A;  1B8R A;  4YGA A;  2NCP A;  1DEK A;  2JUL A;  2G9B A;  5AER A;  3I5H C;  3AAK A;  3WXA A;  4OZD A;  2WCE A;  1YX8 A;  2PYQ A;  2QEO A;  2FCE A;  2JPT A;  1EXR A;  1CFD A;  1QIW A;  1QVI Y;  1LA3 A;  3CZ1 A;  3IF7 A;  4PHJ A;  1C3Y A;  1LIN A;  3O6B A;  1J7Q A;  5KU1 A;  3EVU A;  2KI4 C;  1R6P A;  1U5I B;  2BNX A;  4PE1 A;  1CFF A;  1S36 A;  1QTX A;  4PAL A;  2L2C A;  2GGM A;  4WRI A;  2LLU A;  3BFH A;  1A75 A;  4I5J A;  4UPG A;  1PVB A;  2KAX A;  4HRE E;  4WQ2 A;  1S5G Z;  5J3X A;  1S1E A;  3DD4 A;  5AFP A;  1REC A;  1EG3 A;  1IG5 A;  1MQ1 A;  1L2O B;  1J7R A;  1NP8 A;  1XK4 A;  2QEH A;  2WCF A;  3RLZ A;  4DIR A;  1ZOT B;  2LVJ A;  3FE8 A;  3LL8 B;  4M2O A;  5G08 A;  3ZWH A;  1F8H A;  1AVS A;  3A8R A;  3SS4 A;  3R1O A;  4A4C A;  3DVM A;  1J1D A;  1KFU S;  2L4I A;  1JSA A;  3ZNI A;  3BUO B;  2MLF C;  1K94 A;  1CMG A;  3I5F B;  3K21 A;  1WDC C;  5HKY A;  2NCO A;  1BT6 A;  1TWO A;  4DCK A;  5D69 A;  2TN4 A;  2FJU B;  2M97 A;  1ALV A;  2KQY A;  2LAN A;  1K96 A;  2EC6 C;  3L4L A;  2LP2 A;  3PM2 A;  2M7L A;  2LLS A;  2CT9 A;  2O5G A;  2NLN A;  1RJV A;  2SAS A;  1CTR A;  4PT1 A;  1TRF A;  1XK4 C;  1GQM A;  1NSH A;  1SNL A;  1IJ6 A;  2LVI A;  1RFJ A;  1J55 A;  1V1G A;  3CLN A;  1AJ5 A;  1TUZ A;  2F2P A;  1PAL A;  1KK7 Y;  2JXL A;  1M63 B;  1Z2C B;  4KYN A;  1BG1 A;  3PFV A;  1N65 A;  2JT3 A;  2KI6 D;  1DJG A;  2LHI A;  1SCV A;  1DTL A;  2EGD A;  4PHN A;  1R2U A;  2KHN A;  2MJW B;  3BFA A;  1TIZ A;  2LUC A;  1FI6 A;  4HRG A;  4YGE B;  1PK0 D;  3M0W A;  4E68 A;  1PRW A;  1S26 D;  1B8L A;  1BR4 B;  3FWB A;  4BY4 A;  5AAN A;  1SY9 A;  3TDI A;  2L0P A;  3LK1 A;  2L4H A;  5FI6 A;  1TTX A;  1QX2 A;  2PAS A;  4YRU A;  3PLF B;  3VB1 A;  2HPS A;  2JNF A;  1NX2 A;  1XA5 A;  4ORC B;  1NCZ A;  2YGU A;  2F3Z A;  2LLT A;  1SCM B;  1RTP 1;  3TDU A;  2KYF A;  3VRQ A;  2ZN9 A;  2F3Y A;  2WOS A;  2MBX A;  1C7V A;  4NDD A;  2KGR A;  2PRU A;  2I7A A;  1AHR A;  5D3O A;  3S0D A;  1GJY A;  4ORB B;  1WLM A;  2KQ6 A;  2LMU A;  3ICB A;  1BU3 A;  2K2A A;  5I2L A;  2FOT A;  1IWQ A;  1F54 A;  1UHI A;  3BXK A;  4DRW A;  1NUB A;  2I18 A;  1SL9 A;  1ODB A;  2KFG A;  1KWO C;  2KFF A;  1OOH A;  5CSN A;  1L2O C;  1OMV A;  1QXP A;  1PSR A;  1CDL A;  1OE9 B;  4GFT A;  2M3W A;  4IJ7 A;  3C1V A;  1TNX A;  2JQ6 A;  3SG3 A;  1M31 A;  1X02 A;  3B7A A;  5AXI A;  1UHH A;  3EG5 B;  1S5G Y;  4ZCU A;  3SS5 A;  4MEW A;  2JRF A;  2MRD A;  5JOL A;  1N0Y A;  3NSI A;  1QAS A;  3E3R A;  3I5F C;  3BOW B;  1Q80 A;  3LCP C;  1K9P A;  3GK2 A;  3DXL A;  3OX6 A; 
#chains in the Genus database with same CATH homology
 2LE9 B;  1UUS A;  2KBI A;  3O2P A;  4XJK B;  2MAZ A;  2I2R E;  5ER5 A;  1FPW A;  4BY5 A;  2WND A;  1IQ5 A;  2OTG B;  1EG4 A;  2HF5 A;  3JTD B;  5HKZ A;  1TNQ A;  3EVR A;  1OZS A;  1BLQ A;  1CDM A;  3LLE A;  4M2P A;  2K7D A;  4PDZ A;  3JVT B;  2JXC A;  1RK9 A;  5B8I B;  1WRZ A;  1S6I A;  4OVN F;  2K0J A;  4GUK A;  1NX1 A;  4GPL B;  2ISD A;  1J1E A;  1AP4 A;  1FBV A;  1SK6 D;  4A4B A;  4YGB B;  3PN7 B;  4MSP A;  4M2Q A;  5DKQ A;  1MHO A;  1NCX A;  1LXF C;  5HYD A;  4MZK A;  1M39 A;  4MZL A;  3SG2 A;  4CFQ A;  1IQ3 A;  2QPT A;  3KF9 A;  3SJS A;  3NSL A;  3O4Y A;  1SCM C;  2MLE C;  1SL7 A;  3CS1 A;  2P6B B;  1FF1 A;  4MLW A;  3WHT B;  1TOP A;  5I2Q A;  2NZ0 A;  4U8D A;  1NCY A;  2M8U A;  2MHH A;  1F4Q A;  1DF0 B;  4XJK A;  3TUY B;  5DKN A;  1DGU A;  2ZKM X;  3F45 A;  4AOM A;  5JJG A;  1CDN A;  2Y5I A;  2K2F A;  2GV5 A;  2H61 A;  1QX7 A;  1DJX A;  2COL B;  2E6W A;  2BCB A;  2Y4Q A;  1QJT A;  2CXJ A;  3KO0 A;  3VRR A;  2G2B A;  3TZ1 A;  2ZND A;  1K9K A;  1QV0 A;  3DF0 B;  3EKJ A;  4IL1 A;  4OR9 B;  2DOQ A;  2LVK A;  5HLV A;  1LKJ A;  1QIV A;  5PAL A;  1KQM B;  2AAO A;  1ZMZ A;  4NQG A;  1CLM A;  2PMY A;  3SIA A;  1A2X A;  4JPZ B;  2LUX A;  1CLL A;  1G33 A;  1KK8 B;  1C7W A;  2BBN A;  1VRK A;  1TCO B;  2VRG A;  4PHM A;  1YUS A;  1TN4 A;  2LMT A;  1QX5 B;  1A29 A;  2OTG C;  1PSB A;  1AJ4 A;  1QAT A;  2MA2 A;  3I5G B;  4QJ5 B;  1CLB A;  2AUC A;  2H61 C;  1K9U A;  1UP5 A;  1B8C A;  3DVK A;  1EH2 A;  1GGZ A;  1U5I A;  1F4O A;  3JVT C;  1CFP A;  4MN0 A;  1QLK A;  2BCA A;  1FI5 A;  4JQ0 D;  2L50 A;  1RWY A;  1EJ3 A;  5I2O A;  1B1G A;  1DJH A;  4JWQ A;  1C07 A;  3OB1 B;  1QV1 A;  4GAO A;  2LM5 A;  2RGI A;  2JTZ A;  1DJI A;  1BOC A;  2KOT A;  1NPQ A;  2M7N A;  1DF0 A;  1XFU O;  3IQO A;  1MXE A;  1XFX O;  1JWD A;  3HX4 A;  3PN7 C;  1KFX S;  3FWC A;  3PM8 A;  4YGD B;  5BPJ A;  4GNK B;  2F2O A;  2M0R A;  4ICB A;  4PHK A;  1DVI A;  1Y0V H;  1B7T Z;  1Y1U A;  4C0K A;  3RM1 A;  2LMV A;  1DMO A;  2PVB A;  4Q04 A;  3PAL A;  4PCW A;  4OCI A;  1AK8 A;  1YTZ C;  3BUW B;  3DF0 A;  1SR6 B;  1LVC D;  1DJW A;  2KAV A;  1JF2 A;  2D8N A;  2L51 A;  1J7O A;  1YVH A;  1K2H A;  2K61 A;  3QRX A;  2KI4 B;  1DGV A;  2SCP A;  1BMO A;  4I5L B;  5IBW A;  1K8U A;  1SRA A;  2KGB C;  1ZAC A;  1YUU A;  2GGZ A;  3VRN A;  5CSI A;  3TUY C;  1OZO A;  1SBJ A;  1HT9 A;  3PAT A;  1Y1X A;  1DT7 B;  1MXL C;  4P5O E;  4GGF A;  1SMG A;  1M46 A;  3I5I B;  5HLO A;  1KCY A;  1AUI B;  3SIB A;  1CB1 A;  1WLZ A;  1YR5 A;  1ZUZ A;  1XFZ O;  2K7O A;  3OB2 B;  4C0J A;  1TNP A;  2B1U A;  4FTG A;  1J7P A;  1KQM C;  1BR1 B;  1NYA A;  2AMI A;  4NDB A;  2PAL A;  4HSZ A;  1S6C A;  4QJ4 B;  1WRL A;  3CR5 X;  1KK8 C;  2HET A;  3BUX B;  3FIA A;  1EL4 A;  2LV7 A;  3CGA A;  3KHE A;  1Y1A A;  3EKH A;  3SG6 A;  3VRO A;  5DKR A;  4XYN A;  2KDH A;  3VGO A;  1XVJ A;  3I5G C;  4GGF C;  3SG5 A;  2M29 A;  2KI6 C;  3D0Y B;  2ZFD A;  4CLN A;  1UUR A;  1OSA A;  4YI8 A;  5FYX A;  2BEC A;  1FW4 A;  3AAJ A;  2K7C A;  3BUM B;  5D7F A;  5KSZ A;  1B47 A;  1K95 A;  2HQ8 A;  5F6T A;  2IS9 A;  1JUO A;  1OQP A;  2KYC A;  4FQO A;  2LCP A;  1W7I B;  1V1F A;  1UHK A;  2CTN A;  1MF8 B;  2QAC A;  2CBL A;  2OS8 B;  2LC5 A;  2WOR A;  3WHU B;  1Y6W A;  4D1E A;  4TNC A;  4N1G A;  1ALW A;  4PE7 A;  4QJ3 B;  1IH0 A;  2ZRS A;  2BE6 A;  3A4U B;  2JC2 A;  3NXA A;  4NDC A;  3SG4 A;  2E30 A;  1F71 A;  1CKK A;  2NXQ A;  2LVV A;  3BOW A;  1K93 D;  2Q4U A;  2EHB A;  1IJ5 A;  4PE4 A;  2H2K A;  2JOJ A;  2ZRT A;  4GBA A;  1SR6 C;  2JZI A;  4ZCV A;  2LHL A;  5KTY A;  1YX7 A;  3GK1 A;  1ZFS A;  2JT0 A;  4GGN A;  1CM4 A;  1JF0 A;  4PE0 A;  1B7T Y;  5TNC A;  1UWO A;  3CTN A;  2K8M B;  1JFJ A;  1JFK A;  1OOJ A;  1H4B A;  1H8B A;  3CWG A;  2JT8 A;  1E8A A;  1W7J B;  1N2D A;  1KSM A;  3AKB A;  4MRY A;  3OHM B;  3SG7 A;  2K7B A;  1KWO B;  3GOF A;  4MRX A;  4N1F A;  3I5I C;  5HKW A;  3D0Y A;  2WC8 A;  1CNP A;  1MR8 A;  1QS7 A;  2PSR A;  2L2E A;  1S6J A;  3O78 A;  2WCB A;  4ETO A;  2I94 A;  3OP0 A;  1XO5 A;  4ORA B;  3LK0 A;  2HQW A;  3TS5 B;  3JTD C;  1SYM A;  4MBE A;  3DVJ A;  1G4Y R;  3NSO A;  1CFC A;  1SL8 A;  2BKH B;  1YRU B;  1F55 A;  3CR2 A;  1XFW O;  1HQV A;  1KSO A;  2BL0 B;  3AKA A;  1DJY A;  4C0L A;  2LNK A;  1YUR A;  4R1E A;  1TNW A;  2JNX A;  3IQQ A;  2FCD A;  2A4J A;  3CR4 X;  1IGV A;  1QVI Z;  3KPX A;  1KFU L;  3I5H B;  2OS8 C;  1CMF A;  2Q91 A;  3EK7 A;  1SPY A;  1A03 A;  2CNP A;  3EVV A;  1XFV O;  2L98 A;  3TDZ A;  4DUQ A;  1GGW A;  4CPV A;  2V53 A;  1IRJ A;  1NWD A;  5CSJ A;  4DS7 A;  1D1O A;  1NX3 A;  2ZNE A;  2KNE A;  1CM1 A;  1YUT A;  2JU0 A;  1B4C A;  4MZJ A;  1TCF A;  1SKT A;  4OKH A;  5GQQ C;  2LAP A;  5AEQ A;  3CZT X;  3WNX B;  2F33 A;  2JWW A;  4MVF A;  4CFR A;  1MUX A;  1JC2 A;  2M1K B;  3EK4 A;  1B9A A;  1KQV A;  4P2Y B;  2LP3 A;  1SW8 A;  4AQI A;  1NIW A;  3OX5 A;  4AQJ A;  5K89 A;  1UHN A;  2O60 A;  1K90 D;  3BQ3 A;  1BOD A;  1LA0 A;  2KBM A;  5I8N A;  1JBA A;  2OPO A;  3NSK A;  5CPV A;  4I5K A;  4OV2 A;  4USL A;  1DJZ A;  1WDC B;  2JTT A;  4WQ3 A;  3PSR A;  3D10 A;  4YGC B;  4N5X A;  2M1U A;  1OMR A;  3BYA A;  1A75 B;  1KK7 Z;  2EC6 B;  2M49 B;  1UHJ A;  1YRT B;  1NX0 A;  3GK4 X;  3TS5 C;  1KFX L;  3H4S E;  2L5X B;  4YBH B;  2KFH A;  3BUN B;  1CDP A;  1L7Z A;  1PVA A;  1WY9 A;  2CCM A;  1RRO A;  3MSE B;  1PUL A;  4F0Z B;  2BCX A;  2KSP A;  2ZN8 A;  3EK8 A;  1WRK A;  2BKI B;  1M45 A;  1F70 A;  1OMD A;  2BL0 C;  3DVE A;  2R2I A;  1S3P A;  4L9M A;  2M9G A;  2Y1M A;  1BF5 A;  1XFY O;  1BJF A;  5CSF A;  1G8I A;  4HRH A;  2KAY A;  1MWN A;  2F8P A;  4CID A;  1YVL A;  3FS7 A;  1QLS A;  3KEV A;  1XYD A;  2BE4 A;  2Y1N A;  3HCM A;  4I5N B;  2BBM A;  5ER4 X;  3VRP A;  4YI9 A;  1A4P A;  1IKU A;  1B8R A;  4YGA A;  2NCP A;  2JUL A;  2G9B A;  5AER A;  3I5H C;  3AAK A;  3WXA A;  2WCE A;  1YX8 A;  2FCE A;  2JPT A;  1EXR A;  1CFD A;  1QIW A;  1QVI Y;  1LA3 A;  3IF7 A;  4PHJ A;  1LIN A;  3O6B A;  1J7Q A;  5KU1 A;  3EVU A;  2KI4 C;  1R6P A;  1U5I B;  4PE1 A;  1CFF A;  1S36 A;  1QTX A;  4PAL A;  2GGM A;  4WRI A;  2LLU A;  4I5J A;  1A75 A;  4UPG A;  1PVB A;  2KAX A;  4HRE E;  4WQ2 A;  1S5G Z;  5J3X A;  1S1E A;  3DD4 A;  5AFP A;  1REC A;  1EG3 A;  1IG5 A;  1MQ1 A;  1L2O B;  1J7R A;  1NP8 A;  1XK4 A;  2WCF A;  3RLZ A;  4DIR A;  1ZOT B;  2LVJ A;  3LL8 B;  4M2O A;  5G08 A;  3ZWH A;  1F8H A;  1AVS A;  3A8R A;  4A4C A;  3DVM A;  1J1D A;  1KFU S;  2L4I A;  1JSA A;  3ZNI A;  3BUO B;  2MLF C;  1K94 A;  1CMG A;  3I5F B;  3K21 A;  1WDC C;  5HKY A;  2NCO A;  1BT6 A;  4DCK A;  5D69 A;  2TN4 A;  2FJU B;  2M97 A;  1ALV A;  2KQY A;  2LAN A;  1K96 A;  2EC6 C;  2LP2 A;  2M7L A;  2LLS A;  2CT9 A;  2O5G A;  2NLN A;  1RJV A;  2SAS A;  1CTR A;  1TRF A;  1XK4 C;  1GQM A;  1NSH A;  1SNL A;  1IJ6 A;  2LVI A;  1RFJ A;  1J55 A;  1V1G A;  3CLN A;  1AJ5 A;  2F2P A;  1PAL A;  1KK7 Y;  2JXL A;  1M63 B;  1BG1 A;  3PFV A;  1N65 A;  2JT3 A;  2KI6 D;  1DJG A;  2LHI A;  1SCV A;  1DTL A;  2EGD A;  4PHN A;  1R2U A;  2KHN A;  2MJW B;  1FI6 A;  1TIZ A;  2LUC A;  4HRG A;  4YGE B;  1PK0 D;  3M0W A;  4E68 A;  1PRW A;  1S26 D;  1B8L A;  1BR4 B;  3FWB A;  4BY4 A;  5AAN A;  1SY9 A;  3TDI A;  2L0P A;  3LK1 A;  2L4H A;  1TTX A;  1QX2 A;  2PAS A;  4YRU A;  3PLF B;  2HPS A;  2JNF A;  1NX2 A;  1XA5 A;  4ORC B;  1NCZ A;  2F3Z A;  2LLT A;  1SCM B;  1RTP 1;  3TDU A;  2KYF A;  3VRQ A;  2ZN9 A;  2F3Y A;  2WOS A;  2MBX A;  1C7V A;  4NDD A;  2KGR A;  2PRU A;  2I7A A;  1AHR A;  1GJY A;  4ORB B;  1WLM A;  2KQ6 A;  2LMU A;  3ICB A;  1BU3 A;  2K2A A;  5I2L A;  2FOT A;  1IWQ A;  1F54 A;  1UHI A;  3BXK A;  4DRW A;  1NUB A;  2I18 A;  1SL9 A;  1ODB A;  2KFG A;  1KWO C;  2KFF A;  5CSN A;  1L2O C;  1OMV A;  1QXP A;  1PSR A;  1CDL A;  1OE9 B;  4GFT A;  2M3W A;  3C1V A;  1TNX A;  2JQ6 A;  3SG3 A;  1M31 A;  1X02 A;  5AXI A;  1UHH A;  1S5G Y;  4ZCU A;  4MEW A;  2JRF A;  2MRD A;  5JOL A;  1N0Y A;  3NSI A;  1QAS A;  3E3R A;  3I5F C;  3BOW B;  1Q80 A;  3LCP C;  1K9P A;  3GK2 A;  3OX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...