1H4BA

Solution structure of the birch pollen allergen bet v 4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLCALCIN BET V 4
publication title Solution Structure, Dynamics, and Hydrodynamics of the Calcium-Bound Cross-Reactive Birch Pollen Allergen Bet V 4 Reveal a Canonical Monomeric Two EF-Hand Assembly with a Regulatory Function
pubmed doi rcsb
source organism Betula verrucosa
molecule tags Allergen
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h4bA00
1Y6WA 2K7OA 1WLMA 3CS1A 4DUQA 1K9KA 2CT9A 1EG3A 1U5IA 3DVMA 3CLNA 1UWOA 4YGBB 2JZIA 1SW8A 2IS9A 1YUTA 2HF5A 3BOWA 3EVRA 4WQ3A 1M39A 3PN7B 1KQMC 2GV5A 4M2OA 1B47A 3SG6A 4F0ZB 2L50A 2JWWA 1UHIA 4YGAA 1QX7A 1TOPA 1SCMB 3A4UB 1CDNA 1UHHA 5HKYA 1BMOA 2NLNA 3EK7A 3EVUA 4GUKA 1NWDA 1LVCD 1BR4B 1QXPA 1QV1A 2KHNA 2LAPA 3BQ3A 5J3XA 2WCEA 1N65A 3BUNB 1DTLA 2D8NA 3KF9A 1F55A 1SR6B 2F3YA 4BY5A 3I5IC 1K2HA 1SBJA 3BUOB 2QPTA 4PALA 4XJKB 2M9GA 2O60A 5F6TA 5CPVA 5JJGA 1SMGA 2ZKMX 1YVLA 1UUSA 4DCKA 4DRWA 1W7JB 3IQOA 1CDLA 1S6JA 3AKBA 3OX5A 5AFPA 2EC6C 2CNPA 2NCOA 1CFDA 1AVSA 2KAXA 3GK2A 1CMFA 2F3ZA 4PHJA 1FPWA 3PFVA 3GOFA 4I5NB 3PM8A 3O4YA 3AAKA 1KQVA 2BCAA 2M7LA 1CFPA 4UPGA 2Q91A 1KK8C 1QVIZ 4HRGA 3DD4A 4NDDA 5B8IB 4QJ3B 1CDPA 3JTDC 4NQGA 2L0PA 2RGIA 3BXKA 3IQQA 1S6IA 1XA5A 3QRXA 1AJ5A 3I5GC 1K9UA 4MEWA 2KAYA 1YUUA 1QX2A 3NXAA 2HQ8A 2LLSA 3KHEA 1WRLA 1Q80A 4YI9A 2MBXA 1IRJA 1GQMA 1DJYA 2Y1MA 4HSZA 2BCBA 3TDUA 1QIWA 3HX4A 4GGFA 1SCVA 1PSBA 1DJGA 4I5JA 3VROA 4D1EA 2MHHA 3TUYC 4FTGA 1PRWA 1QIVA 5KSZA 3DF0B 3LK0A 1TTXA 2CBLA 1BOCA 2I94A 3VRNA 4HREE 3O2PA 1UHNA 2JULA 2JTZA 1JSAA 1KQMB 1TNPA 4A4CA 4U8DA 4PE7A 1A75B 2HPSA 3SG7A 2KI6C 4WQ2A 1NSHA 2ZNDA 4YGCB 5HLVA 1IJ5A 3SG5A 1IH0A 4MSPA 4ORCB 1YUSA 5KTYA 1J7QA 2LHLA 2CCMA 1PK0D 5KU1A 1JC2A 2MJWB 1S36A 3BUMB 1NUBA 2KAVA 2KYFA 2P6BB 1K9PA 1TRFA 1SNLA 2M8UA 1NCZA 4ETOA 2KYCA 3WNXB 3I5IB 1QV0A 2A4JA 2MA2A 2OTGC 1CTRA 1MWNA 1QASA 1EH2A 1OE9B 3MSEB 3I5FC 3NSKA 1K94A 4JWQA 3FIAA 2JU0A 1B4CA 3CR4X 4GNKB 5D69A 4GGNA 2LVKA 3EKJA 3NSLA 1WRZA 2LUXA 2EC6B 1F54A 1PSRA 1QJTA 5AXIA 2BL0C 5I2QA 4FQOA 2AUCA 2WCBA 2JXCA 1MF8B 2K7BA 1M31A 4M2PA 1MR8A 1D1OA 3FWCA 1KK8B 2KNEA 4OV2A 2FJUB 2LMUA 4NDBA 3SIAA 3PALA 1S5GY 3JTDB 1KFXL 1MXLC 1MXEA 2QACA 5JOLA 1NIWA 1SRAA 1V1FA 1KSOA 2ISDA 2JT8A 2L4HA 3I5GB 1WRKA 1DJXA 1BLQA 1CDMA 1NCYA 1OZSA 4GPLB 2L4IA 2JT3A 3GK1A 4GGFC 1SL8A 2JXLA 1AK8A 5DKNA 1NP8A 2LP3A 2M97A 2VRGA 4P5OE 1DJHA 1B7TY 1GGZA 3F45A 1EG4A 3BUXB 1DJIA 1CM4A 2KGRA 3WHTB 2LLTA 3FWBA 2K7DA 1J7RA 2FCDA 5AANA 2BCXA 1YTZC 3TDZA 2I2RE 1L2OC 5CSNA 1L7ZA 4PHNA 2LANA 1FF1A 1CM1A 2ZN9A 2EHBA 2JQ6A 1IQ5A 1LA0A 1LKJA 1ZUZA 1YRUB 1W7IB 2LVVA 5GQQC 1J55A 1RFJA 3A8RA 2G2BA 3TS5C 1K96A 3BUWB 1KK7Y 2BBNA 2Y4QA 4MZJA 5PALA 3KO0A 1CFFA 1LXFC 3WXAA 2LMVA 4GBAA 1MUXA 2WCFA 4YGDB 1R6PA 4OKHA 3VRQA 1PALA 5BPJA 4N5XA 4CFRA 2M1KB 2Y5IA 3FS7A 4PHMA 3H4SE 2FOTA 4C0KA 1UP5A 1X02A 1SPYA 1GJYA 1SYMA 3NSIA 4C0LA 1DVIA 2JPTA 1F4OA 2LP2A 2OTGB 3LL8B 3CWGA 5K89A 2K7CA 2COLB 3I5FB 3ZNIA 4OR9B 1XFVO 1QLSA 1XO5A 1BJFA 2NCPA 4TNCA 1IKUA 1SKTA 4AQJA 1CKKA 1DMOA 3OP0A 2R2IA 2MAZA 1H4BA 4ZCVA 1JF0A 2BL0B 1XFWO 2OPOA 1TIZA 1SL9A 2BE6A 2JRFA 2JNXA 2M29A 2OS8B 3AKAA 3OB1B 1KSMA 2LVIA 1WDCC 2MLEC 3TDIA 4AOMA 4YGEB 3O6BA 1TN4A 1PVAA 1BU3A 4N1FA 2KI6D 1MQ1A 1YX8A 3EVVA 1TNXA 2F2PA 4CFQA 3DF0A 1PVBA 4ORBB 1Y1AA 1KCYA 4YRUA 1DJWA 4PCWA 2PMYA 2GGZA 4DS7A 4JQ0D 1CLMA 4QJ4B 1OSAA 4CLNA 1CFCA 1A75A 2KFHA 1M46A 3C1VA 3PATA 2F2OA 3I5HC 2M0RA 1DF0B 4A4BA 2V53A 4P2YB 2KI4C 1L2OB 1BF5A 4PHKA 3OB2B 4MN0A 2O5GA 5ER5A 3RM1A 1FI5A 1SR6C 2HETA 1XFXO 2LMTA 3PSRA 2L5XB 1PULA 1KFUL 3D0YA 1XK4A 3BYAA 2WNDA 2G9BA 3O78A 3CZTX 1DGVA 1RTP1 1SK6D 2KQ6A 2LCPA 2MRDA 2PVBA 4YBHB 1EJ3A 1WLZA 3D10A 4MBEA 1B7TZ 2K0JA 1J1EA 2ZNEA 5IBWA 1HQVA 1HT9A 2MLFC 1TCFA 1CLBA 1NYAA 1C7VA 1N2DA 1C7WA 4JPZB 2JTTA 3E3RA 2KDHA 4DIRA 1DT7B 2KBMA 4ORAB 3VGOA 1NPQA 2SCPA 3IF7A 1B1GA 4E68A 4USLA 2ZFDA 1UHKA 1EL4A 5G08A 4GFTA 1ODBA 2K2AA 2KOTA 1RK9A 1RWYA 1KWOC 1YURA 2H61A 5TNCA 5HLOA 1RECA 3OHMB 1E8AA 1BT6A 2F33A 1CMGA 1KFXS 1S26D 2K61A 3M0WA 1H8BA 1IQ3A 2K8MB 2KSPA 2BECA 1ZMZA 1M45A 5I2LA 3PLFB 2I18A 3TUYB 2KQYA 5D7FA 3RLZA 1SY9A 2WC8A 1U5IB 3DVEA 4PE0A 1NX2A 2LC5A 1OMVA 3BOWB 1Y1XA 3SJSA 1B8CA 2BE4A 4L9MA 1S1EA 1F8HA 3AAJA 1DJZA 2M3WA 4PE4A 1J7PA 2TN4A 1J1DA 1XVJA 1S3PA 2DOQA 1JBAA 1XYDA 3EK4A 1J7OA 1F71A 1OMRA 1YRTB 4XJKA 4ICBA 4HRHA 1IGVA 2LV7A 1BODA 1Y0VH 5I8NA 1FBVA 5HYDA 2SASA 3I5HB 4MLWA 2Y1NA 2ZRSA 3ZWHA 2PASA 1TCOB 1RJVA 2JNFA 2KI4B 2HQWA 4XYNA 4YI8A 1AJ4A 1XFYO 1XK4C 2KGBC 1CLLA 2WORA 2L2EA 2Q4UA 2PALA 1G33A 3HCMA 1K8UA 1ALWA 3SG2A 1GGWA 2EGDA 2L98A 1G4YR 1QATA 4CIDA 3SIBA 1BR1B 1JWDA 5CSFA 2AAOA 3KPXA 4WRIA 2CTNA 2LUCA 4PDZA 3JVTC 2ZRTA 1NX0A 3CTNA 2E6WA 1JFKA 4Q04A 1QX5B 3DVKA 4OVNF 5HKWA 1UHJA 1XFUO 1VRKA 3TZ1A 1ZFSA 4MVFA 5ER4X 1OOJA 2KFFA 2LNKA 1OMDA 1OQPA 5DKRA 3LK1A 5HKZA 2AMIA 1TNWA 1C07A 2H61C 4OCIA 1CNPA 4I5LB 1ZOTB 1QLKA 4M2QA 4MRYA 2FCEA 1Y1UA 2BKIB 2PRUA 1LA3A 1KWOB 2LHIA 1BG1A 1A2XA 2I7AA 2JOJA 3PN7C 2PSRA 1FI6A 1SCMC 1UURA 5I2OA 1QTXA 4BY4A 1IG5A 1LINA 2BKHB 3WHUB 1B8RA 4GAOA 4CPVA 1V1GA 4PE1A 2KFGA 1F70A 1A4PA 1B9AA 1S5GZ 2M1UA 2M49B 2NZ0A 1M63B 1DF0A 5FYXA 1G8IA 2ZN8A 1AP4A 4N1GA 1QVIY 3NSOA 2JT0A 1DGUA 4ZCUA 2L51A 5AERA 1JF2A 4IL1A 3TS5B 2NXQA 3EK8A 4NDCA 5DKQA 2F8PA 1YVHA 5AEQA 3VRPA 2GGMA 1NX3A 1QS7A 4MRXA 1NCXA 2B1UA 1KFUS 2LLUA 3LCPC 1A03A 2BBMA 5CSIA 3DVJA 1R2UA 1CB1A 5CSJA 2KBIA 1AUIB 1EXRA 2M7NA 3CR2A 3EKHA 3VRRA 3SG4A 2CXJA 3D0YB 1ZACA 1YX7A 3LLEA 3CR5X 1FW4A 1RROA 2LE9B 4C0JA 1A29A 2JC2A 2LM5A 3K21A 3KEVA 3GK4X 1K95A 4I5KA 1OZOA 2K2FA 1JFJA 1XFZO 1IJ6A 1MHOA 3CGAA 1KK7Z 2LVJA 1YR5A 4AQIA 3JVTB 1JUOA 4R1EA 1WY9A 2WOSA 2E30A 1NX1A 2H2KA 4QJ5B 1N0YA 2OS8C 3OX6A 1B8LA 4MZKA 4MZLA 3SG3A 1ALVA 1IWQA 3ICBA 1K90D 1K93D 1WDCB 1S6CA 1F4QA 1SL7A 1TNQA 1AHRA
chains in the Genus database with same CATH superfamily
1Y6WA 2K7OA 1WLMA 3CS1A 4DUQA 1K9KA 2CT9A 1EG3A 1U5IA 3DVMA 3CLNA 1UWOA 4YGBB 2JZIA 1SW8A 2IS9A 1YUTA 2HF5A 3BOWA 3EVRA 3DYEA 1M39A 4WQ3A 3PN7B 1KQMC 2GV5A 4M2OA 3SS3A 1B47A 3SG6A 3NHIA 4F0ZB 2FJYA 2L50A 3S0AA 2JWWA 1UHIA 4YGAA 2WCHA 1QX7A 1TOPA 1SCMB 3A4UB 1CDNA 1UHHA 5HKYA 1BMOA 2NLNA 3EK7A 3EVUA 4F7FA 4GUKA 1NWDA 1LVCD 1BR4B 1QXPA 1QV1A 3O4XA 2KHNA 1QWVA 2LAPA 3BQ3A 5J3XA 2WCEA 1N65A 3BUNB 1DTLA 2D8NA 3KF9A 1F55A 1SR6B 2F3YA 4BY5A 3I5IC 1K2HA 1SBJA 3BUOB 2QPTA 4PALA 4XJKB 2PYQA 5FI6A 2M9GA 2O60A 5F6TA 2KPHA 5CPVA 5JJGA 1SMGA 2ZKMX 1YVLA 2WCKA 1UUSA 3N7HA 4DCKA 4DRWA 1W7JB 3IQOA 1CDLA 1S6JA 3AKBA 3OX5A 5FI2A 5AFPA 2EC6C 2CNPA 2NCOA 1CFDA 1AVSA 2KAXA 3GK2A 1CMFA 2F3ZA 3R72A 4PHJA 1FPWA 3PFVA 3GOFA 4I5NB 3NHTA 3B88A 3O4YA 3AAKA 3PM8A 1KQVA 2BCAA 2M7LA 1CFPA 4UPGA 2Q91A 1KK8C 1QVIZ 4HRGA 3DD4A 4NDDA 5B8IB 4QJ3B 1CDPA 3CZ0A 3JTDC 4NQGA 2L0PA 2RGIA 3BXKA 3IQQA 1S6IA 1XA5A 3QRXA 1AJ5A 1SSEB 3I5GC 1K9UA 4MEWA 2KAYA 1YUUA 1QX2A 3NXAA 2HQ8A 2LLSA 3KHEA 1WRLA 1Q80A 4YI9A 2MBXA 1IRJA 1GQMA 1DJYA 2Y1MA 4FQTA 4HSZA 1GM0A 2BCBA 3TDUA 1QIWA 2P70A 3HX4A 4GGFA 1SCVA 2JPOA 1PSBA 1DJGA 4I5JA 3VROA 4D1EA 2MHHA 5FI7A 3TUYC 3D75A 3CYZA 4FTGA 1PRWA 1QIVA 5KSZA 3DF0B 3LK0A 1TTXA 2CBLA 1BOCA 4INWA 2I94A 3VRNA 4HREE 2WC6A 3O2PA 1UHNA 2JULA 3D74A 2JTZA 1JSAA 1KQMB 1TNPA 3VB1A 4A4CA 4U8DA 4PE7A 1A75B 2HPSA 2P71A 3SG7A 2KI6C 4WQ2A 1NSHA 2ZNDA 3CDNA 4YGCB 5HLVA 1IJ5A 3SG5A 1IH0A 3R1VA 4MSPA 4ORCB 1YUSA 5KTYA 1J7QA 2LHLA 2CCMA 1PK0D 5KU1A 1JC2A 2MJWB 1S36A 3BUMB 1NUBA 2KAVA 2KYFA 2P6BB 1K9PA 1DC1A 1TRFA 1DELA 1SNLA 2M8UA 1NCZA 4ETOA 2KYCA 3WNXB 3I5IB 1QV0A 2A4JA 2MA2A 2OTGC 1CTRA 3S0FA 1MWNA 1QASA 1EH2A 1OE9B 2K60A 3MSEB 3I5FC 3NSKA 1K94A 4JWQA 3FIAA 2JU0A 1B4CA 3CR4X 4GNKB 1ORGA 5D69A 4GGNA 2LVKA 2YGUA 1OOHA 3EKJA 3NSLA 1WRZA 2LUXA 2EC6B 1F54A 1PSRA 1QJTA 5AXIA 2BL0C 5I2QA 4FQOA 4JKTA 2AUCA 2WCBA 2JXCA 1MF8B 2K7BA 2QEHA 1M31A 4M2PA 1MR8A 1D1OA 3FWCA 1KK8B 2KNEA 4OV2A 2FJUB 2LMUA 4NDBA 3SIAA 3PALA 1S5GY 3JTDB 1KFXL 1MXLC 1MXEA 2QACA 5EL2A 1NIWA 5JOLA 1SRAA 1V1FA 1KSOA 2ISDA 2JT8A 2L4HA 3B6XA 3I5GB 2WCJA 1WRKA 1DJXA 1BLQA 1CDMA 1T14A 1NCYA 1OZSA 4GPLB 2L4IA 2JT3A 3GK1A 4GGFC 1SL8A 2JXLA 3UNWA 5DKNA 1AK8A 3L47A 1NP8A 2LP3A 2M97A 2VRGA 4P5OE 1DJHA 3L4AA 1B7TY 1GGZA 3F45A 1EG4A 3BUXB 1DJIA 1CM4A 2KGRA 3WHTB 4OZDA 2LLTA 3FWBA 2K7DA 4PT1A 3SS4A 1J7RA 2KLDA 2FCDA 5AANA 2BCXA 1YTZC 3TDZA 2I2RE 1L2OC 5D3OA 5CSNA 1L7ZA 4PHNA 2LANA 1FF1A 1CM1A 2ZN9A 2QDIA 2EHBA 2PQLA 2JQ6A 1ZUZA 1IQ5A 1LA0A 1LKJA 1OW4A 1W7IB 1YRUB 2LVVA 3DY9A 5GQQC 1J55A 1RFJA 3A8RA 2G2BA 3TS5C 1K96A 3BUWB 1KK7Y 2BBNA 2WCMA 2Y4QA 4MZJA 5PALA 3KO0A 1CFFA 1LXFC 3WXAA 1LS8A 2LMVA 4GBAA 1MUXA 2WCFA 4YGDB 1R6PA 3R1PA 4OKHA 3VRQA 1PALA 3SS5A 5BPJA 4N5XA 4CFRA 2M1KB 2Y5IA 3FS7A 4PHMA 3H4SE 2FOTA 4C0KA 1UP5A 1X02A 1SPYA 1GJYA 1SYMA 3NSIA 4C0LA 1DVIA 2JPTA 1F4OA 3D73A 2L5YA 2LP2A 2OTGB 3LL8B 3CWGA 5K89A 2K7CA 2COLB 3I5FB 3ZNIA 3D78A 4OR9B 3BFAA 1XFVO 1QLSA 3UO9A 1XO5A 1BJFA 2NCPA 4TNCA 1IKUA 1SKTA 4AQJA 1CKKA 1DMOA 3OP0A 2R2IA 2MAZA 1H4BA 4ZCVA 1JF0A 2BL0B 1XFWO 2OPOA 1TIZA 2H8VA 1SL9A 2BE6A 2JRFA 2JNXA 2M29A 2OS8B 3AKAA 3OB1B 3FE8A 1KSMA 2LVIA 1WDCC 4INXA 2MLEC 3TDIA 4AOMA 4YGEB 3O6BA 1TN4A 1PVAA 1BU3A 4N1FA 2KI6D 1MQ1A 1YX8A 3EVVA 1TNXA 2F2PA 3FE9A 3DF0A 4CFQA 1PVBA 3R1OA 4ORBB 1Y1AA 1KCYA 4YRUA 1DJWA 4PCWA 1Z4HA 2PMYA 3D77A 2GGZA 4DS7A 4JQ0D 1CLMA 4QJ4B 1OSAA 4CLNA 1CFCA 1A75A 2KFHA 3FE6A 3BJHA 1M46A 3C1VA 3PATA 2F2OA 3I5HC 2M0RA 1DF0B 4A4BA 2V53A 4P2YB 2KI4C 1L2OB 1BF5A 5DICA 4PHKA 3OB2B 4MN0A 2O5GA 2QEBA 5ER5A 3RM1A 1SR6C 1FI5A 2HETA 1XFXO 2LMTA 3PSRA 3QMEA 2L5XB 1PULA 1XFRA 1IIOA 1KFUL 3D0YA 1XK4A 3B87A 3BYAA 2WNDA 3CABA 3DZTA 2G9BA 3S0GA 3O78A 2KLEA 3CZTX 1DGVA 1RTP1 1SK6D 2KQ6A 2LCPA 2MRDA 2PVBA 4YBHB 1EJ3A 1WLZA 3D10A 4MBEA 1B7TZ 2K0JA 1J1EA 2ZNEA 5IBWA 1HQVA 1HT9A 2MLFC 1TCFA 1CLBA 1NYAA 1C7VA 1N2DA 1C7WA 4JPZB 2JTTA 3S0DA 3E3RA 2KDHA 4DIRA 1DT7B 2KBMA 4ORAB 3VGOA 1Z2CB 1NPQA 2SCPA 3IF7A 1B1GA 4E68A 4USLA 2ZFDA 1UHKA 2GTEA 1EL4A 5G08A 4GFTA 1ODBA 2K2AA 1C3ZA 2KOTA 1RK9A 1RWYA 1KWOC 1YURA 2H61A 5TNCA 5HLOA 1RECA 2WC5A 3OHMB 3Q8IA 1E8AA 1BT6A 3D76A 2F33A 3V2LA 4KYNA 1TUZA 1CMGA 1KFXS 1S26D 1TUJA 2K61A 3M0WA 1H8BA 1IQ3A 2K8MB 2KSPA 2BECA 1ZMZA 1M45A 5I2LA 3PLFB 2I18A 3CZ2A 3TUYB 2KQYA 4IJ7A 5D7FA 3BFBA 3RLZA 1SY9A 2WC8A 1U5IB 3DVEA 4PE0A 1NX2A 1OOGA 2LC5A 1OMVA 3BOWB 2BNXA 1Y1XA 3SJSA 1B8CA 2BE4A 4L9MA 1S1EA 1F8HA 3AAJA 1DJZA 2M3WA 4PE4A 1J7PA 2TN4A 1J1DA 3L4LA 1XVJA 1S3PA 2DOQA 1JBAA 1XYDA 3EK4A 1J7OA 1F71A 1OMRA 1YRTB 4XJKA 4ICBA 4HRHA 1IGVA 2LV7A 1BODA 1OOFA 1Y0VH 5I8NA 1FBVA 5HYDA 2SASA 3I5HB 4MLWA 2L2CA 2Y1NA 2ZRSA 3ZWHA 2PASA 1TCOB 1RJVA 2JNFA 2KI4B 2HQWA 4XYNA 4YI8A 3B86A 1AJ4A 1XFYO 1XK4C 2KGBC 1CLLA 2WORA 1W9ZA 2L2EA 2Q4UA 2PALA 1G33A 3HCMA 1K8UA 1ALWA 3SG2A 1GGWA 2EGDA 2L98A 1G4YR 1QATA 4CIDA 2ERBA 3SIBA 1BR1B 1JWDA 5CSFA 2AAOA 3KPXA 1P28A 2CTNA 4WRIA 2LUCA 4PDZA 3JVTC 3PJIA 2ZRTA 1NX0A 3CTNA 2E6WA 1JFKA 4Q04A 1QX5B 3DVKA 1DQEA 4OVNF 5HKWA 1TWOA 1UHJA 1VRKA 1XFUO 3TZ1A 1ZFSA 4MVFA 5ER4X 1OOJA 2KFFA 3K1EA 2LNKA 1OMDA 1OQPA 5DKRA 3S0EA 3LK1A 5HKZA 2AMIA 1TNWA 3DXLA 1C07A 3CZ1A 2H61C 4OCIA 3RZSA 4I5LB 1ZOTB 1QLKA 4M2QA 1CNPA 4MRYA 2FCEA 1DEKA 1Y1UA 2BKIB 2PRUA 1LA3A 1KWOB 2LHIA 1BG1A 1A2XA 2I7AA 2JOJA 3PN7C 2PSRA 1FI6A 1SCMC 1UURA 5I2OA 1QTXA 4BY4A 1IG5A 1LINA 3OBVA 2BKHB 3WHUB 1B8RA 4GAOA 4CPVA 1V1GA 4PE1A 2KFGA 1F70A 3OGNA 1OOIX 1A4PA 1B9AA 1S5GZ 2M1UA 2M49B 2NZ0A 1M63B 1DF0A 5FYXA 1G8IA 2ZN8A 1AP4A 2QEVA 4N1GA 1QVIY 3NSOA 3IVTA 2JT0A 1DGUA 4ZCUA 2L51A 5AERA 3PM2A 4JD9A 1JF2A 4IL1A 3TS5B 2NXQA 3EK8A 4NDCA 5DKQA 2F8PA 1YVHA 5AEQA 3VRPA 3NGVA 5I94A 3B7AA 2GGMA 1NX3A 1QS7A 4MRXA 1NCXA 2B1UA 1KFUS 2LLUA 3LCPC 3S0BA 2BAPA 1A03A 2BBMA 5CSIA 1C3YA 3DVJA 1R2UA 1CB1A 5CSJA 2KBIA 1AUIB 1EXRA 2M7NA 3CR2A 3EKHA 3VRRA 3SG4A 2CXJA 3D0YB 1ZACA 1YX7A 3LLEA 3CR5X 1FW4A 1RROA 2LE9B 4C0JA 1A29A 2JC2A 2LM5A 3K21A 3KEVA 3GK4X 2WCLA 3BFHA 1K95A 4I5KA 1OZOA 2K2FA 1JFJA 1XFZO 1IJ6A 1MHOA 3CGAA 1KK7Z 2LVJA 3EG5B 1YR5A 4AQIA 2QEOA 3JVTB 1JUOA 4R1EA 1WY9A 2WOSA 2E30A 1NX1A 2H2KA 4QJ5B 1N0YA 2OS8C 3OX6A 1B8LA 5HL1A 4MZKA 4MZLA 3SG3A 1ALVA 1IWQA 3ICBA 1K90D 1K93D 1WDCB 1S6CA 1F4QA 1SL7A 1TNQA 1AHRA
chains in the Genus database with same CATH topology
1Y6WA 2K7OA 1WLMA 3CS1A 4DUQA 1K9KA 2CT9A 1EG3A 1U5IA 3DVMA 3CLNA 1UWOA 4YGBB 2JZIA 1SW8A 2IS9A 1YUTA 2HF5A 3BOWA 3EVRA 4WQ3A 1M39A 3PN7B 1KQMC 2GV5A 4M2OA 1B47A 3SG6A 4F0ZB 2L50A 2JWWA 1UHIA 4YGAA 1QX7A 1TOPA 1SCMB 3A4UB 1CDNA 1UHHA 5HKYA 1BMOA 2NLNA 3EK7A 3EVUA 4GUKA 1NWDA 1LVCD 1BR4B 1QXPA 1QV1A 2KHNA 2LAPA 3BQ3A 5J3XA 2WCEA 1N65A 3BUNB 1DTLA 2D8NA 3KF9A 1F55A 1SR6B 2F3YA 4BY5A 3I5IC 1K2HA 1SBJA 3BUOB 2QPTA 4PALA 4XJKB 2M9GA 2O60A 5F6TA 5CPVA 5JJGA 1SMGA 2ZKMX 1YVLA 1UUSA 4DCKA 4DRWA 1W7JB 3IQOA 1CDLA 1S6JA 3AKBA 3OX5A 5AFPA 2EC6C 2CNPA 2NCOA 1CFDA 1AVSA 2KAXA 3GK2A 1CMFA 2F3ZA 4PHJA 1FPWA 3PFVA 3GOFA 4I5NB 3PM8A 3O4YA 3AAKA 1KQVA 2BCAA 2M7LA 1CFPA 4UPGA 2Q91A 1KK8C 1QVIZ 4HRGA 3DD4A 4NDDA 5B8IB 4QJ3B 1CDPA 3JTDC 4NQGA 2L0PA 2RGIA 3BXKA 3IQQA 1S6IA 1XA5A 3QRXA 1AJ5A 3I5GC 1K9UA 4MEWA 2KAYA 1YUUA 1QX2A 3NXAA 2HQ8A 2LLSA 3KHEA 1WRLA 1Q80A 4YI9A 2MBXA 1IRJA 1GQMA 1DJYA 2Y1MA 4HSZA 2BCBA 3TDUA 1QIWA 3HX4A 4GGFA 1SCVA 1PSBA 1DJGA 4I5JA 3VROA 4D1EA 2MHHA 3TUYC 4FTGA 1PRWA 1QIVA 5KSZA 3DF0B 3LK0A 1TTXA 2CBLA 1BOCA 2I94A 3VRNA 4HREE 3O2PA 1UHNA 2JULA 2JTZA 1JSAA 1KQMB 1TNPA 4A4CA 4U8DA 4PE7A 1A75B 2HPSA 3SG7A 2KI6C 4WQ2A 1NSHA 2ZNDA 4YGCB 5HLVA 1IJ5A 3SG5A 1IH0A 4MSPA 4ORCB 1YUSA 5KTYA 1J7QA 2LHLA 2CCMA 1PK0D 5KU1A 1JC2A 2MJWB 1S36A 3BUMB 1NUBA 2KAVA 2KYFA 2P6BB 1K9PA 1TRFA 1SNLA 2M8UA 1NCZA 4ETOA 2KYCA 3WNXB 3I5IB 1QV0A 2A4JA 2MA2A 2OTGC 1CTRA 1MWNA 1QASA 1EH2A 1OE9B 3MSEB 3I5FC 3NSKA 1K94A 4JWQA 3FIAA 2JU0A 1B4CA 3CR4X 4GNKB 5D69A 4GGNA 2LVKA 3EKJA 3NSLA 1WRZA 2LUXA 2EC6B 1F54A 1PSRA 1QJTA 5AXIA 2BL0C 5I2QA 4FQOA 2AUCA 2WCBA 2JXCA 1MF8B 2K7BA 1M31A 4M2PA 1MR8A 1D1OA 3FWCA 1KK8B 2KNEA 4OV2A 2FJUB 2LMUA 4NDBA 3SIAA 3PALA 1S5GY 3JTDB 1KFXL 1MXLC 1MXEA 2QACA 5JOLA 1NIWA 1SRAA 1V1FA 1KSOA 2ISDA 2JT8A 2L4HA 3I5GB 1WRKA 1DJXA 1BLQA 1CDMA 1NCYA 1OZSA 4GPLB 2L4IA 2JT3A 3GK1A 4GGFC 1SL8A 2JXLA 1AK8A 5DKNA 1NP8A 2LP3A 2M97A 2VRGA 4P5OE 1DJHA 1B7TY 1GGZA 3F45A 1EG4A 3BUXB 1DJIA 1CM4A 2KGRA 3WHTB 2LLTA 3FWBA 2K7DA 1J7RA 2FCDA 5AANA 2BCXA 1YTZC 3TDZA 2I2RE 1L2OC 5CSNA 1L7ZA 4PHNA 2LANA 1FF1A 1CM1A 2ZN9A 2EHBA 2JQ6A 1IQ5A 1LA0A 1LKJA 1ZUZA 1YRUB 1W7IB 2LVVA 5GQQC 1J55A 1RFJA 3A8RA 2G2BA 3TS5C 1K96A 3BUWB 1KK7Y 2BBNA 2Y4QA 4MZJA 5PALA 3KO0A 1CFFA 1LXFC 3WXAA 2LMVA 4GBAA 1MUXA 2WCFA 4YGDB 1R6PA 4OKHA 3VRQA 1PALA 5BPJA 4N5XA 4CFRA 2M1KB 2Y5IA 3FS7A 4PHMA 3H4SE 2FOTA 4C0KA 1UP5A 1X02A 1SPYA 1GJYA 1SYMA 3NSIA 4C0LA 1DVIA 2JPTA 1F4OA 2LP2A 2OTGB 3LL8B 3CWGA 5K89A 2K7CA 2COLB 3I5FB 3ZNIA 4OR9B 1XFVO 1QLSA 1XO5A 1BJFA 2NCPA 4TNCA 1IKUA 1SKTA 4AQJA 1CKKA 1DMOA 3OP0A 2R2IA 2MAZA 1H4BA 4ZCVA 1JF0A 2BL0B 1XFWO 2OPOA 1TIZA 1SL9A 2BE6A 2JRFA 2JNXA 2M29A 2OS8B 3AKAA 3OB1B 1KSMA 2LVIA 1WDCC 2MLEC 3TDIA 4AOMA 4YGEB 3O6BA 1TN4A 1PVAA 1BU3A 4N1FA 2KI6D 1MQ1A 1YX8A 3EVVA 1TNXA 2F2PA 4CFQA 3DF0A 1PVBA 4ORBB 1Y1AA 1KCYA 4YRUA 1DJWA 4PCWA 2PMYA 2GGZA 4DS7A 4JQ0D 1CLMA 4QJ4B 1OSAA 4CLNA 1CFCA 1A75A 2KFHA 1M46A 3C1VA 3PATA 2F2OA 3I5HC 2M0RA 1DF0B 4A4BA 2V53A 4P2YB 2KI4C 1L2OB 1BF5A 4PHKA 3OB2B 4MN0A 2O5GA 5ER5A 3RM1A 1FI5A 1SR6C 2HETA 1XFXO 2LMTA 3PSRA 2L5XB 1PULA 1KFUL 3D0YA 1XK4A 3BYAA 2WNDA 2G9BA 3O78A 3CZTX 1DGVA 1RTP1 1SK6D 2KQ6A 2LCPA 2MRDA 2PVBA 4YBHB 1EJ3A 1WLZA 3D10A 4MBEA 1B7TZ 2K0JA 1J1EA 2ZNEA 5IBWA 1HQVA 1HT9A 2MLFC 1TCFA 1CLBA 1NYAA 1C7VA 1N2DA 1C7WA 4JPZB 2JTTA 3E3RA 2KDHA 4DIRA 1DT7B 2KBMA 4ORAB 3VGOA 1NPQA 2SCPA 3IF7A 1B1GA 4E68A 4USLA 2ZFDA 1UHKA 1EL4A 5G08A 4GFTA 1ODBA 2K2AA 2KOTA 1RK9A 1RWYA 1KWOC 1YURA 2H61A 5TNCA 5HLOA 1RECA 3OHMB 1E8AA 1BT6A 2F33A 1CMGA 1KFXS 1S26D 2K61A 3M0WA 1H8BA 1IQ3A 2K8MB 2KSPA 2BECA 1ZMZA 1M45A 5I2LA 3PLFB 2I18A 3TUYB 2KQYA 5D7FA 3RLZA 1SY9A 2WC8A 1U5IB 3DVEA 4PE0A 1NX2A 2LC5A 1OMVA 3BOWB 1Y1XA 3SJSA 1B8CA 2BE4A 4L9MA 1S1EA 1F8HA 3AAJA 1DJZA 2M3WA 4PE4A 1J7PA 2TN4A 1J1DA 1XVJA 1S3PA 2DOQA 1JBAA 1XYDA 3EK4A 1J7OA 1F71A 1OMRA 1YRTB 4XJKA 4ICBA 4HRHA 1IGVA 2LV7A 1BODA 1Y0VH 5I8NA 1FBVA 5HYDA 2SASA 3I5HB 4MLWA 2Y1NA 2ZRSA 3ZWHA 2PASA 1TCOB 1RJVA 2JNFA 2KI4B 2HQWA 4XYNA 4YI8A 1AJ4A 1XFYO 1XK4C 2KGBC 1CLLA 2WORA 2L2EA 2Q4UA 2PALA 1G33A 3HCMA 1K8UA 1ALWA 3SG2A 1GGWA 2EGDA 2L98A 1G4YR 1QATA 4CIDA 3SIBA 1BR1B 1JWDA 5CSFA 2AAOA 3KPXA 4WRIA 2CTNA 2LUCA 4PDZA 3JVTC 2ZRTA 1NX0A 3CTNA 2E6WA 1JFKA 4Q04A 1QX5B 3DVKA 4OVNF 5HKWA 1UHJA 1XFUO 1VRKA 3TZ1A 1ZFSA 4MVFA 5ER4X 1OOJA 2KFFA 2LNKA 1OMDA 1OQPA 5DKRA 3LK1A 5HKZA 2AMIA 1TNWA 1C07A 2H61C 4OCIA 1CNPA 4I5LB 1ZOTB 1QLKA 4M2QA 4MRYA 2FCEA 1Y1UA 2BKIB 2PRUA 1LA3A 1KWOB 2LHIA 1BG1A 1A2XA 2I7AA 2JOJA 3PN7C 2PSRA 1FI6A 1SCMC 1UURA 5I2OA 1QTXA 4BY4A 1IG5A 1LINA 2BKHB 3WHUB 1B8RA 4GAOA 4CPVA 1V1GA 4PE1A 2KFGA 1F70A 1A4PA 1B9AA 1S5GZ 2M1UA 2M49B 2NZ0A 1M63B 1DF0A 5FYXA 1G8IA 2ZN8A 1AP4A 4N1GA 1QVIY 3NSOA 2JT0A 1DGUA 4ZCUA 2L51A 5AERA 1JF2A 4IL1A 3TS5B 2NXQA 3EK8A 4NDCA 5DKQA 2F8PA 1YVHA 5AEQA 3VRPA 2GGMA 1NX3A 1QS7A 4MRXA 1NCXA 2B1UA 1KFUS 2LLUA 3LCPC 1A03A 2BBMA 5CSIA 3DVJA 1R2UA 1CB1A 5CSJA 2KBIA 1AUIB 1EXRA 2M7NA 3CR2A 3EKHA 3VRRA 3SG4A 2CXJA 3D0YB 1ZACA 1YX7A 3LLEA 3CR5X 1FW4A 1RROA 2LE9B 4C0JA 1A29A 2JC2A 2LM5A 3K21A 3KEVA 3GK4X 1K95A 4I5KA 1OZOA 2K2FA 1JFJA 1XFZO 1IJ6A 1MHOA 3CGAA 1KK7Z 2LVJA 1YR5A 4AQIA 3JVTB 1JUOA 4R1EA 1WY9A 2WOSA 2E30A 1NX1A 2H2KA 4QJ5B 1N0YA 2OS8C 3OX6A 1B8LA 4MZKA 4MZLA 3SG3A 1ALVA 1IWQA 3ICBA 1K90D 1K93D 1WDCB 1S6CA 1F4QA 1SL7A 1TNQA 1AHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6W A;  2K7O A;  1WLM A;  3CS1 A;  4DUQ A;  1K9K A;  2CT9 A;  1EG3 A;  1U5I A;  3DVM A;  3CLN A;  1UWO A;  4YGB B;  2JZI A;  1SW8 A;  2IS9 A;  1YUT A;  2HF5 A;  3BOW A;  3EVR A;  4WQ3 A;  1M39 A;  3PN7 B;  1KQM C;  2GV5 A;  4M2O A;  1B47 A;  3SG6 A;  4F0Z B;  2L50 A;  2JWW A;  1UHI A;  4YGA A;  1QX7 A;  1TOP A;  1SCM B;  3A4U B;  1CDN A;  1UHH A;  5HKY A;  1BMO A;  2NLN A;  3EK7 A;  3EVU A;  4GUK A;  1NWD A;  1LVC D;  1BR4 B;  1QXP A;  1QV1 A;  2KHN A;  2LAP A;  3BQ3 A;  5J3X A;  2WCE A;  1N65 A;  3BUN B;  1DTL A;  2D8N A;  3KF9 A;  1F55 A;  1SR6 B;  2F3Y A;  4BY5 A;  3I5I C;  1K2H A;  1SBJ A;  3BUO B;  2QPT A;  4PAL A;  4XJK B;  2M9G A;  2O60 A;  5F6T A;  5CPV A;  5JJG A;  1SMG A;  2ZKM X;  1YVL A;  1UUS A;  4DCK A;  4DRW A;  1W7J B;  3IQO A;  1CDL A;  1S6J A;  3AKB A;  3OX5 A;  5AFP A;  2EC6 C;  2CNP A;  2NCO A;  1CFD A;  1AVS A;  2KAX A;  3GK2 A;  1CMF A;  2F3Z A;  4PHJ A;  1FPW A;  3PFV A;  3GOF A;  4I5N B;  3PM8 A;  3O4Y A;  3AAK A;  1KQV A;  2BCA A;  2M7L A;  1CFP A;  4UPG A;  2Q91 A;  1KK8 C;  1QVI Z;  4HRG A;  3DD4 A;  4NDD A;  5B8I B;  4QJ3 B;  1CDP A;  3JTD C;  4NQG A;  2L0P A;  2RGI A;  3BXK A;  3IQQ A;  1S6I A;  1XA5 A;  3QRX A;  1AJ5 A;  3I5G C;  1K9U A;  4MEW A;  2KAY A;  1YUU A;  1QX2 A;  3NXA A;  2HQ8 A;  2LLS A;  3KHE A;  1WRL A;  1Q80 A;  4YI9 A;  2MBX A;  1IRJ A;  1GQM A;  1DJY A;  2Y1M A;  4HSZ A;  2BCB A;  3TDU A;  1QIW A;  3HX4 A;  4GGF A;  1SCV A;  1PSB A;  1DJG A;  4I5J A;  3VRO A;  4D1E A;  2MHH A;  3TUY C;  4FTG A;  1PRW A;  1QIV A;  5KSZ A;  3DF0 B;  3LK0 A;  1TTX A;  2CBL A;  1BOC A;  2I94 A;  3VRN A;  4HRE E;  3O2P A;  1UHN A;  2JUL A;  2JTZ A;  1JSA A;  1KQM B;  1TNP A;  4A4C A;  4U8D A;  4PE7 A;  1A75 B;  2HPS A;  3SG7 A;  2KI6 C;  4WQ2 A;  1NSH A;  2ZND A;  4YGC B;  5HLV A;  1IJ5 A;  3SG5 A;  1IH0 A;  4MSP A;  4ORC B;  1YUS A;  5KTY A;  1J7Q A;  2LHL A;  2CCM A;  1PK0 D;  5KU1 A;  1JC2 A;  2MJW B;  1S36 A;  3BUM B;  1NUB A;  2KAV A;  2KYF A;  2P6B B;  1K9P A;  1TRF A;  1SNL A;  2M8U A;  1NCZ A;  4ETO A;  2KYC A;  3WNX B;  3I5I B;  1QV0 A;  2A4J A;  2MA2 A;  2OTG C;  1CTR A;  1MWN A;  1QAS A;  1EH2 A;  1OE9 B;  3MSE B;  3I5F C;  3NSK A;  1K94 A;  4JWQ A;  3FIA A;  2JU0 A;  1B4C A;  3CR4 X;  4GNK B;  5D69 A;  4GGN A;  2LVK A;  3EKJ A;  3NSL A;  1WRZ A;  2LUX A;  2EC6 B;  1F54 A;  1PSR A;  1QJT A;  5AXI A;  2BL0 C;  5I2Q A;  4FQO A;  2AUC A;  2WCB A;  2JXC A;  1MF8 B;  2K7B A;  1M31 A;  4M2P A;  1MR8 A;  1D1O A;  3FWC A;  1KK8 B;  2KNE A;  4OV2 A;  2FJU B;  2LMU A;  4NDB A;  3SIA A;  3PAL A;  1S5G Y;  3JTD B;  1KFX L;  1MXL C;  1MXE A;  2QAC A;  5JOL A;  1NIW A;  1SRA A;  1V1F A;  1KSO A;  2ISD A;  2JT8 A;  2L4H A;  3I5G B;  1WRK A;  1DJX A;  1BLQ A;  1CDM A;  1NCY A;  1OZS A;  4GPL B;  2L4I A;  2JT3 A;  3GK1 A;  4GGF C;  1SL8 A;  2JXL A;  1AK8 A;  5DKN A;  1NP8 A;  2LP3 A;  2M97 A;  2VRG A;  4P5O E;  1DJH A;  1B7T Y;  1GGZ A;  3F45 A;  1EG4 A;  3BUX B;  1DJI A;  1CM4 A;  2KGR A;  3WHT B;  2LLT A;  3FWB A;  2K7D A;  1J7R A;  2FCD A;  5AAN A;  2BCX A;  1YTZ C;  3TDZ A;  2I2R E;  1L2O C;  5CSN A;  1L7Z A;  4PHN A;  2LAN A;  1FF1 A;  1CM1 A;  2ZN9 A;  2EHB A;  2JQ6 A;  1IQ5 A;  1LA0 A;  1LKJ A;  1ZUZ A;  1YRU B;  1W7I B;  2LVV A;  5GQQ C;  1J55 A;  1RFJ A;  3A8R A;  2G2B A;  3TS5 C;  1K96 A;  3BUW B;  1KK7 Y;  2BBN A;  2Y4Q A;  4MZJ A;  5PAL A;  3KO0 A;  1CFF A;  1LXF C;  3WXA A;  2LMV A;  4GBA A;  1MUX A;  2WCF A;  4YGD B;  1R6P A;  4OKH A;  3VRQ A;  1PAL A;  5BPJ A;  4N5X A;  4CFR A;  2M1K B;  2Y5I A;  3FS7 A;  4PHM A;  3H4S E;  2FOT A;  4C0K A;  1UP5 A;  1X02 A;  1SPY A;  1GJY A;  1SYM A;  3NSI A;  4C0L A;  1DVI A;  2JPT A;  1F4O A;  2LP2 A;  2OTG B;  3LL8 B;  3CWG A;  5K89 A;  2K7C A;  2COL B;  3I5F B;  3ZNI A;  4OR9 B;  1XFV O;  1QLS A;  1XO5 A;  1BJF A;  2NCP A;  4TNC A;  1IKU A;  1SKT A;  4AQJ A;  1CKK A;  1DMO A;  3OP0 A;  2R2I A;  2MAZ A;  1H4B A;  4ZCV A;  1JF0 A;  2BL0 B;  1XFW O;  2OPO A;  1TIZ A;  1SL9 A;  2BE6 A;  2JRF A;  2JNX A;  2M29 A;  2OS8 B;  3AKA A;  3OB1 B;  1KSM A;  2LVI A;  1WDC C;  2MLE C;  3TDI A;  4AOM A;  4YGE B;  3O6B A;  1TN4 A;  1PVA A;  1BU3 A;  4N1F A;  2KI6 D;  1MQ1 A;  1YX8 A;  3EVV A;  1TNX A;  2F2P A;  4CFQ A;  3DF0 A;  1PVB A;  4ORB B;  1Y1A A;  1KCY A;  4YRU A;  1DJW A;  4PCW A;  2PMY A;  2GGZ A;  4DS7 A;  4JQ0 D;  1CLM A;  4QJ4 B;  1OSA A;  4CLN A;  1CFC A;  1A75 A;  2KFH A;  1M46 A;  3C1V A;  3PAT A;  2F2O A;  3I5H C;  2M0R A;  1DF0 B;  4A4B A;  2V53 A;  4P2Y B;  2KI4 C;  1L2O B;  1BF5 A;  4PHK A;  3OB2 B;  4MN0 A;  2O5G A;  5ER5 A;  3RM1 A;  1FI5 A;  1SR6 C;  2HET A;  1XFX O;  2LMT A;  3PSR A;  2L5X B;  1PUL A;  1KFU L;  3D0Y A;  1XK4 A;  3BYA A;  2WND A;  2G9B A;  3O78 A;  3CZT X;  1DGV A;  1RTP 1;  1SK6 D;  2KQ6 A;  2LCP A;  2MRD A;  2PVB A;  4YBH B;  1EJ3 A;  1WLZ A;  3D10 A;  4MBE A;  1B7T Z;  2K0J A;  1J1E A;  2ZNE A;  5IBW A;  1HQV A;  1HT9 A;  2MLF C;  1TCF A;  1CLB A;  1NYA A;  1C7V A;  1N2D A;  1C7W A;  4JPZ B;  2JTT A;  3E3R A;  2KDH A;  4DIR A;  1DT7 B;  2KBM A;  4ORA B;  3VGO A;  1NPQ A;  2SCP A;  3IF7 A;  1B1G A;  4E68 A;  4USL A;  2ZFD A;  1UHK A;  1EL4 A;  5G08 A;  4GFT A;  1ODB A;  2K2A A;  2KOT A;  1RK9 A;  1RWY A;  1KWO C;  1YUR A;  2H61 A;  5TNC A;  5HLO A;  1REC A;  3OHM B;  1E8A A;  1BT6 A;  2F33 A;  1CMG A;  1KFX S;  1S26 D;  2K61 A;  3M0W A;  1H8B A;  1IQ3 A;  2K8M B;  2KSP A;  2BEC A;  1ZMZ A;  1M45 A;  5I2L A;  3PLF B;  2I18 A;  3TUY B;  2KQY A;  5D7F A;  3RLZ A;  1SY9 A;  2WC8 A;  1U5I B;  3DVE A;  4PE0 A;  1NX2 A;  2LC5 A;  1OMV A;  3BOW B;  1Y1X A;  3SJS A;  1B8C A;  2BE4 A;  4L9M A;  1S1E A;  1F8H A;  3AAJ A;  1DJZ A;  2M3W A;  4PE4 A;  1J7P A;  2TN4 A;  1J1D A;  1XVJ A;  1S3P A;  2DOQ A;  1JBA A;  1XYD A;  3EK4 A;  1J7O A;  1F71 A;  1OMR A;  1YRT B;  4XJK A;  4ICB A;  4HRH A;  1IGV A;  2LV7 A;  1BOD A;  1Y0V H;  5I8N A;  1FBV A;  5HYD A;  2SAS A;  3I5H B;  4MLW A;  2Y1N A;  2ZRS A;  3ZWH A;  2PAS A;  1TCO B;  1RJV A;  2JNF A;  2KI4 B;  2HQW A;  4XYN A;  4YI8 A;  1AJ4 A;  1XFY O;  1XK4 C;  2KGB C;  1CLL A;  2WOR A;  2L2E A;  2Q4U A;  2PAL A;  1G33 A;  3HCM A;  1K8U A;  1ALW A;  3SG2 A;  1GGW A;  2EGD A;  2L98 A;  1G4Y R;  1QAT A;  4CID A;  3SIB A;  1BR1 B;  1JWD A;  5CSF A;  2AAO A;  3KPX A;  4WRI A;  2CTN A;  2LUC A;  4PDZ A;  3JVT C;  2ZRT A;  1NX0 A;  3CTN A;  2E6W A;  1JFK A;  4Q04 A;  1QX5 B;  3DVK A;  4OVN F;  5HKW A;  1UHJ A;  1XFU O;  1VRK A;  3TZ1 A;  1ZFS A;  4MVF A;  5ER4 X;  1OOJ A;  2KFF A;  2LNK A;  1OMD A;  1OQP A;  5DKR A;  3LK1 A;  5HKZ A;  2AMI A;  1TNW A;  1C07 A;  2H61 C;  4OCI A;  1CNP A;  4I5L B;  1ZOT B;  1QLK A;  4M2Q A;  4MRY A;  2FCE A;  1Y1U A;  2BKI B;  2PRU A;  1LA3 A;  1KWO B;  2LHI A;  1BG1 A;  1A2X A;  2I7A A;  2JOJ A;  3PN7 C;  2PSR A;  1FI6 A;  1SCM C;  1UUR A;  5I2O A;  1QTX A;  4BY4 A;  1IG5 A;  1LIN A;  2BKH B;  3WHU B;  1B8R A;  4GAO A;  4CPV A;  1V1G A;  4PE1 A;  2KFG A;  1F70 A;  1A4P A;  1B9A A;  1S5G Z;  2M1U A;  2M49 B;  2NZ0 A;  1M63 B;  1DF0 A;  5FYX A;  1G8I A;  2ZN8 A;  1AP4 A;  4N1G A;  1QVI Y;  3NSO A;  2JT0 A;  1DGU A;  4ZCU A;  2L51 A;  5AER A;  1JF2 A;  4IL1 A;  3TS5 B;  2NXQ A;  3EK8 A;  4NDC A;  5DKQ A;  2F8P A;  1YVH A;  5AEQ A;  3VRP A;  2GGM A;  1NX3 A;  1QS7 A;  4MRX A;  1NCX A;  2B1U A;  1KFU S;  2LLU A;  3LCP C;  1A03 A;  2BBM A;  5CSI A;  3DVJ A;  1R2U A;  1CB1 A;  5CSJ A;  2KBI A;  1AUI B;  1EXR A;  2M7N A;  3CR2 A;  3EKH A;  3VRR A;  3SG4 A;  2CXJ A;  3D0Y B;  1ZAC A;  1YX7 A;  3LLE A;  3CR5 X;  1FW4 A;  1RRO A;  2LE9 B;  4C0J A;  1A29 A;  2JC2 A;  2LM5 A;  3K21 A;  3KEV A;  3GK4 X;  1K95 A;  4I5K A;  1OZO A;  2K2F A;  1JFJ A;  1XFZ O;  1IJ6 A;  1MHO A;  3CGA A;  1KK7 Z;  2LVJ A;  1YR5 A;  4AQI A;  3JVT B;  1JUO A;  4R1E A;  1WY9 A;  2WOS A;  2E30 A;  1NX1 A;  2H2K A;  4QJ5 B;  1N0Y A;  2OS8 C;  3OX6 A;  1B8L A;  4MZK A;  4MZL A;  3SG3 A;  1ALV A;  1IWQ A;  3ICB A;  1K90 D;  1K93 D;  1WDC B;  1S6C A;  1F4Q A;  1SL7 A;  1TNQ A;  1AHR A; 
#chains in the Genus database with same CATH topology
 1Y6W A;  2K7O A;  1WLM A;  3CS1 A;  4DUQ A;  1K9K A;  2CT9 A;  1EG3 A;  1U5I A;  3DVM A;  3CLN A;  1UWO A;  4YGB B;  2JZI A;  1SW8 A;  2IS9 A;  1YUT A;  2HF5 A;  3BOW A;  3EVR A;  3DYE A;  1M39 A;  4WQ3 A;  3PN7 B;  1KQM C;  2GV5 A;  4M2O A;  3SS3 A;  1B47 A;  3SG6 A;  3NHI A;  4F0Z B;  2FJY A;  2L50 A;  3S0A A;  2JWW A;  1UHI A;  4YGA A;  2WCH A;  1QX7 A;  1TOP A;  1SCM B;  3A4U B;  1CDN A;  1UHH A;  5HKY A;  1BMO A;  2NLN A;  3EK7 A;  3EVU A;  4F7F A;  4GUK A;  1NWD A;  1LVC D;  1BR4 B;  1QXP A;  1QV1 A;  3O4X A;  2KHN A;  1QWV A;  2LAP A;  3BQ3 A;  5J3X A;  2WCE A;  1N65 A;  3BUN B;  1DTL A;  2D8N A;  3KF9 A;  1F55 A;  1SR6 B;  2F3Y A;  4BY5 A;  3I5I C;  1K2H A;  1SBJ A;  3BUO B;  2QPT A;  4PAL A;  4XJK B;  2PYQ A;  5FI6 A;  2M9G A;  2O60 A;  5F6T A;  2KPH A;  5CPV A;  5JJG A;  1SMG A;  2ZKM X;  1YVL A;  2WCK A;  1UUS A;  3N7H A;  4DCK A;  4DRW A;  1W7J B;  3IQO A;  1CDL A;  1S6J A;  3AKB A;  3OX5 A;  5FI2 A;  5AFP A;  2EC6 C;  2CNP A;  2NCO A;  1CFD A;  1AVS A;  2KAX A;  3GK2 A;  1CMF A;  2F3Z A;  3R72 A;  4PHJ A;  1FPW A;  3PFV A;  3GOF A;  4I5N B;  3NHT A;  3B88 A;  3O4Y A;  3AAK A;  3PM8 A;  1KQV A;  2BCA A;  2M7L A;  1CFP A;  4UPG A;  2Q91 A;  1KK8 C;  1QVI Z;  4HRG A;  3DD4 A;  4NDD A;  5B8I B;  4QJ3 B;  1CDP A;  3CZ0 A;  3JTD C;  4NQG A;  2L0P A;  2RGI A;  3BXK A;  3IQQ A;  1S6I A;  1XA5 A;  3QRX A;  1AJ5 A;  1SSE B;  3I5G C;  1K9U A;  4MEW A;  2KAY A;  1YUU A;  1QX2 A;  3NXA A;  2HQ8 A;  2LLS A;  3KHE A;  1WRL A;  1Q80 A;  4YI9 A;  2MBX A;  1IRJ A;  1GQM A;  1DJY A;  2Y1M A;  4FQT A;  4HSZ A;  1GM0 A;  2BCB A;  3TDU A;  1QIW A;  2P70 A;  3HX4 A;  4GGF A;  1SCV A;  2JPO A;  1PSB A;  1DJG A;  4I5J A;  3VRO A;  4D1E A;  2MHH A;  5FI7 A;  3TUY C;  3D75 A;  3CYZ A;  4FTG A;  1PRW A;  1QIV A;  5KSZ A;  3DF0 B;  3LK0 A;  1TTX A;  2CBL A;  1BOC A;  4INW A;  2I94 A;  3VRN A;  4HRE E;  2WC6 A;  3O2P A;  1UHN A;  2JUL A;  3D74 A;  2JTZ A;  1JSA A;  1KQM B;  1TNP A;  3VB1 A;  4A4C A;  4U8D A;  4PE7 A;  1A75 B;  2HPS A;  2P71 A;  3SG7 A;  2KI6 C;  4WQ2 A;  1NSH A;  2ZND A;  3CDN A;  4YGC B;  5HLV A;  1IJ5 A;  3SG5 A;  1IH0 A;  3R1V A;  4MSP A;  4ORC B;  1YUS A;  5KTY A;  1J7Q A;  2LHL A;  2CCM A;  1PK0 D;  5KU1 A;  1JC2 A;  2MJW B;  1S36 A;  3BUM B;  1NUB A;  2KAV A;  2KYF A;  2P6B B;  1K9P A;  1DC1 A;  1TRF A;  1DEL A;  1SNL A;  2M8U A;  1NCZ A;  4ETO A;  2KYC A;  3WNX B;  3I5I B;  1QV0 A;  2A4J A;  2MA2 A;  2OTG C;  1CTR A;  3S0F A;  1MWN A;  1QAS A;  1EH2 A;  1OE9 B;  2K60 A;  3MSE B;  3I5F C;  3NSK A;  1K94 A;  4JWQ A;  3FIA A;  2JU0 A;  1B4C A;  3CR4 X;  4GNK B;  1ORG A;  5D69 A;  4GGN A;  2LVK A;  2YGU A;  1OOH A;  3EKJ A;  3NSL A;  1WRZ A;  2LUX A;  2EC6 B;  1F54 A;  1PSR A;  1QJT A;  5AXI A;  2BL0 C;  5I2Q A;  4FQO A;  4JKT A;  2AUC A;  2WCB A;  2JXC A;  1MF8 B;  2K7B A;  2QEH A;  1M31 A;  4M2P A;  1MR8 A;  1D1O A;  3FWC A;  1KK8 B;  2KNE A;  4OV2 A;  2FJU B;  2LMU A;  4NDB A;  3SIA A;  3PAL A;  1S5G Y;  3JTD B;  1KFX L;  1MXL C;  1MXE A;  2QAC A;  5EL2 A;  1NIW A;  5JOL A;  1SRA A;  1V1F A;  1KSO A;  2ISD A;  2JT8 A;  2L4H A;  3B6X A;  3I5G B;  2WCJ A;  1WRK A;  1DJX A;  1BLQ A;  1CDM A;  1T14 A;  1NCY A;  1OZS A;  4GPL B;  2L4I A;  2JT3 A;  3GK1 A;  4GGF C;  1SL8 A;  2JXL A;  3UNW A;  5DKN A;  1AK8 A;  3L47 A;  1NP8 A;  2LP3 A;  2M97 A;  2VRG A;  4P5O E;  1DJH A;  3L4A A;  1B7T Y;  1GGZ A;  3F45 A;  1EG4 A;  3BUX B;  1DJI A;  1CM4 A;  2KGR A;  3WHT B;  4OZD A;  2LLT A;  3FWB A;  2K7D A;  4PT1 A;  3SS4 A;  1J7R A;  2KLD A;  2FCD A;  5AAN A;  2BCX A;  1YTZ C;  3TDZ A;  2I2R E;  1L2O C;  5D3O A;  5CSN A;  1L7Z A;  4PHN A;  2LAN A;  1FF1 A;  1CM1 A;  2ZN9 A;  2QDI A;  2EHB A;  2PQL A;  2JQ6 A;  1ZUZ A;  1IQ5 A;  1LA0 A;  1LKJ A;  1OW4 A;  1W7I B;  1YRU B;  2LVV A;  3DY9 A;  5GQQ C;  1J55 A;  1RFJ A;  3A8R A;  2G2B A;  3TS5 C;  1K96 A;  3BUW B;  1KK7 Y;  2BBN A;  2WCM A;  2Y4Q A;  4MZJ A;  5PAL A;  3KO0 A;  1CFF A;  1LXF C;  3WXA A;  1LS8 A;  2LMV A;  4GBA A;  1MUX A;  2WCF A;  4YGD B;  1R6P A;  3R1P A;  4OKH A;  3VRQ A;  1PAL A;  3SS5 A;  5BPJ A;  4N5X A;  4CFR A;  2M1K B;  2Y5I A;  3FS7 A;  4PHM A;  3H4S E;  2FOT A;  4C0K A;  1UP5 A;  1X02 A;  1SPY A;  1GJY A;  1SYM A;  3NSI A;  4C0L A;  1DVI A;  2JPT A;  1F4O A;  3D73 A;  2L5Y A;  2LP2 A;  2OTG B;  3LL8 B;  3CWG A;  5K89 A;  2K7C A;  2COL B;  3I5F B;  3ZNI A;  3D78 A;  4OR9 B;  3BFA A;  1XFV O;  1QLS A;  3UO9 A;  1XO5 A;  1BJF A;  2NCP A;  4TNC A;  1IKU A;  1SKT A;  4AQJ A;  1CKK A;  1DMO A;  3OP0 A;  2R2I A;  2MAZ A;  1H4B A;  4ZCV A;  1JF0 A;  2BL0 B;  1XFW O;  2OPO A;  1TIZ A;  2H8V A;  1SL9 A;  2BE6 A;  2JRF A;  2JNX A;  2M29 A;  2OS8 B;  3AKA A;  3OB1 B;  3FE8 A;  1KSM A;  2LVI A;  1WDC C;  4INX A;  2MLE C;  3TDI A;  4AOM A;  4YGE B;  3O6B A;  1TN4 A;  1PVA A;  1BU3 A;  4N1F A;  2KI6 D;  1MQ1 A;  1YX8 A;  3EVV A;  1TNX A;  2F2P A;  3FE9 A;  3DF0 A;  4CFQ A;  1PVB A;  3R1O A;  4ORB B;  1Y1A A;  1KCY A;  4YRU A;  1DJW A;  4PCW A;  1Z4H A;  2PMY A;  3D77 A;  2GGZ A;  4DS7 A;  4JQ0 D;  1CLM A;  4QJ4 B;  1OSA A;  4CLN A;  1CFC A;  1A75 A;  2KFH A;  3FE6 A;  3BJH A;  1M46 A;  3C1V A;  3PAT A;  2F2O A;  3I5H C;  2M0R A;  1DF0 B;  4A4B A;  2V53 A;  4P2Y B;  2KI4 C;  1L2O B;  1BF5 A;  5DIC A;  4PHK A;  3OB2 B;  4MN0 A;  2O5G A;  2QEB A;  5ER5 A;  3RM1 A;  1SR6 C;  1FI5 A;  2HET A;  1XFX O;  2LMT A;  3PSR A;  3QME A;  2L5X B;  1PUL A;  1XFR A;  1IIO A;  1KFU L;  3D0Y A;  1XK4 A;  3B87 A;  3BYA A;  2WND A;  3CAB A;  3DZT A;  2G9B A;  3S0G A;  3O78 A;  2KLE A;  3CZT X;  1DGV A;  1RTP 1;  1SK6 D;  2KQ6 A;  2LCP A;  2MRD A;  2PVB A;  4YBH B;  1EJ3 A;  1WLZ A;  3D10 A;  4MBE A;  1B7T Z;  2K0J A;  1J1E A;  2ZNE A;  5IBW A;  1HQV A;  1HT9 A;  2MLF C;  1TCF A;  1CLB A;  1NYA A;  1C7V A;  1N2D A;  1C7W A;  4JPZ B;  2JTT A;  3S0D A;  3E3R A;  2KDH A;  4DIR A;  1DT7 B;  2KBM A;  4ORA B;  3VGO A;  1Z2C B;  1NPQ A;  2SCP A;  3IF7 A;  1B1G A;  4E68 A;  4USL A;  2ZFD A;  1UHK A;  2GTE A;  1EL4 A;  5G08 A;  4GFT A;  1ODB A;  2K2A A;  1C3Z A;  2KOT A;  1RK9 A;  1RWY A;  1KWO C;  1YUR A;  2H61 A;  5TNC A;  5HLO A;  1REC A;  2WC5 A;  3OHM B;  3Q8I A;  1E8A A;  1BT6 A;  3D76 A;  2F33 A;  3V2L A;  4KYN A;  1TUZ A;  1CMG A;  1KFX S;  1S26 D;  1TUJ A;  2K61 A;  3M0W A;  1H8B A;  1IQ3 A;  2K8M B;  2KSP A;  2BEC A;  1ZMZ A;  1M45 A;  5I2L A;  3PLF B;  2I18 A;  3CZ2 A;  3TUY B;  2KQY A;  4IJ7 A;  5D7F A;  3BFB A;  3RLZ A;  1SY9 A;  2WC8 A;  1U5I B;  3DVE A;  4PE0 A;  1NX2 A;  1OOG A;  2LC5 A;  1OMV A;  3BOW B;  2BNX A;  1Y1X A;  3SJS A;  1B8C A;  2BE4 A;  4L9M A;  1S1E A;  1F8H A;  3AAJ A;  1DJZ A;  2M3W A;  4PE4 A;  1J7P A;  2TN4 A;  1J1D A;  3L4L A;  1XVJ A;  1S3P A;  2DOQ A;  1JBA A;  1XYD A;  3EK4 A;  1J7O A;  1F71 A;  1OMR A;  1YRT B;  4XJK A;  4ICB A;  4HRH A;  1IGV A;  2LV7 A;  1BOD A;  1OOF A;  1Y0V H;  5I8N A;  1FBV A;  5HYD A;  2SAS A;  3I5H B;  4MLW A;  2L2C A;  2Y1N A;  2ZRS A;  3ZWH A;  2PAS A;  1TCO B;  1RJV A;  2JNF A;  2KI4 B;  2HQW A;  4XYN A;  4YI8 A;  3B86 A;  1AJ4 A;  1XFY O;  1XK4 C;  2KGB C;  1CLL A;  2WOR A;  1W9Z A;  2L2E A;  2Q4U A;  2PAL A;  1G33 A;  3HCM A;  1K8U A;  1ALW A;  3SG2 A;  1GGW A;  2EGD A;  2L98 A;  1G4Y R;  1QAT A;  4CID A;  2ERB A;  3SIB A;  1BR1 B;  1JWD A;  5CSF A;  2AAO A;  3KPX A;  1P28 A;  2CTN A;  4WRI A;  2LUC A;  4PDZ A;  3JVT C;  3PJI A;  2ZRT A;  1NX0 A;  3CTN A;  2E6W A;  1JFK A;  4Q04 A;  1QX5 B;  3DVK A;  1DQE A;  4OVN F;  5HKW A;  1TWO A;  1UHJ A;  1VRK A;  1XFU O;  3TZ1 A;  1ZFS A;  4MVF A;  5ER4 X;  1OOJ A;  2KFF A;  3K1E A;  2LNK A;  1OMD A;  1OQP A;  5DKR A;  3S0E A;  3LK1 A;  5HKZ A;  2AMI A;  1TNW A;  3DXL A;  1C07 A;  3CZ1 A;  2H61 C;  4OCI A;  3RZS A;  4I5L B;  1ZOT B;  1QLK A;  4M2Q A;  1CNP A;  4MRY A;  2FCE A;  1DEK A;  1Y1U A;  2BKI B;  2PRU A;  1LA3 A;  1KWO B;  2LHI A;  1BG1 A;  1A2X A;  2I7A A;  2JOJ A;  3PN7 C;  2PSR A;  1FI6 A;  1SCM C;  1UUR A;  5I2O A;  1QTX A;  4BY4 A;  1IG5 A;  1LIN A;  3OBV A;  2BKH B;  3WHU B;  1B8R A;  4GAO A;  4CPV A;  1V1G A;  4PE1 A;  2KFG A;  1F70 A;  3OGN A;  1OOI X;  1A4P A;  1B9A A;  1S5G Z;  2M1U A;  2M49 B;  2NZ0 A;  1M63 B;  1DF0 A;  5FYX A;  1G8I A;  2ZN8 A;  1AP4 A;  2QEV A;  4N1G A;  1QVI Y;  3NSO A;  3IVT A;  2JT0 A;  1DGU A;  4ZCU A;  2L51 A;  5AER A;  3PM2 A;  4JD9 A;  1JF2 A;  4IL1 A;  3TS5 B;  2NXQ A;  3EK8 A;  4NDC A;  5DKQ A;  2F8P A;  1YVH A;  5AEQ A;  3VRP A;  3NGV A;  5I94 A;  3B7A A;  2GGM A;  1NX3 A;  1QS7 A;  4MRX A;  1NCX A;  2B1U A;  1KFU S;  2LLU A;  3LCP C;  3S0B A;  2BAP A;  1A03 A;  2BBM A;  5CSI A;  1C3Y A;  3DVJ A;  1R2U A;  1CB1 A;  5CSJ A;  2KBI A;  1AUI B;  1EXR A;  2M7N A;  3CR2 A;  3EKH A;  3VRR A;  3SG4 A;  2CXJ A;  3D0Y B;  1ZAC A;  1YX7 A;  3LLE A;  3CR5 X;  1FW4 A;  1RRO A;  2LE9 B;  4C0J A;  1A29 A;  2JC2 A;  2LM5 A;  3K21 A;  3KEV A;  3GK4 X;  2WCL A;  3BFH A;  1K95 A;  4I5K A;  1OZO A;  2K2F A;  1JFJ A;  1XFZ O;  1IJ6 A;  1MHO A;  3CGA A;  1KK7 Z;  2LVJ A;  3EG5 B;  1YR5 A;  4AQI A;  2QEO A;  3JVT B;  1JUO A;  4R1E A;  1WY9 A;  2WOS A;  2E30 A;  1NX1 A;  2H2K A;  4QJ5 B;  1N0Y A;  2OS8 C;  3OX6 A;  1B8L A;  5HL1 A;  4MZK A;  4MZL A;  3SG3 A;  1ALV A;  1IWQ A;  3ICB A;  1K90 D;  1K93 D;  1WDC B;  1S6C A;  1F4Q A;  1SL7 A;  1TNQ A;  1AHR A; 
#chains in the Genus database with same CATH homology
 1Y6W A;  2K7O A;  1WLM A;  3CS1 A;  4DUQ A;  1K9K A;  2CT9 A;  1EG3 A;  1U5I A;  3DVM A;  3CLN A;  1UWO A;  4YGB B;  2JZI A;  1SW8 A;  2IS9 A;  1YUT A;  2HF5 A;  3BOW A;  3EVR A;  4WQ3 A;  1M39 A;  3PN7 B;  1KQM C;  2GV5 A;  4M2O A;  1B47 A;  3SG6 A;  4F0Z B;  2L50 A;  2JWW A;  1UHI A;  4YGA A;  1QX7 A;  1TOP A;  1SCM B;  3A4U B;  1CDN A;  1UHH A;  5HKY A;  1BMO A;  2NLN A;  3EK7 A;  3EVU A;  4GUK A;  1NWD A;  1LVC D;  1BR4 B;  1QXP A;  1QV1 A;  2KHN A;  2LAP A;  3BQ3 A;  5J3X A;  2WCE A;  1N65 A;  3BUN B;  1DTL A;  2D8N A;  3KF9 A;  1F55 A;  1SR6 B;  2F3Y A;  4BY5 A;  3I5I C;  1K2H A;  1SBJ A;  3BUO B;  2QPT A;  4PAL A;  4XJK B;  2M9G A;  2O60 A;  5F6T A;  5CPV A;  5JJG A;  1SMG A;  2ZKM X;  1YVL A;  1UUS A;  4DCK A;  4DRW A;  1W7J B;  3IQO A;  1CDL A;  1S6J A;  3AKB A;  3OX5 A;  5AFP A;  2EC6 C;  2CNP A;  2NCO A;  1CFD A;  1AVS A;  2KAX A;  3GK2 A;  1CMF A;  2F3Z A;  4PHJ A;  1FPW A;  3PFV A;  3GOF A;  4I5N B;  3PM8 A;  3O4Y A;  3AAK A;  1KQV A;  2BCA A;  2M7L A;  1CFP A;  4UPG A;  2Q91 A;  1KK8 C;  1QVI Z;  4HRG A;  3DD4 A;  4NDD A;  5B8I B;  4QJ3 B;  1CDP A;  3JTD C;  4NQG A;  2L0P A;  2RGI A;  3BXK A;  3IQQ A;  1S6I A;  1XA5 A;  3QRX A;  1AJ5 A;  3I5G C;  1K9U A;  4MEW A;  2KAY A;  1YUU A;  1QX2 A;  3NXA A;  2HQ8 A;  2LLS A;  3KHE A;  1WRL A;  1Q80 A;  4YI9 A;  2MBX A;  1IRJ A;  1GQM A;  1DJY A;  2Y1M A;  4HSZ A;  2BCB A;  3TDU A;  1QIW A;  3HX4 A;  4GGF A;  1SCV A;  1PSB A;  1DJG A;  4I5J A;  3VRO A;  4D1E A;  2MHH A;  3TUY C;  4FTG A;  1PRW A;  1QIV A;  5KSZ A;  3DF0 B;  3LK0 A;  1TTX A;  2CBL A;  1BOC A;  2I94 A;  3VRN A;  4HRE E;  3O2P A;  1UHN A;  2JUL A;  2JTZ A;  1JSA A;  1KQM B;  1TNP A;  4A4C A;  4U8D A;  4PE7 A;  1A75 B;  2HPS A;  3SG7 A;  2KI6 C;  4WQ2 A;  1NSH A;  2ZND A;  4YGC B;  5HLV A;  1IJ5 A;  3SG5 A;  1IH0 A;  4MSP A;  4ORC B;  1YUS A;  5KTY A;  1J7Q A;  2LHL A;  2CCM A;  1PK0 D;  5KU1 A;  1JC2 A;  2MJW B;  1S36 A;  3BUM B;  1NUB A;  2KAV A;  2KYF A;  2P6B B;  1K9P A;  1TRF A;  1SNL A;  2M8U A;  1NCZ A;  4ETO A;  2KYC A;  3WNX B;  3I5I B;  1QV0 A;  2A4J A;  2MA2 A;  2OTG C;  1CTR A;  1MWN A;  1QAS A;  1EH2 A;  1OE9 B;  3MSE B;  3I5F C;  3NSK A;  1K94 A;  4JWQ A;  3FIA A;  2JU0 A;  1B4C A;  3CR4 X;  4GNK B;  5D69 A;  4GGN A;  2LVK A;  3EKJ A;  3NSL A;  1WRZ A;  2LUX A;  2EC6 B;  1F54 A;  1PSR A;  1QJT A;  5AXI A;  2BL0 C;  5I2Q A;  4FQO A;  2AUC A;  2WCB A;  2JXC A;  1MF8 B;  2K7B A;  1M31 A;  4M2P A;  1MR8 A;  1D1O A;  3FWC A;  1KK8 B;  2KNE A;  4OV2 A;  2FJU B;  2LMU A;  4NDB A;  3SIA A;  3PAL A;  1S5G Y;  3JTD B;  1KFX L;  1MXL C;  1MXE A;  2QAC A;  5JOL A;  1NIW A;  1SRA A;  1V1F A;  1KSO A;  2ISD A;  2JT8 A;  2L4H A;  3I5G B;  1WRK A;  1DJX A;  1BLQ A;  1CDM A;  1NCY A;  1OZS A;  4GPL B;  2L4I A;  2JT3 A;  3GK1 A;  4GGF C;  1SL8 A;  2JXL A;  1AK8 A;  5DKN A;  1NP8 A;  2LP3 A;  2M97 A;  2VRG A;  4P5O E;  1DJH A;  1B7T Y;  1GGZ A;  3F45 A;  1EG4 A;  3BUX B;  1DJI A;  1CM4 A;  2KGR A;  3WHT B;  2LLT A;  3FWB A;  2K7D A;  1J7R A;  2FCD A;  5AAN A;  2BCX A;  1YTZ C;  3TDZ A;  2I2R E;  1L2O C;  5CSN A;  1L7Z A;  4PHN A;  2LAN A;  1FF1 A;  1CM1 A;  2ZN9 A;  2EHB A;  2JQ6 A;  1IQ5 A;  1LA0 A;  1LKJ A;  1ZUZ A;  1YRU B;  1W7I B;  2LVV A;  5GQQ C;  1J55 A;  1RFJ A;  3A8R A;  2G2B A;  3TS5 C;  1K96 A;  3BUW B;  1KK7 Y;  2BBN A;  2Y4Q A;  4MZJ A;  5PAL A;  3KO0 A;  1CFF A;  1LXF C;  3WXA A;  2LMV A;  4GBA A;  1MUX A;  2WCF A;  4YGD B;  1R6P A;  4OKH A;  3VRQ A;  1PAL A;  5BPJ A;  4N5X A;  4CFR A;  2M1K B;  2Y5I A;  3FS7 A;  4PHM A;  3H4S E;  2FOT A;  4C0K A;  1UP5 A;  1X02 A;  1SPY A;  1GJY A;  1SYM A;  3NSI A;  4C0L A;  1DVI A;  2JPT A;  1F4O A;  2LP2 A;  2OTG B;  3LL8 B;  3CWG A;  5K89 A;  2K7C A;  2COL B;  3I5F B;  3ZNI A;  4OR9 B;  1XFV O;  1QLS A;  1XO5 A;  1BJF A;  2NCP A;  4TNC A;  1IKU A;  1SKT A;  4AQJ A;  1CKK A;  1DMO A;  3OP0 A;  2R2I A;  2MAZ A;  1H4B A;  4ZCV A;  1JF0 A;  2BL0 B;  1XFW O;  2OPO A;  1TIZ A;  1SL9 A;  2BE6 A;  2JRF A;  2JNX A;  2M29 A;  2OS8 B;  3AKA A;  3OB1 B;  1KSM A;  2LVI A;  1WDC C;  2MLE C;  3TDI A;  4AOM A;  4YGE B;  3O6B A;  1TN4 A;  1PVA A;  1BU3 A;  4N1F A;  2KI6 D;  1MQ1 A;  1YX8 A;  3EVV A;  1TNX A;  2F2P A;  4CFQ A;  3DF0 A;  1PVB A;  4ORB B;  1Y1A A;  1KCY A;  4YRU A;  1DJW A;  4PCW A;  2PMY A;  2GGZ A;  4DS7 A;  4JQ0 D;  1CLM A;  4QJ4 B;  1OSA A;  4CLN A;  1CFC A;  1A75 A;  2KFH A;  1M46 A;  3C1V A;  3PAT A;  2F2O A;  3I5H C;  2M0R A;  1DF0 B;  4A4B A;  2V53 A;  4P2Y B;  2KI4 C;  1L2O B;  1BF5 A;  4PHK A;  3OB2 B;  4MN0 A;  2O5G A;  5ER5 A;  3RM1 A;  1FI5 A;  1SR6 C;  2HET A;  1XFX O;  2LMT A;  3PSR A;  2L5X B;  1PUL A;  1KFU L;  3D0Y A;  1XK4 A;  3BYA A;  2WND A;  2G9B A;  3O78 A;  3CZT X;  1DGV A;  1RTP 1;  1SK6 D;  2KQ6 A;  2LCP A;  2MRD A;  2PVB A;  4YBH B;  1EJ3 A;  1WLZ A;  3D10 A;  4MBE A;  1B7T Z;  2K0J A;  1J1E A;  2ZNE A;  5IBW A;  1HQV A;  1HT9 A;  2MLF C;  1TCF A;  1CLB A;  1NYA A;  1C7V A;  1N2D A;  1C7W A;  4JPZ B;  2JTT A;  3E3R A;  2KDH A;  4DIR A;  1DT7 B;  2KBM A;  4ORA B;  3VGO A;  1NPQ A;  2SCP A;  3IF7 A;  1B1G A;  4E68 A;  4USL A;  2ZFD A;  1UHK A;  1EL4 A;  5G08 A;  4GFT A;  1ODB A;  2K2A A;  2KOT A;  1RK9 A;  1RWY A;  1KWO C;  1YUR A;  2H61 A;  5TNC A;  5HLO A;  1REC A;  3OHM B;  1E8A A;  1BT6 A;  2F33 A;  1CMG A;  1KFX S;  1S26 D;  2K61 A;  3M0W A;  1H8B A;  1IQ3 A;  2K8M B;  2KSP A;  2BEC A;  1ZMZ A;  1M45 A;  5I2L A;  3PLF B;  2I18 A;  3TUY B;  2KQY A;  5D7F A;  3RLZ A;  1SY9 A;  2WC8 A;  1U5I B;  3DVE A;  4PE0 A;  1NX2 A;  2LC5 A;  1OMV A;  3BOW B;  1Y1X A;  3SJS A;  1B8C A;  2BE4 A;  4L9M A;  1S1E A;  1F8H A;  3AAJ A;  1DJZ A;  2M3W A;  4PE4 A;  1J7P A;  2TN4 A;  1J1D A;  1XVJ A;  1S3P A;  2DOQ A;  1JBA A;  1XYD A;  3EK4 A;  1J7O A;  1F71 A;  1OMR A;  1YRT B;  4XJK A;  4ICB A;  4HRH A;  1IGV A;  2LV7 A;  1BOD A;  1Y0V H;  5I8N A;  1FBV A;  5HYD A;  2SAS A;  3I5H B;  4MLW A;  2Y1N A;  2ZRS A;  3ZWH A;  2PAS A;  1TCO B;  1RJV A;  2JNF A;  2KI4 B;  2HQW A;  4XYN A;  4YI8 A;  1AJ4 A;  1XFY O;  1XK4 C;  2KGB C;  1CLL A;  2WOR A;  2L2E A;  2Q4U A;  2PAL A;  1G33 A;  3HCM A;  1K8U A;  1ALW A;  3SG2 A;  1GGW A;  2EGD A;  2L98 A;  1G4Y R;  1QAT A;  4CID A;  3SIB A;  1BR1 B;  1JWD A;  5CSF A;  2AAO A;  3KPX A;  4WRI A;  2CTN A;  2LUC A;  4PDZ A;  3JVT C;  2ZRT A;  1NX0 A;  3CTN A;  2E6W A;  1JFK A;  4Q04 A;  1QX5 B;  3DVK A;  4OVN F;  5HKW A;  1UHJ A;  1XFU O;  1VRK A;  3TZ1 A;  1ZFS A;  4MVF A;  5ER4 X;  1OOJ A;  2KFF A;  2LNK A;  1OMD A;  1OQP A;  5DKR A;  3LK1 A;  5HKZ A;  2AMI A;  1TNW A;  1C07 A;  2H61 C;  4OCI A;  1CNP A;  4I5L B;  1ZOT B;  1QLK A;  4M2Q A;  4MRY A;  2FCE A;  1Y1U A;  2BKI B;  2PRU A;  1LA3 A;  1KWO B;  2LHI A;  1BG1 A;  1A2X A;  2I7A A;  2JOJ A;  3PN7 C;  2PSR A;  1FI6 A;  1SCM C;  1UUR A;  5I2O A;  1QTX A;  4BY4 A;  1IG5 A;  1LIN A;  2BKH B;  3WHU B;  1B8R A;  4GAO A;  4CPV A;  1V1G A;  4PE1 A;  2KFG A;  1F70 A;  1A4P A;  1B9A A;  1S5G Z;  2M1U A;  2M49 B;  2NZ0 A;  1M63 B;  1DF0 A;  5FYX A;  1G8I A;  2ZN8 A;  1AP4 A;  4N1G A;  1QVI Y;  3NSO A;  2JT0 A;  1DGU A;  4ZCU A;  2L51 A;  5AER A;  1JF2 A;  4IL1 A;  3TS5 B;  2NXQ A;  3EK8 A;  4NDC A;  5DKQ A;  2F8P A;  1YVH A;  5AEQ A;  3VRP A;  2GGM A;  1NX3 A;  1QS7 A;  4MRX A;  1NCX A;  2B1U A;  1KFU S;  2LLU A;  3LCP C;  1A03 A;  2BBM A;  5CSI A;  3DVJ A;  1R2U A;  1CB1 A;  5CSJ A;  2KBI A;  1AUI B;  1EXR A;  2M7N A;  3CR2 A;  3EKH A;  3VRR A;  3SG4 A;  2CXJ A;  3D0Y B;  1ZAC A;  1YX7 A;  3LLE A;  3CR5 X;  1FW4 A;  1RRO A;  2LE9 B;  4C0J A;  1A29 A;  2JC2 A;  2LM5 A;  3K21 A;  3KEV A;  3GK4 X;  1K95 A;  4I5K A;  1OZO A;  2K2F A;  1JFJ A;  1XFZ O;  1IJ6 A;  1MHO A;  3CGA A;  1KK7 Z;  2LVJ A;  1YR5 A;  4AQI A;  3JVT B;  1JUO A;  4R1E A;  1WY9 A;  2WOS A;  2E30 A;  1NX1 A;  2H2K A;  4QJ5 B;  1N0Y A;  2OS8 C;  3OX6 A;  1B8L A;  4MZK A;  4MZL A;  3SG3 A;  1ALV A;  1IWQ A;  3ICB A;  1K90 D;  1K93 D;  1WDC B;  1S6C A;  1F4Q A;  1SL7 A;  1TNQ A;  1AHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...