2D8NA

Crystal structure of human recoverin at 2.2 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Recoverin
publication title Crystal structure of human recoverin at 2.2 A resolution
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 67
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2d8nA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2d8nA01
2JTTA 1QV0A 1SR6C 3FWBA 1M39A 1PALA 3IQQA 1JSAA 1K96A 5HKZA 5CPVA 2BBNA 1U5IA 1OMVA 1WLZA 2A4JA 2CCMA 3FWCA 1NWDA 1PSRA 5D69A 1WDCC 2JXCA 2KAYA 4MLWA 1NIWA 3AAJA 2BE6A 3KPXA 1AJ5A 4I5JA 2M8UA 3GK1A 2M97A 3NSKA 4M2OA 2K0JA 1BOCA 1KK7Z 1YX8A 4HRHA 2FJUB 1F54A 2LVJA 2JZIA 2LNKA 1IWQA 2K7OA 2LAPA 2M7NA 1K9UA 1A03A 2OPOA 2H2KA 1IRJA 4P2YB 1AUIB 1GGZA 3BUWB 1NCXA 4XYNA 3HX4A 2ZN8A 5AXIA 1YTZC 2OS8C 1NSHA 2CTNA 3C1VA 4GPLB 2LLTA 1G33A 4OVNF 4XJKB 2SCPA 2KAVA 1RTP1 3TS5B 1KCYA 1RROA 4GGFA 3OX6A 1N2DA 1R6PA 2JPTA 4QJ5B 4PE4A 3JVTB 1ALWA 3D0YB 4PHMA 3WNXB 1SRAA 1LXFC 4YGCB 1RECA 2L51A 2JT3A 1KK8B 1OSAA 3OX5A 1CMFA 3EVVA 1CM1A 4N1GA 1LA3A 4NDBA 2Y5IA 5D7FA 1GJYA 4CIDA 1DMOA 1S6JA 1IH0A 1XFVO 2I18A 1KSMA 3EVRA 4MSPA 1Q80A 4MZKA 1J7PA 1CDPA 3NSOA 1SR6B 1B47A 1KWOC 3PN7C 4PE7A 1NCYA 2H61C 2BL0C 4I5KA 1U5IB 3FS7A 1KK7Y 1IJ6A 4IL1A 2O60A 1JUOA 4GAOA 2JTZA 2LCPA 5HKYA 2OTGB 1YR5A 2B1UA 2F2PA 1DJZA 1A29A 2PASA 4BY5A 1D1OA 2KBIA 1A75A 2L2EA 3SIAA 1FBVA 2NLNA 3BUNB 3E3RA 3WHUB 1TCFA 4A4BA 1CDNA 2KI6D 3WXAA 1BG1A 1F8HA 2KHNA 2KYFA 2AAOA 1CMGA 1SCVA 1PK0D 1DJWA 1XK4C 4GGNA 2BCXA 1KFUS 1SY9A 1UHKA 2NCOA 1XFYO 1M46A 1TRFA 1NUBA 1QJTA 2ZKMX 4F0ZB 5KTYA 1CB1A 2LVVA 1RK9A 2HPSA 4M2QA 5JOLA 2KQ6A 4HRGA 4OV2A 1B8LA 1TCOB 1SNLA 3BUOB 1FI5A 2LUXA 2M1UA 1CFCA 1IKUA 2HF5A 1PULA 4PALA 4PDZA 1ALVA 1LKJA 2BECA 3NSLA 1IQ3A 5DKRA 3GK4X 3TS5C 2FOTA 4PE1A 1XFWO 2PSRA 3EVUA 3DVKA 4GFTA 3CS1A 5CSFA 3WHTB 1S3PA 3VROA 1FPWA 3JVTC 1QIWA 4TNCA 2ZRTA 2M1KB 2K8MB 3VRRA 1OE9B 1XFXO 1HT9A 1RWYA 3EK8A 1NX1A 2Y1MA 2JT8A 2KBMA 1V1FA 2JU0A 2BE4A 1OOJA 2WORA 2K2FA 4I5LB 1DF0B 1MHOA 1OZSA 1UHNA 1CFFA 2JULA 1J7RA 3BUXB 1J1EA 2LVIA 3NSIA 2NXQA 1CM4A 3I5IB 1TTXA 1DGUA 2HQWA 1AVSA 5HYDA 2GV5A 1V1GA 2LANA 3DVJA 1FW4A 3EK7A 2WC8A 1M31A 1X02A 2O5GA 3SG5A 4YGBB 1VRKA 5FYXA 2F2OA 4ZCVA 1S1EA 2MLFC 2EC6C 1UURA 5HLVA 2WNDA 1KSOA 1QXPA 2M3WA 2OTGC 3BOWB 4PHJA 4DIRA 1BU3A 4DS7A 1B1GA 1H4BA 3KHEA 2LVKA 4HREE 1PRWA 2LP3A 2M9GA 1E8AA 3JTDB 1MQ1A 3RLZA 2KNEA 3DF0A 1UHJA 2JNFA 4Q04A 3SG4A 1WLMA 2IS9A 4ICBA 1LVCD 2SASA 2KGBC 3SG7A 1AP4A 2LE9B 1ODBA 4MVFA 1J7OA 4MN0A 3NXAA 2KOTA 4WQ2A 4YGAA 2ISDA 2K7CA 2LMTA 2LV7A 1S6IA 3LK1A 1CDMA 3ZWHA 4NQGA 4C0JA 3HCMA 1ZUZA 2LHLA 2PRUA 1JC2A 3I5HB 4GGFC 3OB1B 1QVIZ 2ZNEA 1SW8A 1M63B 1MF8B 2BKIB 2JNXA 2KYCA 2TN4A 1DJYA 1AJ4A 2BCBA 3PFVA 5F6TA 1KFUL 1Y1AA 2F8PA 4E68A 2F3YA 2KAXA 4JWQA 1YX7A 2KDHA 4PCWA 3SG6A 1F4OA 3O78A 2JQ6A 2CNPA 1TNPA 1IQ5A 2WOSA 4MRYA 1FI6A 1H8BA 2FCDA 5AEQA 2KQYA 1S26D 4DUQA 1UP5A 2KI4C 5CSNA 2P6BB 3BUMB 3VGOA 3D10A 1EJ3A 1Y0VH 3TDIA 1NCZA 1L2OB 1NP8A 2MRDA 2ZRSA 3I5IC 4CFRA 4AQIA 2G2BA 5DKNA 4MBEA 4R1EA 3VRPA 3AKAA 1BR4B 1SL8A 1DTLA 3CR2A 1YUUA 3BQ3A 1CKKA 4M2PA 3O2PA 4ORAB 2EC6B 1KQMC 2JOJA 1EXRA 5JJGA 1BF5A 2KFGA 2E30A 3M0WA 1DGVA 2QACA 2KGRA 1C7WA 5ER5A 3RM1A 1DJIA 2EHBA 4D1EA 1B4CA 4N1FA 4GNKB 3DF0B 3LK0A 3GOFA 1YVLA 3CWGA 1R2UA 2L4HA 1JFJA 1BT6A 1QVIY 1S36A 1C7VA 4ORBB 1K9PA 2CXJA 4ETOA 1OZOA 1K94A 2HQ8A 4OKHA 2GGZA 1K93D 3JTDC 3FIAA 2K7DA 2ZN9A 4L9MA 1PVBA 1TN4A 2M7LA 1Y1XA 2I2RE 2K2AA 1G8IA 1S6CA 3K21A 2L98A 1YRTB 1TNWA 1QATA 1DJHA 1B8CA 1ZFSA 1YURA 1KFXS 4OR9B 5B8IB 1DT7B 1QIVA 2R2IA 2Y4QA 4YBHB 3PLFB 1YRUB 1JBAA 2BCAA 5I2LA 1SCMB 2JWWA 3I5HC 2Y1NA 3VRNA 3BYAA 4DRWA 1WY9A 2DOQA 1OMDA 1GQMA 2K61A 2WCEA 1TOPA 3IQOA 2WCFA 2K7BA 1YVHA 4FTGA 2LMUA 4YRUA 1N65A 2I94A 1XA5A 3CZTX 1SK6D 2MJWB 4PHKA 1CLBA 2KI4B 1QLKA 4CLNA 1CLMA 2PALA 1J1DA 2KFFA 1IJ5A 1J7QA 1SL9A 1S5GY 3TZ1A 3O4YA 5IBWA 2L0PA 4WQ3A 1Y1UA 3CR4X 2LHIA 4OCIA 1W7JB 1L2OC 5AERA 1KQMB 3DVMA 1A75B 3D0YA 3SJSA 1YUTA 4QJ3B 2MBXA 1FF1A 1XFUO 1QS7A 5HLOA 3ICBA 2G9BA 1G4YR 1OMRA 1TNQA 3OB2B 4P5OE 5K89A 1EG4A 1UHHA 3IF7A 1B8RA 5BPJA 5HKWA 3LLEA 1IGVA 2HETA 1A4PA 4N5XA 1RJVA 3H4SE 4ORCB 1C07A 1ZOTB 1QX5B 2CT9A 2JC2A 1K9KA 1K90D 5CSJA 2F33A 4GUKA 3MSEB 4AOMA 3O6BA 1UHIA 1MR8A 3AAKA 1PSBA 1QV1A 4DCKA 3I5FB 1BODA 4MEWA 5AANA 1CDLA 2FCEA 3LCPC 1EH2A 1MXEA 1SL7A 1LA0A 1SYMA 2BBMA 2VRGA 1CFPA 2COLB 3CR5X 3LL8B 2CBLA 4CFQA 1SCMC 2RGIA 2V53A 1A2XA 1NX2A 1MXLC 3KEVA 1ZMZA 1B7TZ 1WRZA 2LLSA 3KO0A 4QJ4B 4YI9A 3TUYB 2WCBA 4MRXA 1KFXL 1TIZA 1NX0A 2NCPA 3KF9A 1LINA 2L5XB 1MWNA 1W7IB 2NZ0A 4ZCUA 3QRXA 2KSPA 1F70A 1UWOA 1XYDA 2EGDA 2M0RA 4JQ0D 1DJGA 1WRLA 3PATA 4YGEB 2PVBA 1JWDA 1YUSA 4USLA 3PM8A 2L4IA 3TDZA 1NPQA 2ZFDA 1JFKA 3CTNA 1L7ZA 1QASA 2LP2A 1SKTA 3A4UB 1J55A 5ER4X 2PMYA 3SIBA 2BKHB 3I5GB 4JPZB 1CNPA 2D8NA 1QX2A 3DVEA 4I5NB 4WRIA 3ZNIA 4YI8A 3TDUA 1F71A 1S5GZ 2MLEC 4MZLA 4NDDA 3F45A 2LM5A 3SG2A 3VRQA 1PVAA 1RFJA 3OP0A 1DF0A 5KU1A 2LC5A 3A8RA 2GGMA 1OQPA 3SG3A 4HSZA 2H61A 1BMOA 1NYAA 2F3ZA 3OHMB 1KQVA 1AHRA 1Y6WA 1K2HA 1JF2A 1NX3A 1B7TY 2I7AA 4MZJA 2M29A 3EKJA 5I2OA 1CLLA 2E6WA 1WDCB 1ZACA 2M49B 3EKHA 5AFPA 1SBJA 1K95A 1IG5A 2JXLA 3I5FC 1XO5A 3PALA 3GK2A 1QX7A 2MAZA 3BOWA 2AMIA 2Q4UA 4GBAA 2LUCA 4UPGA 5PALA 1M45A 1TNXA 5G08A 4YGDB 4U8DA 1XK4A 1BJFA 1AK8A 3CLNA 2MA2A 1GGWA 1K8UA 4AQJA 2OS8B 1SPYA 1JF0A 2ZNDA 1HQVA 1MUXA 1CFDA 2KI6C 2MHHA 1SMGA 5KSZA 3TUYC 2JRFA 3CGAA 1WRKA 2JT0A 1BLQA 1DVIA 1QTXA 1QLSA 4PE0A 5CSIA 4XJKA 4NDCA 4A4CA 5I8NA 4CPVA 3PSRA 5GQQC 2QPTA 2Q91A 4BY4A 1N0YA 1EG3A 1EL4A 1CTRA 5DKQA 1XFZO 2LMVA 1DJXA 1KK8C 1UUSA 1B9AA 3AKBA 4FQOA 4PHNA 4C0KA 1F4QA 1BR1B 3I5GC 5I2QA 2KFHA 1XVJA 2AUCA 3DD4A 3BXKA 1KWOB 3PN7B 2BL0B 3EK4A 2LLUA 5J3XA 2L50A 5TNCA 1F55A 4C0LA
chains in the Genus database with same CATH superfamily
2JTTA 1QV0A 1SR6C 3FWBA 1M39A 1PALA 3BFBA 3IQQA 1JSAA 1K96A 4KYNA 5CPVA 5HKZA 2BBNA 1U5IA 1OMVA 3D73A 2QEVA 1Z2CB 1WLZA 3RZSA 3CZ1A 2A4JA 2CCMA 3FWCA 5FI2A 2WCJA 1NWDA 1PSRA 5D69A 1WDCC 2JXCA 2KAYA 4MLWA 5FI7A 1NIWA 3AAJA 2BE6A 3KPXA 1AJ5A 4I5JA 2M8UA 3GK1A 2M97A 3NSKA 4M2OA 2K0JA 1BOCA 2QEBA 1KK7Z 1YX8A 4HRHA 2FJUB 1F54A 2LVJA 2WCHA 2JZIA 2LNKA 1IWQA 2PYQA 3SS5A 2K7OA 2LAPA 2M7NA 1K9UA 1A03A 2OPOA 2H2KA 2KPHA 1IRJA 4P2YB 1AUIB 1GGZA 3BUWB 1NCXA 4XYNA 3HX4A 2ZN8A 5AXIA 1YTZC 2OS8C 1NSHA 2CTNA 4FQTA 3C1VA 4GPLB 2LLTA 5D3OA 1G33A 4OVNF 4JKTA 4XJKB 1C3ZA 2SCPA 2KAVA 1RTP1 3TS5B 1KCYA 1RROA 4GGFA 1TUJA 1N2DA 1R6PA 3OX6A 2JPTA 4QJ5B 4PE4A 3JVTB 1ALWA 3D0YB 4PHMA 3WNXB 1SRAA 1LXFC 4YGCB 1RECA 2L51A 2JT3A 1KK8B 1OSAA 3OX5A 1CMFA 3EVVA 1CM1A 4N1GA 1SSEB 1LA3A 4NDBA 3D74A 2Y5IA 5D7FA 1GJYA 1T14A 2WCKA 4CIDA 1DMOA 1S6JA 1IH0A 1C3YA 1XFVO 3B7AA 2I18A 1KSMA 3EVRA 4MSPA 1Q80A 4MZKA 1J7PA 1CDPA 3NSOA 1SR6B 1B47A 1KWOC 3PN7C 4PE7A 1NCYA 2H61C 2BL0C 4I5KA 1U5IB 3FS7A 1KK7Y 1IJ6A 4IL1A 2O60A 1JUOA 4GAOA 2JTZA 2LCPA 5HKYA 2OTGB 1YR5A 2B1UA 2F2PA 1DJZA 1A29A 2PASA 4BY5A 1D1OA 2KBIA 1A75A 2L2EA 3SIAA 1FBVA 2NLNA 2PQLA 3BUNB 3E3RA 3WHUB 1TCFA 4A4BA 1CDNA 2QEOA 2KI6D 3WXAA 1BG1A 1F8HA 2KHNA 2KYFA 2AAOA 1CMGA 1SCVA 1PK0D 1DJWA 1XK4C 4GGNA 2BCXA 3OGNA 1KFUS 3L4LA 1SY9A 1UHKA 2NCOA 2WCMA 3QMEA 3R1VA 1XFYO 1M46A 1TRFA 1NUBA 1QJTA 2ZKMX 4F0ZB 5KTYA 1CB1A 2LVVA 1RK9A 2HPSA 4M2QA 5JOLA 2KQ6A 4HRGA 4OV2A 1B8LA 1TCOB 1SNLA 3BUOB 1FI5A 2LUXA 2M1UA 1CFCA 1IKUA 2HF5A 1PULA 4PALA 4PDZA 1ALVA 1LKJA 2BECA 3NSLA 1IQ3A 5DKRA 3GK4X 3D77A 3TS5C 2FOTA 4PE1A 1XFWO 2PSRA 3EVUA 3DVKA 4GFTA 3CS1A 5CSFA 2YGUA 1S3PA 3VROA 3WHTB 1FPWA 3JVTC 1QIWA 4TNCA 2ZRTA 2M1KB 2KLDA 2K8MB 3VRRA 1OE9B 1XFXO 1HT9A 1RWYA 3EK8A 1NX1A 2Y1MA 4OZDA 2JT8A 3DY9A 2KBMA 1V1FA 2JU0A 2BE4A 1OOJA 2WORA 2K2FA 3PJIA 4I5LB 1DF0B 1MHOA 1OZSA 1UHNA 3FE8A 1CFFA 2JULA 1J7RA 3BUXB 1J1EA 2LVIA 3NSIA 2NXQA 1ORGA 1CM4A 3I5IB 1TTXA 1DGUA 2HQWA 1AVSA 1DELA 5HYDA 2GV5A 1V1GA 2LANA 2BAPA 3DVJA 1FW4A 3EK7A 2WC8A 1M31A 1X02A 3R1PA 3V2LA 2O5GA 3SG5A 4YGBB 1VRKA 5FYXA 1OOHA 2F2OA 4ZCVA 1S1EA 3B86A 3CYZA 3O4XA 2MLFC 2EC6C 1UURA 5HLVA 2WNDA 3FE6A 1KSOA 1QXPA 2M3WA 2OTGC 3BOWB 4PHJA 4DIRA 1BU3A 3CDNA 4DS7A 2WC5A 1B1GA 3KHEA 1H4BA 4F7FA 2LVKA 4HREE 1PRWA 2K60A 2LP3A 1E8AA 2M9GA 1MQ1A 3JTDB 2KNEA 3RLZA 3DF0A 1UHJA 2JNFA 4Q04A 3SG4A 1WLMA 2IS9A 4ICBA 1LVCD 2QEHA 2SASA 3S0FA 2KGBC 3CZ0A 3SG7A 1AP4A 2LE9B 1ODBA 4MVFA 1J7OA 4MN0A 1OOIX 2KOTA 3NXAA 4WQ2A 4YGAA 2ISDA 2K7CA 2LMTA 2LV7A 1S6IA 3LK1A 1CDMA 1TUZA 4INWA 3ZWHA 4NQGA 4C0JA 3HCMA 1ZUZA 2LHLA 2PRUA 1JC2A 3I5HB 4GGFC 3OB1B 3L4AA 1QVIZ 2ZNEA 1SW8A 1M63B 1MF8B 2BKIB 2JNXA 2KYCA 2TN4A 1DJYA 1AJ4A 2BCBA 3DYEA 3PFVA 5F6TA 1IIOA 1KFUL 1Y1AA 3CABA 2F8PA 4E68A 3DZTA 2F3YA 2KAXA 4JWQA 1YX7A 2KDHA 4PCWA 3SG6A 1F4OA 3O78A 2JQ6A 2CNPA 1TNPA 1IQ5A 2WOSA 4MRYA 1FI6A 1H8BA 2FCDA 2WCLA 5AEQA 2KQYA 1S26D 3B87A 4DUQA 1UP5A 2KI4C 5CSNA 2P6BB 3SS4A 3BUMB 3VGOA 3D10A 1EJ3A 3D78A 1Y0VH 3L47A 1NCZA 1L2OB 1NP8A 2MRDA 2ZRSA 3TDIA 3I5IC 4CFRA 4AQIA 2G2BA 5DKNA 4MBEA 4R1EA 3Q8IA 5EL2A 3AKAA 3VRPA 1BR4B 1SL8A 3EG5B 1DTLA 3CR2A 1YUUA 3BQ3A 1CKKA 3BFAA 4M2PA 3O2PA 4ORAB 2EC6B 1KQMC 2JOJA 1EXRA 3S0DA 5JJGA 1BF5A 2ERBA 2KFGA 2E30A 3M0WA 1DGVA 2QACA 2KGRA 1C7WA 5ER5A 3RM1A 1DJIA 2EHBA 4D1EA 1B4CA 4N1FA 4GNKB 3DF0B 3LK0A 1P28A 1YVLA 3GOFA 1DQEA 3CWGA 1R2UA 2L4HA 1JFJA 1Z4HA 1BT6A 1QVIY 1S36A 1C7VA 4ORBB 1K9PA 2CXJA 4ETOA 1OZOA 1K94A 2HQ8A 4OKHA 2GGZA 1K93D 3JTDC 3FIAA 2K7DA 2ZN9A 4L9MA 1PVBA 3BFHA 1TN4A 2M7LA 1Y1XA 2I2RE 2K2AA 1G8IA 3BJHA 1S6CA 3K21A 2L98A 1YRTB 1TNWA 1OOGA 3VB1A 1QATA 1DJHA 2L2CA 1B8CA 3NHTA 1ZFSA 1YURA 1KFXS 4OR9B 5B8IB 3FE9A 1DT7B 1QIVA 2FJYA 2R2IA 2Y4QA 4YBHB 3PLFB 1YRUB 1JBAA 2BCAA 5I2LA 1SCMB 2JWWA 3I5HC 2Y1NA 3OBVA 3BYAA 3VRNA 4DRWA 1WY9A 2DOQA 1OMDA 1GQMA 2K61A 2L5YA 2WCEA 1TOPA 3IQOA 2WCFA 2K7BA 1YVHA 3B6XA 2LMUA 4FTGA 4YRUA 1N65A 2I94A 1XA5A 3CZTX 3PM2A 1SK6D 2MJWB 4PHKA 1CLBA 2KI4B 1QLKA 4CLNA 1CLMA 3R1OA 2PALA 1J1DA 2KFFA 1IJ5A 3K1EA 1SL9A 1J7QA 5DICA 1S5GY 1LS8A 3O4YA 3TZ1A 5IBWA 2L0PA 4WQ3A 1Y1UA 3CR4X 2LHIA 4OCIA 1DEKA 1W7JB 1L2OC 2P71A 5AERA 5FI6A 1KQMB 3DVMA 1A75B 3D0YA 3SJSA 1YUTA 4QJ3B 2MBXA 1FF1A 3S0BA 1XFUO 1QS7A 5HLOA 3ICBA 3N7HA 2G9BA 1G4YR 1OMRA 1TNQA 3OB2B 4P5OE 5K89A 4INXA 2KLEA 1EG4A 1UHHA 3IF7A 1B8RA 3CZ2A 5BPJA 5HKWA 3LLEA 1W9ZA 3R72A 1IGVA 3NHIA 2HETA 1A4PA 4N5XA 1RJVA 3H4SE 4ORCB 3UO9A 1C07A 1ZOTB 1QX5B 2CT9A 2JC2A 1K9KA 1K90D 5CSJA 2F33A 4GUKA 3MSEB 4AOMA 3O6BA 1UHIA 1MR8A 3AAKA 1PSBA 1QV1A 4DCKA 3I5FB 1BODA 4MEWA 5AANA 1CDLA 2FCEA 3LCPC 1EH2A 1MXEA 1SL7A 1LA0A 1SYMA 2BBMA 2VRGA 1CFPA 1GM0A 2COLB 3CR5X 3IVTA 3LL8B 2CBLA 4CFQA 1SCMC 2RGIA 2V53A 1A2XA 3S0AA 1NX2A 1MXLC 3KEVA 1ZMZA 1B7TZ 1WRZA 2BNXA 2LLSA 3KO0A 2H8VA 4PT1A 4QJ4B 4YI9A 3TUYB 2WCBA 4MRXA 1KFXL 1TIZA 1NX0A 2NCPA 3KF9A 1LINA 2L5XB 1MWNA 1W7IB 2NZ0A 3D76A 4ZCUA 3QRXA 2KSPA 1F70A 1UWOA 1XYDA 2EGDA 2M0RA 4JQ0D 1DJGA 1WRLA 3PATA 4YGEB 2PVBA 1JWDA 1YUSA 4USLA 2GTEA 3PM8A 2L4IA 3DXLA 1NPQA 2ZFDA 3TDZA 1JFKA 3CTNA 1L7ZA 1QASA 2LP2A 1SKTA 1XFRA 3A4UB 1J55A 5ER4X 2PMYA 3SIBA 2BKHB 2JPOA 3I5GB 4JPZB 1CNPA 2D8NA 1QX2A 3DVEA 4I5NB 4WRIA 3ZNIA 4YI8A 3TDUA 1F71A 3UNWA 3B88A 1S5GZ 2MLEC 4MZLA 4NDDA 3F45A 2LM5A 3SG2A 3VRQA 1PVAA 1RFJA 3OP0A 1DF0A 5KU1A 2LC5A 3A8RA 2GGMA 1OQPA 3SG3A 4HSZA 2H61A 1BMOA 1NYAA 2F3ZA 3OHMB 1KQVA 1AHRA 1Y6WA 1K2HA 1JF2A 1NX3A 1B7TY 2I7AA 4MZJA 2M29A 3EKJA 5I2OA 1CLLA 2E6WA 5I94A 1WDCB 1ZACA 3NGVA 2M49B 3EKHA 5AFPA 1SBJA 1K95A 1IG5A 2JXLA 3I5FC 1XO5A 3PALA 3GK2A 1QX7A 2MAZA 3BOWA 2AMIA 1DC1A 2Q4UA 4GBAA 2LUCA 4UPGA 5PALA 1M45A 1TNXA 5G08A 4YGDB 4U8DA 1XK4A 1BJFA 2P70A 1AK8A 3CLNA 1OOFA 2WC6A 2MA2A 1GGWA 1K8UA 4IJ7A 4AQJA 3D75A 2OS8B 1SPYA 1JF0A 2ZNDA 1HQVA 1MUXA 1CFDA 2QDIA 2KI6C 2MHHA 1SMGA 5KSZA 3S0EA 1TWOA 3TUYC 2JRFA 3CGAA 1WRKA 2JT0A 5HL1A 1BLQA 1DVIA 1QTXA 1QLSA 3SS3A 4PE0A 5CSIA 4XJKA 4NDCA 4A4CA 5I8NA 4CPVA 3PSRA 5GQQC 2QPTA 2Q91A 4BY4A 1OW4A 1N0YA 1EG3A 1EL4A 1CTRA 5DKQA 1XFZO 2LMVA 1DJXA 1KK8C 1UUSA 1B9AA 3AKBA 4FQOA 4PHNA 4C0KA 1F4QA 1BR1B 3I5GC 1QWVA 4JD9A 5I2QA 2KFHA 1XVJA 2AUCA 3DD4A 3BXKA 1KWOB 3PN7B 2BL0B 3EK4A 2LLUA 5J3XA 3S0GA 2L50A 5TNCA 1F55A 4C0LA
chains in the Genus database with same CATH topology
2JTTA 1QV0A 1SR6C 3FWBA 1M39A 1PALA 3IQQA 1JSAA 1K96A 5HKZA 5CPVA 2BBNA 1U5IA 1OMVA 1WLZA 2A4JA 2CCMA 3FWCA 1NWDA 1PSRA 5D69A 1WDCC 2JXCA 2KAYA 4MLWA 1NIWA 3AAJA 2BE6A 3KPXA 1AJ5A 4I5JA 2M8UA 3GK1A 2M97A 3NSKA 4M2OA 2K0JA 1BOCA 1KK7Z 1YX8A 4HRHA 2FJUB 1F54A 2LVJA 2JZIA 2LNKA 1IWQA 2K7OA 2LAPA 2M7NA 1K9UA 1A03A 2OPOA 2H2KA 1IRJA 4P2YB 1AUIB 1GGZA 3BUWB 1NCXA 4XYNA 3HX4A 2ZN8A 5AXIA 1YTZC 2OS8C 1NSHA 2CTNA 3C1VA 4GPLB 2LLTA 1G33A 4OVNF 4XJKB 2SCPA 2KAVA 1RTP1 3TS5B 1KCYA 1RROA 4GGFA 3OX6A 1N2DA 1R6PA 2JPTA 4QJ5B 4PE4A 3JVTB 1ALWA 3D0YB 4PHMA 3WNXB 1SRAA 1LXFC 4YGCB 1RECA 2L51A 2JT3A 1KK8B 1OSAA 3OX5A 1CMFA 3EVVA 1CM1A 4N1GA 1LA3A 4NDBA 2Y5IA 5D7FA 1GJYA 4CIDA 1DMOA 1S6JA 1IH0A 1XFVO 2I18A 1KSMA 3EVRA 4MSPA 1Q80A 4MZKA 1J7PA 1CDPA 3NSOA 1SR6B 1B47A 1KWOC 3PN7C 4PE7A 1NCYA 2H61C 2BL0C 4I5KA 1U5IB 3FS7A 1KK7Y 1IJ6A 4IL1A 2O60A 1JUOA 4GAOA 2JTZA 2LCPA 5HKYA 2OTGB 1YR5A 2B1UA 2F2PA 1DJZA 1A29A 2PASA 4BY5A 1D1OA 2KBIA 1A75A 2L2EA 3SIAA 1FBVA 2NLNA 3BUNB 3E3RA 3WHUB 1TCFA 4A4BA 1CDNA 2KI6D 3WXAA 1BG1A 1F8HA 2KHNA 2KYFA 2AAOA 1CMGA 1SCVA 1PK0D 1DJWA 1XK4C 4GGNA 2BCXA 1KFUS 1SY9A 1UHKA 2NCOA 1XFYO 1M46A 1TRFA 1NUBA 1QJTA 2ZKMX 4F0ZB 5KTYA 1CB1A 2LVVA 1RK9A 2HPSA 4M2QA 5JOLA 2KQ6A 4HRGA 4OV2A 1B8LA 1TCOB 1SNLA 3BUOB 1FI5A 2LUXA 2M1UA 1CFCA 1IKUA 2HF5A 1PULA 4PALA 4PDZA 1ALVA 1LKJA 2BECA 3NSLA 1IQ3A 5DKRA 3GK4X 3TS5C 2FOTA 4PE1A 1XFWO 2PSRA 3EVUA 3DVKA 4GFTA 3CS1A 5CSFA 3WHTB 1S3PA 3VROA 1FPWA 3JVTC 1QIWA 4TNCA 2ZRTA 2M1KB 2K8MB 3VRRA 1OE9B 1XFXO 1HT9A 1RWYA 3EK8A 1NX1A 2Y1MA 2JT8A 2KBMA 1V1FA 2JU0A 2BE4A 1OOJA 2WORA 2K2FA 4I5LB 1DF0B 1MHOA 1OZSA 1UHNA 1CFFA 2JULA 1J7RA 3BUXB 1J1EA 2LVIA 3NSIA 2NXQA 1CM4A 3I5IB 1TTXA 1DGUA 2HQWA 1AVSA 5HYDA 2GV5A 1V1GA 2LANA 3DVJA 1FW4A 3EK7A 2WC8A 1M31A 1X02A 2O5GA 3SG5A 4YGBB 1VRKA 5FYXA 2F2OA 4ZCVA 1S1EA 2MLFC 2EC6C 1UURA 5HLVA 2WNDA 1KSOA 1QXPA 2M3WA 2OTGC 3BOWB 4PHJA 4DIRA 1BU3A 4DS7A 1B1GA 1H4BA 3KHEA 2LVKA 4HREE 1PRWA 2LP3A 2M9GA 1E8AA 3JTDB 1MQ1A 3RLZA 2KNEA 3DF0A 1UHJA 2JNFA 4Q04A 3SG4A 1WLMA 2IS9A 4ICBA 1LVCD 2SASA 2KGBC 3SG7A 1AP4A 2LE9B 1ODBA 4MVFA 1J7OA 4MN0A 3NXAA 2KOTA 4WQ2A 4YGAA 2ISDA 2K7CA 2LMTA 2LV7A 1S6IA 3LK1A 1CDMA 3ZWHA 4NQGA 4C0JA 3HCMA 1ZUZA 2LHLA 2PRUA 1JC2A 3I5HB 4GGFC 3OB1B 1QVIZ 2ZNEA 1SW8A 1M63B 1MF8B 2BKIB 2JNXA 2KYCA 2TN4A 1DJYA 1AJ4A 2BCBA 3PFVA 5F6TA 1KFUL 1Y1AA 2F8PA 4E68A 2F3YA 2KAXA 4JWQA 1YX7A 2KDHA 4PCWA 3SG6A 1F4OA 3O78A 2JQ6A 2CNPA 1TNPA 1IQ5A 2WOSA 4MRYA 1FI6A 1H8BA 2FCDA 5AEQA 2KQYA 1S26D 4DUQA 1UP5A 2KI4C 5CSNA 2P6BB 3BUMB 3VGOA 3D10A 1EJ3A 1Y0VH 3TDIA 1NCZA 1L2OB 1NP8A 2MRDA 2ZRSA 3I5IC 4CFRA 4AQIA 2G2BA 5DKNA 4MBEA 4R1EA 3VRPA 3AKAA 1BR4B 1SL8A 1DTLA 3CR2A 1YUUA 3BQ3A 1CKKA 4M2PA 3O2PA 4ORAB 2EC6B 1KQMC 2JOJA 1EXRA 5JJGA 1BF5A 2KFGA 2E30A 3M0WA 1DGVA 2QACA 2KGRA 1C7WA 5ER5A 3RM1A 1DJIA 2EHBA 4D1EA 1B4CA 4N1FA 4GNKB 3DF0B 3LK0A 3GOFA 1YVLA 3CWGA 1R2UA 2L4HA 1JFJA 1BT6A 1QVIY 1S36A 1C7VA 4ORBB 1K9PA 2CXJA 4ETOA 1OZOA 1K94A 2HQ8A 4OKHA 2GGZA 1K93D 3JTDC 3FIAA 2K7DA 2ZN9A 4L9MA 1PVBA 1TN4A 2M7LA 1Y1XA 2I2RE 2K2AA 1G8IA 1S6CA 3K21A 2L98A 1YRTB 1TNWA 1QATA 1DJHA 1B8CA 1ZFSA 1YURA 1KFXS 4OR9B 5B8IB 1DT7B 1QIVA 2R2IA 2Y4QA 4YBHB 3PLFB 1YRUB 1JBAA 2BCAA 5I2LA 1SCMB 2JWWA 3I5HC 2Y1NA 3VRNA 3BYAA 4DRWA 1WY9A 2DOQA 1OMDA 1GQMA 2K61A 2WCEA 1TOPA 3IQOA 2WCFA 2K7BA 1YVHA 4FTGA 2LMUA 4YRUA 1N65A 2I94A 1XA5A 3CZTX 1SK6D 2MJWB 4PHKA 1CLBA 2KI4B 1QLKA 4CLNA 1CLMA 2PALA 1J1DA 2KFFA 1IJ5A 1J7QA 1SL9A 1S5GY 3TZ1A 3O4YA 5IBWA 2L0PA 4WQ3A 1Y1UA 3CR4X 2LHIA 4OCIA 1W7JB 1L2OC 5AERA 1KQMB 3DVMA 1A75B 3D0YA 3SJSA 1YUTA 4QJ3B 2MBXA 1FF1A 1XFUO 1QS7A 5HLOA 3ICBA 2G9BA 1G4YR 1OMRA 1TNQA 3OB2B 4P5OE 5K89A 1EG4A 1UHHA 3IF7A 1B8RA 5BPJA 5HKWA 3LLEA 1IGVA 2HETA 1A4PA 4N5XA 1RJVA 3H4SE 4ORCB 1C07A 1ZOTB 1QX5B 2CT9A 2JC2A 1K9KA 1K90D 5CSJA 2F33A 4GUKA 3MSEB 4AOMA 3O6BA 1UHIA 1MR8A 3AAKA 1PSBA 1QV1A 4DCKA 3I5FB 1BODA 4MEWA 5AANA 1CDLA 2FCEA 3LCPC 1EH2A 1MXEA 1SL7A 1LA0A 1SYMA 2BBMA 2VRGA 1CFPA 2COLB 3CR5X 3LL8B 2CBLA 4CFQA 1SCMC 2RGIA 2V53A 1A2XA 1NX2A 1MXLC 3KEVA 1ZMZA 1B7TZ 1WRZA 2LLSA 3KO0A 4QJ4B 4YI9A 3TUYB 2WCBA 4MRXA 1KFXL 1TIZA 1NX0A 2NCPA 3KF9A 1LINA 2L5XB 1MWNA 1W7IB 2NZ0A 4ZCUA 3QRXA 2KSPA 1F70A 1UWOA 1XYDA 2EGDA 2M0RA 4JQ0D 1DJGA 1WRLA 3PATA 4YGEB 2PVBA 1JWDA 1YUSA 4USLA 3PM8A 2L4IA 3TDZA 1NPQA 2ZFDA 1JFKA 3CTNA 1L7ZA 1QASA 2LP2A 1SKTA 3A4UB 1J55A 5ER4X 2PMYA 3SIBA 2BKHB 3I5GB 4JPZB 1CNPA 2D8NA 1QX2A 3DVEA 4I5NB 4WRIA 3ZNIA 4YI8A 3TDUA 1F71A 1S5GZ 2MLEC 4MZLA 4NDDA 3F45A 2LM5A 3SG2A 3VRQA 1PVAA 1RFJA 3OP0A 1DF0A 5KU1A 2LC5A 3A8RA 2GGMA 1OQPA 3SG3A 4HSZA 2H61A 1BMOA 1NYAA 2F3ZA 3OHMB 1KQVA 1AHRA 1Y6WA 1K2HA 1JF2A 1NX3A 1B7TY 2I7AA 4MZJA 2M29A 3EKJA 5I2OA 1CLLA 2E6WA 1WDCB 1ZACA 2M49B 3EKHA 5AFPA 1SBJA 1K95A 1IG5A 2JXLA 3I5FC 1XO5A 3PALA 3GK2A 1QX7A 2MAZA 3BOWA 2AMIA 2Q4UA 4GBAA 2LUCA 4UPGA 5PALA 1M45A 1TNXA 5G08A 4YGDB 4U8DA 1XK4A 1BJFA 1AK8A 3CLNA 2MA2A 1GGWA 1K8UA 4AQJA 2OS8B 1SPYA 1JF0A 2ZNDA 1HQVA 1MUXA 1CFDA 2KI6C 2MHHA 1SMGA 5KSZA 3TUYC 2JRFA 3CGAA 1WRKA 2JT0A 1BLQA 1DVIA 1QTXA 1QLSA 4PE0A 5CSIA 4XJKA 4NDCA 4A4CA 5I8NA 4CPVA 3PSRA 5GQQC 2QPTA 2Q91A 4BY4A 1N0YA 1EG3A 1EL4A 1CTRA 5DKQA 1XFZO 2LMVA 1DJXA 1KK8C 1UUSA 1B9AA 3AKBA 4FQOA 4PHNA 4C0KA 1F4QA 1BR1B 3I5GC 5I2QA 2KFHA 1XVJA 2AUCA 3DD4A 3BXKA 1KWOB 3PN7B 2BL0B 3EK4A 2LLUA 5J3XA 2L50A 5TNCA 1F55A 4C0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTT A;  1QV0 A;  1SR6 C;  3FWB A;  1M39 A;  1PAL A;  3IQQ A;  1JSA A;  1K96 A;  5HKZ A;  5CPV A;  2BBN A;  1U5I A;  1OMV A;  1WLZ A;  2A4J A;  2CCM A;  3FWC A;  1NWD A;  1PSR A;  5D69 A;  1WDC C;  2JXC A;  2KAY A;  4MLW A;  1NIW A;  3AAJ A;  2BE6 A;  3KPX A;  1AJ5 A;  4I5J A;  2M8U A;  3GK1 A;  2M97 A;  3NSK A;  4M2O A;  2K0J A;  1BOC A;  1KK7 Z;  1YX8 A;  4HRH A;  2FJU B;  1F54 A;  2LVJ A;  2JZI A;  2LNK A;  1IWQ A;  2K7O A;  2LAP A;  2M7N A;  1K9U A;  1A03 A;  2OPO A;  2H2K A;  1IRJ A;  4P2Y B;  1AUI B;  1GGZ A;  3BUW B;  1NCX A;  4XYN A;  3HX4 A;  2ZN8 A;  5AXI A;  1YTZ C;  2OS8 C;  1NSH A;  2CTN A;  3C1V A;  4GPL B;  2LLT A;  1G33 A;  4OVN F;  4XJK B;  2SCP A;  2KAV A;  1RTP 1;  3TS5 B;  1KCY A;  1RRO A;  4GGF A;  3OX6 A;  1N2D A;  1R6P A;  2JPT A;  4QJ5 B;  4PE4 A;  3JVT B;  1ALW A;  3D0Y B;  4PHM A;  3WNX B;  1SRA A;  1LXF C;  4YGC B;  1REC A;  2L51 A;  2JT3 A;  1KK8 B;  1OSA A;  3OX5 A;  1CMF A;  3EVV A;  1CM1 A;  4N1G A;  1LA3 A;  4NDB A;  2Y5I A;  5D7F A;  1GJY A;  4CID A;  1DMO A;  1S6J A;  1IH0 A;  1XFV O;  2I18 A;  1KSM A;  3EVR A;  4MSP A;  1Q80 A;  4MZK A;  1J7P A;  1CDP A;  3NSO A;  1SR6 B;  1B47 A;  1KWO C;  3PN7 C;  4PE7 A;  1NCY A;  2H61 C;  2BL0 C;  4I5K A;  1U5I B;  3FS7 A;  1KK7 Y;  1IJ6 A;  4IL1 A;  2O60 A;  1JUO A;  4GAO A;  2JTZ A;  2LCP A;  5HKY A;  2OTG B;  1YR5 A;  2B1U A;  2F2P A;  1DJZ A;  1A29 A;  2PAS A;  4BY5 A;  1D1O A;  2KBI A;  1A75 A;  2L2E A;  3SIA A;  1FBV A;  2NLN A;  3BUN B;  3E3R A;  3WHU B;  1TCF A;  4A4B A;  1CDN A;  2KI6 D;  3WXA A;  1BG1 A;  1F8H A;  2KHN A;  2KYF A;  2AAO A;  1CMG A;  1SCV A;  1PK0 D;  1DJW A;  1XK4 C;  4GGN A;  2BCX A;  1KFU S;  1SY9 A;  1UHK A;  2NCO A;  1XFY O;  1M46 A;  1TRF A;  1NUB A;  1QJT A;  2ZKM X;  4F0Z B;  5KTY A;  1CB1 A;  2LVV A;  1RK9 A;  2HPS A;  4M2Q A;  5JOL A;  2KQ6 A;  4HRG A;  4OV2 A;  1B8L A;  1TCO B;  1SNL A;  3BUO B;  1FI5 A;  2LUX A;  2M1U A;  1CFC A;  1IKU A;  2HF5 A;  1PUL A;  4PAL A;  4PDZ A;  1ALV A;  1LKJ A;  2BEC A;  3NSL A;  1IQ3 A;  5DKR A;  3GK4 X;  3TS5 C;  2FOT A;  4PE1 A;  1XFW O;  2PSR A;  3EVU A;  3DVK A;  4GFT A;  3CS1 A;  5CSF A;  3WHT B;  1S3P A;  3VRO A;  1FPW A;  3JVT C;  1QIW A;  4TNC A;  2ZRT A;  2M1K B;  2K8M B;  3VRR A;  1OE9 B;  1XFX O;  1HT9 A;  1RWY A;  3EK8 A;  1NX1 A;  2Y1M A;  2JT8 A;  2KBM A;  1V1F A;  2JU0 A;  2BE4 A;  1OOJ A;  2WOR A;  2K2F A;  4I5L B;  1DF0 B;  1MHO A;  1OZS A;  1UHN A;  1CFF A;  2JUL A;  1J7R A;  3BUX B;  1J1E A;  2LVI A;  3NSI A;  2NXQ A;  1CM4 A;  3I5I B;  1TTX A;  1DGU A;  2HQW A;  1AVS A;  5HYD A;  2GV5 A;  1V1G A;  2LAN A;  3DVJ A;  1FW4 A;  3EK7 A;  2WC8 A;  1M31 A;  1X02 A;  2O5G A;  3SG5 A;  4YGB B;  1VRK A;  5FYX A;  2F2O A;  4ZCV A;  1S1E A;  2MLF C;  2EC6 C;  1UUR A;  5HLV A;  2WND A;  1KSO A;  1QXP A;  2M3W A;  2OTG C;  3BOW B;  4PHJ A;  4DIR A;  1BU3 A;  4DS7 A;  1B1G A;  1H4B A;  3KHE A;  2LVK A;  4HRE E;  1PRW A;  2LP3 A;  2M9G A;  1E8A A;  3JTD B;  1MQ1 A;  3RLZ A;  2KNE A;  3DF0 A;  1UHJ A;  2JNF A;  4Q04 A;  3SG4 A;  1WLM A;  2IS9 A;  4ICB A;  1LVC D;  2SAS A;  2KGB C;  3SG7 A;  1AP4 A;  2LE9 B;  1ODB A;  4MVF A;  1J7O A;  4MN0 A;  3NXA A;  2KOT A;  4WQ2 A;  4YGA A;  2ISD A;  2K7C A;  2LMT A;  2LV7 A;  1S6I A;  3LK1 A;  1CDM A;  3ZWH A;  4NQG A;  4C0J A;  3HCM A;  1ZUZ A;  2LHL A;  2PRU A;  1JC2 A;  3I5H B;  4GGF C;  3OB1 B;  1QVI Z;  2ZNE A;  1SW8 A;  1M63 B;  1MF8 B;  2BKI B;  2JNX A;  2KYC A;  2TN4 A;  1DJY A;  1AJ4 A;  2BCB A;  3PFV A;  5F6T A;  1KFU L;  1Y1A A;  2F8P A;  4E68 A;  2F3Y A;  2KAX A;  4JWQ A;  1YX7 A;  2KDH A;  4PCW A;  3SG6 A;  1F4O A;  3O78 A;  2JQ6 A;  2CNP A;  1TNP A;  1IQ5 A;  2WOS A;  4MRY A;  1FI6 A;  1H8B A;  2FCD A;  5AEQ A;  2KQY A;  1S26 D;  4DUQ A;  1UP5 A;  2KI4 C;  5CSN A;  2P6B B;  3BUM B;  3VGO A;  3D10 A;  1EJ3 A;  1Y0V H;  3TDI A;  1NCZ A;  1L2O B;  1NP8 A;  2MRD A;  2ZRS A;  3I5I C;  4CFR A;  4AQI A;  2G2B A;  5DKN A;  4MBE A;  4R1E A;  3VRP A;  3AKA A;  1BR4 B;  1SL8 A;  1DTL A;  3CR2 A;  1YUU A;  3BQ3 A;  1CKK A;  4M2P A;  3O2P A;  4ORA B;  2EC6 B;  1KQM C;  2JOJ A;  1EXR A;  5JJG A;  1BF5 A;  2KFG A;  2E30 A;  3M0W A;  1DGV A;  2QAC A;  2KGR A;  1C7W A;  5ER5 A;  3RM1 A;  1DJI A;  2EHB A;  4D1E A;  1B4C A;  4N1F A;  4GNK B;  3DF0 B;  3LK0 A;  3GOF A;  1YVL A;  3CWG A;  1R2U A;  2L4H A;  1JFJ A;  1BT6 A;  1QVI Y;  1S36 A;  1C7V A;  4ORB B;  1K9P A;  2CXJ A;  4ETO A;  1OZO A;  1K94 A;  2HQ8 A;  4OKH A;  2GGZ A;  1K93 D;  3JTD C;  3FIA A;  2K7D A;  2ZN9 A;  4L9M A;  1PVB A;  1TN4 A;  2M7L A;  1Y1X A;  2I2R E;  2K2A A;  1G8I A;  1S6C A;  3K21 A;  2L98 A;  1YRT B;  1TNW A;  1QAT A;  1DJH A;  1B8C A;  1ZFS A;  1YUR A;  1KFX S;  4OR9 B;  5B8I B;  1DT7 B;  1QIV A;  2R2I A;  2Y4Q A;  4YBH B;  3PLF B;  1YRU B;  1JBA A;  2BCA A;  5I2L A;  1SCM B;  2JWW A;  3I5H C;  2Y1N A;  3VRN A;  3BYA A;  4DRW A;  1WY9 A;  2DOQ A;  1OMD A;  1GQM A;  2K61 A;  2WCE A;  1TOP A;  3IQO A;  2WCF A;  2K7B A;  1YVH A;  4FTG A;  2LMU A;  4YRU A;  1N65 A;  2I94 A;  1XA5 A;  3CZT X;  1SK6 D;  2MJW B;  4PHK A;  1CLB A;  2KI4 B;  1QLK A;  4CLN A;  1CLM A;  2PAL A;  1J1D A;  2KFF A;  1IJ5 A;  1J7Q A;  1SL9 A;  1S5G Y;  3TZ1 A;  3O4Y A;  5IBW A;  2L0P A;  4WQ3 A;  1Y1U A;  3CR4 X;  2LHI A;  4OCI A;  1W7J B;  1L2O C;  5AER A;  1KQM B;  3DVM A;  1A75 B;  3D0Y A;  3SJS A;  1YUT A;  4QJ3 B;  2MBX A;  1FF1 A;  1XFU O;  1QS7 A;  5HLO A;  3ICB A;  2G9B A;  1G4Y R;  1OMR A;  1TNQ A;  3OB2 B;  4P5O E;  5K89 A;  1EG4 A;  1UHH A;  3IF7 A;  1B8R A;  5BPJ A;  5HKW A;  3LLE A;  1IGV A;  2HET A;  1A4P A;  4N5X A;  1RJV A;  3H4S E;  4ORC B;  1C07 A;  1ZOT B;  1QX5 B;  2CT9 A;  2JC2 A;  1K9K A;  1K90 D;  5CSJ A;  2F33 A;  4GUK A;  3MSE B;  4AOM A;  3O6B A;  1UHI A;  1MR8 A;  3AAK A;  1PSB A;  1QV1 A;  4DCK A;  3I5F B;  1BOD A;  4MEW A;  5AAN A;  1CDL A;  2FCE A;  3LCP C;  1EH2 A;  1MXE A;  1SL7 A;  1LA0 A;  1SYM A;  2BBM A;  2VRG A;  1CFP A;  2COL B;  3CR5 X;  3LL8 B;  2CBL A;  4CFQ A;  1SCM C;  2RGI A;  2V53 A;  1A2X A;  1NX2 A;  1MXL C;  3KEV A;  1ZMZ A;  1B7T Z;  1WRZ A;  2LLS A;  3KO0 A;  4QJ4 B;  4YI9 A;  3TUY B;  2WCB A;  4MRX A;  1KFX L;  1TIZ A;  1NX0 A;  2NCP A;  3KF9 A;  1LIN A;  2L5X B;  1MWN A;  1W7I B;  2NZ0 A;  4ZCU A;  3QRX A;  2KSP A;  1F70 A;  1UWO A;  1XYD A;  2EGD A;  2M0R A;  4JQ0 D;  1DJG A;  1WRL A;  3PAT A;  4YGE B;  2PVB A;  1JWD A;  1YUS A;  4USL A;  3PM8 A;  2L4I A;  3TDZ A;  1NPQ A;  2ZFD A;  1JFK A;  3CTN A;  1L7Z A;  1QAS A;  2LP2 A;  1SKT A;  3A4U B;  1J55 A;  5ER4 X;  2PMY A;  3SIB A;  2BKH B;  3I5G B;  4JPZ B;  1CNP A;  2D8N A;  1QX2 A;  3DVE A;  4I5N B;  4WRI A;  3ZNI A;  4YI8 A;  3TDU A;  1F71 A;  1S5G Z;  2MLE C;  4MZL A;  4NDD A;  3F45 A;  2LM5 A;  3SG2 A;  3VRQ A;  1PVA A;  1RFJ A;  3OP0 A;  1DF0 A;  5KU1 A;  2LC5 A;  3A8R A;  2GGM A;  1OQP A;  3SG3 A;  4HSZ A;  2H61 A;  1BMO A;  1NYA A;  2F3Z A;  3OHM B;  1KQV A;  1AHR A;  1Y6W A;  1K2H A;  1JF2 A;  1NX3 A;  1B7T Y;  2I7A A;  4MZJ A;  2M29 A;  3EKJ A;  5I2O A;  1CLL A;  2E6W A;  1WDC B;  1ZAC A;  2M49 B;  3EKH A;  5AFP A;  1SBJ A;  1K95 A;  1IG5 A;  2JXL A;  3I5F C;  1XO5 A;  3PAL A;  3GK2 A;  1QX7 A;  2MAZ A;  3BOW A;  2AMI A;  2Q4U A;  4GBA A;  2LUC A;  4UPG A;  5PAL A;  1M45 A;  1TNX A;  5G08 A;  4YGD B;  4U8D A;  1XK4 A;  1BJF A;  1AK8 A;  3CLN A;  2MA2 A;  1GGW A;  1K8U A;  4AQJ A;  2OS8 B;  1SPY A;  1JF0 A;  2ZND A;  1HQV A;  1MUX A;  1CFD A;  2KI6 C;  2MHH A;  1SMG A;  5KSZ A;  3TUY C;  2JRF A;  3CGA A;  1WRK A;  2JT0 A;  1BLQ A;  1DVI A;  1QTX A;  1QLS A;  4PE0 A;  5CSI A;  4XJK A;  4NDC A;  4A4C A;  5I8N A;  4CPV A;  3PSR A;  5GQQ C;  2QPT A;  2Q91 A;  4BY4 A;  1N0Y A;  1EG3 A;  1EL4 A;  1CTR A;  5DKQ A;  1XFZ O;  2LMV A;  1DJX A;  1KK8 C;  1UUS A;  1B9A A;  3AKB A;  4FQO A;  4PHN A;  4C0K A;  1F4Q A;  1BR1 B;  3I5G C;  5I2Q A;  2KFH A;  1XVJ A;  2AUC A;  3DD4 A;  3BXK A;  1KWO B;  3PN7 B;  2BL0 B;  3EK4 A;  2LLU A;  5J3X A;  2L50 A;  5TNC A;  1F55 A;  4C0L A; 
#chains in the Genus database with same CATH topology
 2JTT A;  1QV0 A;  1SR6 C;  3FWB A;  1M39 A;  1PAL A;  3BFB A;  3IQQ A;  1JSA A;  1K96 A;  4KYN A;  5CPV A;  5HKZ A;  2BBN A;  1U5I A;  1OMV A;  3D73 A;  2QEV A;  1Z2C B;  1WLZ A;  3RZS A;  3CZ1 A;  2A4J A;  2CCM A;  3FWC A;  5FI2 A;  2WCJ A;  1NWD A;  1PSR A;  5D69 A;  1WDC C;  2JXC A;  2KAY A;  4MLW A;  5FI7 A;  1NIW A;  3AAJ A;  2BE6 A;  3KPX A;  1AJ5 A;  4I5J A;  2M8U A;  3GK1 A;  2M97 A;  3NSK A;  4M2O A;  2K0J A;  1BOC A;  2QEB A;  1KK7 Z;  1YX8 A;  4HRH A;  2FJU B;  1F54 A;  2LVJ A;  2WCH A;  2JZI A;  2LNK A;  1IWQ A;  2PYQ A;  3SS5 A;  2K7O A;  2LAP A;  2M7N A;  1K9U A;  1A03 A;  2OPO A;  2H2K A;  2KPH A;  1IRJ A;  4P2Y B;  1AUI B;  1GGZ A;  3BUW B;  1NCX A;  4XYN A;  3HX4 A;  2ZN8 A;  5AXI A;  1YTZ C;  2OS8 C;  1NSH A;  2CTN A;  4FQT A;  3C1V A;  4GPL B;  2LLT A;  5D3O A;  1G33 A;  4OVN F;  4JKT A;  4XJK B;  1C3Z A;  2SCP A;  2KAV A;  1RTP 1;  3TS5 B;  1KCY A;  1RRO A;  4GGF A;  1TUJ A;  1N2D A;  1R6P A;  3OX6 A;  2JPT A;  4QJ5 B;  4PE4 A;  3JVT B;  1ALW A;  3D0Y B;  4PHM A;  3WNX B;  1SRA A;  1LXF C;  4YGC B;  1REC A;  2L51 A;  2JT3 A;  1KK8 B;  1OSA A;  3OX5 A;  1CMF A;  3EVV A;  1CM1 A;  4N1G A;  1SSE B;  1LA3 A;  4NDB A;  3D74 A;  2Y5I A;  5D7F A;  1GJY A;  1T14 A;  2WCK A;  4CID A;  1DMO A;  1S6J A;  1IH0 A;  1C3Y A;  1XFV O;  3B7A A;  2I18 A;  1KSM A;  3EVR A;  4MSP A;  1Q80 A;  4MZK A;  1J7P A;  1CDP A;  3NSO A;  1SR6 B;  1B47 A;  1KWO C;  3PN7 C;  4PE7 A;  1NCY A;  2H61 C;  2BL0 C;  4I5K A;  1U5I B;  3FS7 A;  1KK7 Y;  1IJ6 A;  4IL1 A;  2O60 A;  1JUO A;  4GAO A;  2JTZ A;  2LCP A;  5HKY A;  2OTG B;  1YR5 A;  2B1U A;  2F2P A;  1DJZ A;  1A29 A;  2PAS A;  4BY5 A;  1D1O A;  2KBI A;  1A75 A;  2L2E A;  3SIA A;  1FBV A;  2NLN A;  2PQL A;  3BUN B;  3E3R A;  3WHU B;  1TCF A;  4A4B A;  1CDN A;  2QEO A;  2KI6 D;  3WXA A;  1BG1 A;  1F8H A;  2KHN A;  2KYF A;  2AAO A;  1CMG A;  1SCV A;  1PK0 D;  1DJW A;  1XK4 C;  4GGN A;  2BCX A;  3OGN A;  1KFU S;  3L4L A;  1SY9 A;  1UHK A;  2NCO A;  2WCM A;  3QME A;  3R1V A;  1XFY O;  1M46 A;  1TRF A;  1NUB A;  1QJT A;  2ZKM X;  4F0Z B;  5KTY A;  1CB1 A;  2LVV A;  1RK9 A;  2HPS A;  4M2Q A;  5JOL A;  2KQ6 A;  4HRG A;  4OV2 A;  1B8L A;  1TCO B;  1SNL A;  3BUO B;  1FI5 A;  2LUX A;  2M1U A;  1CFC A;  1IKU A;  2HF5 A;  1PUL A;  4PAL A;  4PDZ A;  1ALV A;  1LKJ A;  2BEC A;  3NSL A;  1IQ3 A;  5DKR A;  3GK4 X;  3D77 A;  3TS5 C;  2FOT A;  4PE1 A;  1XFW O;  2PSR A;  3EVU A;  3DVK A;  4GFT A;  3CS1 A;  5CSF A;  2YGU A;  1S3P A;  3VRO A;  3WHT B;  1FPW A;  3JVT C;  1QIW A;  4TNC A;  2ZRT A;  2M1K B;  2KLD A;  2K8M B;  3VRR A;  1OE9 B;  1XFX O;  1HT9 A;  1RWY A;  3EK8 A;  1NX1 A;  2Y1M A;  4OZD A;  2JT8 A;  3DY9 A;  2KBM A;  1V1F A;  2JU0 A;  2BE4 A;  1OOJ A;  2WOR A;  2K2F A;  3PJI A;  4I5L B;  1DF0 B;  1MHO A;  1OZS A;  1UHN A;  3FE8 A;  1CFF A;  2JUL A;  1J7R A;  3BUX B;  1J1E A;  2LVI A;  3NSI A;  2NXQ A;  1ORG A;  1CM4 A;  3I5I B;  1TTX A;  1DGU A;  2HQW A;  1AVS A;  1DEL A;  5HYD A;  2GV5 A;  1V1G A;  2LAN A;  2BAP A;  3DVJ A;  1FW4 A;  3EK7 A;  2WC8 A;  1M31 A;  1X02 A;  3R1P A;  3V2L A;  2O5G A;  3SG5 A;  4YGB B;  1VRK A;  5FYX A;  1OOH A;  2F2O A;  4ZCV A;  1S1E A;  3B86 A;  3CYZ A;  3O4X A;  2MLF C;  2EC6 C;  1UUR A;  5HLV A;  2WND A;  3FE6 A;  1KSO A;  1QXP A;  2M3W A;  2OTG C;  3BOW B;  4PHJ A;  4DIR A;  1BU3 A;  3CDN A;  4DS7 A;  2WC5 A;  1B1G A;  3KHE A;  1H4B A;  4F7F A;  2LVK A;  4HRE E;  1PRW A;  2K60 A;  2LP3 A;  1E8A A;  2M9G A;  1MQ1 A;  3JTD B;  2KNE A;  3RLZ A;  3DF0 A;  1UHJ A;  2JNF A;  4Q04 A;  3SG4 A;  1WLM A;  2IS9 A;  4ICB A;  1LVC D;  2QEH A;  2SAS A;  3S0F A;  2KGB C;  3CZ0 A;  3SG7 A;  1AP4 A;  2LE9 B;  1ODB A;  4MVF A;  1J7O A;  4MN0 A;  1OOI X;  2KOT A;  3NXA A;  4WQ2 A;  4YGA A;  2ISD A;  2K7C A;  2LMT A;  2LV7 A;  1S6I A;  3LK1 A;  1CDM A;  1TUZ A;  4INW A;  3ZWH A;  4NQG A;  4C0J A;  3HCM A;  1ZUZ A;  2LHL A;  2PRU A;  1JC2 A;  3I5H B;  4GGF C;  3OB1 B;  3L4A A;  1QVI Z;  2ZNE A;  1SW8 A;  1M63 B;  1MF8 B;  2BKI B;  2JNX A;  2KYC A;  2TN4 A;  1DJY A;  1AJ4 A;  2BCB A;  3DYE A;  3PFV A;  5F6T A;  1IIO A;  1KFU L;  1Y1A A;  3CAB A;  2F8P A;  4E68 A;  3DZT A;  2F3Y A;  2KAX A;  4JWQ A;  1YX7 A;  2KDH A;  4PCW A;  3SG6 A;  1F4O A;  3O78 A;  2JQ6 A;  2CNP A;  1TNP A;  1IQ5 A;  2WOS A;  4MRY A;  1FI6 A;  1H8B A;  2FCD A;  2WCL A;  5AEQ A;  2KQY A;  1S26 D;  3B87 A;  4DUQ A;  1UP5 A;  2KI4 C;  5CSN A;  2P6B B;  3SS4 A;  3BUM B;  3VGO A;  3D10 A;  1EJ3 A;  3D78 A;  1Y0V H;  3L47 A;  1NCZ A;  1L2O B;  1NP8 A;  2MRD A;  2ZRS A;  3TDI A;  3I5I C;  4CFR A;  4AQI A;  2G2B A;  5DKN A;  4MBE A;  4R1E A;  3Q8I A;  5EL2 A;  3AKA A;  3VRP A;  1BR4 B;  1SL8 A;  3EG5 B;  1DTL A;  3CR2 A;  1YUU A;  3BQ3 A;  1CKK A;  3BFA A;  4M2P A;  3O2P A;  4ORA B;  2EC6 B;  1KQM C;  2JOJ A;  1EXR A;  3S0D A;  5JJG A;  1BF5 A;  2ERB A;  2KFG A;  2E30 A;  3M0W A;  1DGV A;  2QAC A;  2KGR A;  1C7W A;  5ER5 A;  3RM1 A;  1DJI A;  2EHB A;  4D1E A;  1B4C A;  4N1F A;  4GNK B;  3DF0 B;  3LK0 A;  1P28 A;  1YVL A;  3GOF A;  1DQE A;  3CWG A;  1R2U A;  2L4H A;  1JFJ A;  1Z4H A;  1BT6 A;  1QVI Y;  1S36 A;  1C7V A;  4ORB B;  1K9P A;  2CXJ A;  4ETO A;  1OZO A;  1K94 A;  2HQ8 A;  4OKH A;  2GGZ A;  1K93 D;  3JTD C;  3FIA A;  2K7D A;  2ZN9 A;  4L9M A;  1PVB A;  3BFH A;  1TN4 A;  2M7L A;  1Y1X A;  2I2R E;  2K2A A;  1G8I A;  3BJH A;  1S6C A;  3K21 A;  2L98 A;  1YRT B;  1TNW A;  1OOG A;  3VB1 A;  1QAT A;  1DJH A;  2L2C A;  1B8C A;  3NHT A;  1ZFS A;  1YUR A;  1KFX S;  4OR9 B;  5B8I B;  3FE9 A;  1DT7 B;  1QIV A;  2FJY A;  2R2I A;  2Y4Q A;  4YBH B;  3PLF B;  1YRU B;  1JBA A;  2BCA A;  5I2L A;  1SCM B;  2JWW A;  3I5H C;  2Y1N A;  3OBV A;  3BYA A;  3VRN A;  4DRW A;  1WY9 A;  2DOQ A;  1OMD A;  1GQM A;  2K61 A;  2L5Y A;  2WCE A;  1TOP A;  3IQO A;  2WCF A;  2K7B A;  1YVH A;  3B6X A;  2LMU A;  4FTG A;  4YRU A;  1N65 A;  2I94 A;  1XA5 A;  3CZT X;  3PM2 A;  1SK6 D;  2MJW B;  4PHK A;  1CLB A;  2KI4 B;  1QLK A;  4CLN A;  1CLM A;  3R1O A;  2PAL A;  1J1D A;  2KFF A;  1IJ5 A;  3K1E A;  1SL9 A;  1J7Q A;  5DIC A;  1S5G Y;  1LS8 A;  3O4Y A;  3TZ1 A;  5IBW A;  2L0P A;  4WQ3 A;  1Y1U A;  3CR4 X;  2LHI A;  4OCI A;  1DEK A;  1W7J B;  1L2O C;  2P71 A;  5AER A;  5FI6 A;  1KQM B;  3DVM A;  1A75 B;  3D0Y A;  3SJS A;  1YUT A;  4QJ3 B;  2MBX A;  1FF1 A;  3S0B A;  1XFU O;  1QS7 A;  5HLO A;  3ICB A;  3N7H A;  2G9B A;  1G4Y R;  1OMR A;  1TNQ A;  3OB2 B;  4P5O E;  5K89 A;  4INX A;  2KLE A;  1EG4 A;  1UHH A;  3IF7 A;  1B8R A;  3CZ2 A;  5BPJ A;  5HKW A;  3LLE A;  1W9Z A;  3R72 A;  1IGV A;  3NHI A;  2HET A;  1A4P A;  4N5X A;  1RJV A;  3H4S E;  4ORC B;  3UO9 A;  1C07 A;  1ZOT B;  1QX5 B;  2CT9 A;  2JC2 A;  1K9K A;  1K90 D;  5CSJ A;  2F33 A;  4GUK A;  3MSE B;  4AOM A;  3O6B A;  1UHI A;  1MR8 A;  3AAK A;  1PSB A;  1QV1 A;  4DCK A;  3I5F B;  1BOD A;  4MEW A;  5AAN A;  1CDL A;  2FCE A;  3LCP C;  1EH2 A;  1MXE A;  1SL7 A;  1LA0 A;  1SYM A;  2BBM A;  2VRG A;  1CFP A;  1GM0 A;  2COL B;  3CR5 X;  3IVT A;  3LL8 B;  2CBL A;  4CFQ A;  1SCM C;  2RGI A;  2V53 A;  1A2X A;  3S0A A;  1NX2 A;  1MXL C;  3KEV A;  1ZMZ A;  1B7T Z;  1WRZ A;  2BNX A;  2LLS A;  3KO0 A;  2H8V A;  4PT1 A;  4QJ4 B;  4YI9 A;  3TUY B;  2WCB A;  4MRX A;  1KFX L;  1TIZ A;  1NX0 A;  2NCP A;  3KF9 A;  1LIN A;  2L5X B;  1MWN A;  1W7I B;  2NZ0 A;  3D76 A;  4ZCU A;  3QRX A;  2KSP A;  1F70 A;  1UWO A;  1XYD A;  2EGD A;  2M0R A;  4JQ0 D;  1DJG A;  1WRL A;  3PAT A;  4YGE B;  2PVB A;  1JWD A;  1YUS A;  4USL A;  2GTE A;  3PM8 A;  2L4I A;  3DXL A;  1NPQ A;  2ZFD A;  3TDZ A;  1JFK A;  3CTN A;  1L7Z A;  1QAS A;  2LP2 A;  1SKT A;  1XFR A;  3A4U B;  1J55 A;  5ER4 X;  2PMY A;  3SIB A;  2BKH B;  2JPO A;  3I5G B;  4JPZ B;  1CNP A;  2D8N A;  1QX2 A;  3DVE A;  4I5N B;  4WRI A;  3ZNI A;  4YI8 A;  3TDU A;  1F71 A;  3UNW A;  3B88 A;  1S5G Z;  2MLE C;  4MZL A;  4NDD A;  3F45 A;  2LM5 A;  3SG2 A;  3VRQ A;  1PVA A;  1RFJ A;  3OP0 A;  1DF0 A;  5KU1 A;  2LC5 A;  3A8R A;  2GGM A;  1OQP A;  3SG3 A;  4HSZ A;  2H61 A;  1BMO A;  1NYA A;  2F3Z A;  3OHM B;  1KQV A;  1AHR A;  1Y6W A;  1K2H A;  1JF2 A;  1NX3 A;  1B7T Y;  2I7A A;  4MZJ A;  2M29 A;  3EKJ A;  5I2O A;  1CLL A;  2E6W A;  5I94 A;  1WDC B;  1ZAC A;  3NGV A;  2M49 B;  3EKH A;  5AFP A;  1SBJ A;  1K95 A;  1IG5 A;  2JXL A;  3I5F C;  1XO5 A;  3PAL A;  3GK2 A;  1QX7 A;  2MAZ A;  3BOW A;  2AMI A;  1DC1 A;  2Q4U A;  4GBA A;  2LUC A;  4UPG A;  5PAL A;  1M45 A;  1TNX A;  5G08 A;  4YGD B;  4U8D A;  1XK4 A;  1BJF A;  2P70 A;  1AK8 A;  3CLN A;  1OOF A;  2WC6 A;  2MA2 A;  1GGW A;  1K8U A;  4IJ7 A;  4AQJ A;  3D75 A;  2OS8 B;  1SPY A;  1JF0 A;  2ZND A;  1HQV A;  1MUX A;  1CFD A;  2QDI A;  2KI6 C;  2MHH A;  1SMG A;  5KSZ A;  3S0E A;  1TWO A;  3TUY C;  2JRF A;  3CGA A;  1WRK A;  2JT0 A;  5HL1 A;  1BLQ A;  1DVI A;  1QTX A;  1QLS A;  3SS3 A;  4PE0 A;  5CSI A;  4XJK A;  4NDC A;  4A4C A;  5I8N A;  4CPV A;  3PSR A;  5GQQ C;  2QPT A;  2Q91 A;  4BY4 A;  1OW4 A;  1N0Y A;  1EG3 A;  1EL4 A;  1CTR A;  5DKQ A;  1XFZ O;  2LMV A;  1DJX A;  1KK8 C;  1UUS A;  1B9A A;  3AKB A;  4FQO A;  4PHN A;  4C0K A;  1F4Q A;  1BR1 B;  3I5G C;  1QWV A;  4JD9 A;  5I2Q A;  2KFH A;  1XVJ A;  2AUC A;  3DD4 A;  3BXK A;  1KWO B;  3PN7 B;  2BL0 B;  3EK4 A;  2LLU A;  5J3X A;  3S0G A;  2L50 A;  5TNC A;  1F55 A;  4C0L A; 
#chains in the Genus database with same CATH homology
 2JTT A;  1QV0 A;  1SR6 C;  3FWB A;  1M39 A;  1PAL A;  3IQQ A;  1JSA A;  1K96 A;  5HKZ A;  5CPV A;  2BBN A;  1U5I A;  1OMV A;  1WLZ A;  2A4J A;  2CCM A;  3FWC A;  1NWD A;  1PSR A;  5D69 A;  1WDC C;  2JXC A;  2KAY A;  4MLW A;  1NIW A;  3AAJ A;  2BE6 A;  3KPX A;  1AJ5 A;  4I5J A;  2M8U A;  3GK1 A;  2M97 A;  3NSK A;  4M2O A;  2K0J A;  1BOC A;  1KK7 Z;  1YX8 A;  4HRH A;  2FJU B;  1F54 A;  2LVJ A;  2JZI A;  2LNK A;  1IWQ A;  2K7O A;  2LAP A;  2M7N A;  1K9U A;  1A03 A;  2OPO A;  2H2K A;  1IRJ A;  4P2Y B;  1AUI B;  1GGZ A;  3BUW B;  1NCX A;  4XYN A;  3HX4 A;  2ZN8 A;  5AXI A;  1YTZ C;  2OS8 C;  1NSH A;  2CTN A;  3C1V A;  4GPL B;  2LLT A;  1G33 A;  4OVN F;  4XJK B;  2SCP A;  2KAV A;  1RTP 1;  3TS5 B;  1KCY A;  1RRO A;  4GGF A;  3OX6 A;  1N2D A;  1R6P A;  2JPT A;  4QJ5 B;  4PE4 A;  3JVT B;  1ALW A;  3D0Y B;  4PHM A;  3WNX B;  1SRA A;  1LXF C;  4YGC B;  1REC A;  2L51 A;  2JT3 A;  1KK8 B;  1OSA A;  3OX5 A;  1CMF A;  3EVV A;  1CM1 A;  4N1G A;  1LA3 A;  4NDB A;  2Y5I A;  5D7F A;  1GJY A;  4CID A;  1DMO A;  1S6J A;  1IH0 A;  1XFV O;  2I18 A;  1KSM A;  3EVR A;  4MSP A;  1Q80 A;  4MZK A;  1J7P A;  1CDP A;  3NSO A;  1SR6 B;  1B47 A;  1KWO C;  3PN7 C;  4PE7 A;  1NCY A;  2H61 C;  2BL0 C;  4I5K A;  1U5I B;  3FS7 A;  1KK7 Y;  1IJ6 A;  4IL1 A;  2O60 A;  1JUO A;  4GAO A;  2JTZ A;  2LCP A;  5HKY A;  2OTG B;  1YR5 A;  2B1U A;  2F2P A;  1DJZ A;  1A29 A;  2PAS A;  4BY5 A;  1D1O A;  2KBI A;  1A75 A;  2L2E A;  3SIA A;  1FBV A;  2NLN A;  3BUN B;  3E3R A;  3WHU B;  1TCF A;  4A4B A;  1CDN A;  2KI6 D;  3WXA A;  1BG1 A;  1F8H A;  2KHN A;  2KYF A;  2AAO A;  1CMG A;  1SCV A;  1PK0 D;  1DJW A;  1XK4 C;  4GGN A;  2BCX A;  1KFU S;  1SY9 A;  1UHK A;  2NCO A;  1XFY O;  1M46 A;  1TRF A;  1NUB A;  1QJT A;  2ZKM X;  4F0Z B;  5KTY A;  1CB1 A;  2LVV A;  1RK9 A;  2HPS A;  4M2Q A;  5JOL A;  2KQ6 A;  4HRG A;  4OV2 A;  1B8L A;  1TCO B;  1SNL A;  3BUO B;  1FI5 A;  2LUX A;  2M1U A;  1CFC A;  1IKU A;  2HF5 A;  1PUL A;  4PAL A;  4PDZ A;  1ALV A;  1LKJ A;  2BEC A;  3NSL A;  1IQ3 A;  5DKR A;  3GK4 X;  3TS5 C;  2FOT A;  4PE1 A;  1XFW O;  2PSR A;  3EVU A;  3DVK A;  4GFT A;  3CS1 A;  5CSF A;  3WHT B;  1S3P A;  3VRO A;  1FPW A;  3JVT C;  1QIW A;  4TNC A;  2ZRT A;  2M1K B;  2K8M B;  3VRR A;  1OE9 B;  1XFX O;  1HT9 A;  1RWY A;  3EK8 A;  1NX1 A;  2Y1M A;  2JT8 A;  2KBM A;  1V1F A;  2JU0 A;  2BE4 A;  1OOJ A;  2WOR A;  2K2F A;  4I5L B;  1DF0 B;  1MHO A;  1OZS A;  1UHN A;  1CFF A;  2JUL A;  1J7R A;  3BUX B;  1J1E A;  2LVI A;  3NSI A;  2NXQ A;  1CM4 A;  3I5I B;  1TTX A;  1DGU A;  2HQW A;  1AVS A;  5HYD A;  2GV5 A;  1V1G A;  2LAN A;  3DVJ A;  1FW4 A;  3EK7 A;  2WC8 A;  1M31 A;  1X02 A;  2O5G A;  3SG5 A;  4YGB B;  1VRK A;  5FYX A;  2F2O A;  4ZCV A;  1S1E A;  2MLF C;  2EC6 C;  1UUR A;  5HLV A;  2WND A;  1KSO A;  1QXP A;  2M3W A;  2OTG C;  3BOW B;  4PHJ A;  4DIR A;  1BU3 A;  4DS7 A;  1B1G A;  1H4B A;  3KHE A;  2LVK A;  4HRE E;  1PRW A;  2LP3 A;  2M9G A;  1E8A A;  3JTD B;  1MQ1 A;  3RLZ A;  2KNE A;  3DF0 A;  1UHJ A;  2JNF A;  4Q04 A;  3SG4 A;  1WLM A;  2IS9 A;  4ICB A;  1LVC D;  2SAS A;  2KGB C;  3SG7 A;  1AP4 A;  2LE9 B;  1ODB A;  4MVF A;  1J7O A;  4MN0 A;  3NXA A;  2KOT A;  4WQ2 A;  4YGA A;  2ISD A;  2K7C A;  2LMT A;  2LV7 A;  1S6I A;  3LK1 A;  1CDM A;  3ZWH A;  4NQG A;  4C0J A;  3HCM A;  1ZUZ A;  2LHL A;  2PRU A;  1JC2 A;  3I5H B;  4GGF C;  3OB1 B;  1QVI Z;  2ZNE A;  1SW8 A;  1M63 B;  1MF8 B;  2BKI B;  2JNX A;  2KYC A;  2TN4 A;  1DJY A;  1AJ4 A;  2BCB A;  3PFV A;  5F6T A;  1KFU L;  1Y1A A;  2F8P A;  4E68 A;  2F3Y A;  2KAX A;  4JWQ A;  1YX7 A;  2KDH A;  4PCW A;  3SG6 A;  1F4O A;  3O78 A;  2JQ6 A;  2CNP A;  1TNP A;  1IQ5 A;  2WOS A;  4MRY A;  1FI6 A;  1H8B A;  2FCD A;  5AEQ A;  2KQY A;  1S26 D;  4DUQ A;  1UP5 A;  2KI4 C;  5CSN A;  2P6B B;  3BUM B;  3VGO A;  3D10 A;  1EJ3 A;  1Y0V H;  3TDI A;  1NCZ A;  1L2O B;  1NP8 A;  2MRD A;  2ZRS A;  3I5I C;  4CFR A;  4AQI A;  2G2B A;  5DKN A;  4MBE A;  4R1E A;  3VRP A;  3AKA A;  1BR4 B;  1SL8 A;  1DTL A;  3CR2 A;  1YUU A;  3BQ3 A;  1CKK A;  4M2P A;  3O2P A;  4ORA B;  2EC6 B;  1KQM C;  2JOJ A;  1EXR A;  5JJG A;  1BF5 A;  2KFG A;  2E30 A;  3M0W A;  1DGV A;  2QAC A;  2KGR A;  1C7W A;  5ER5 A;  3RM1 A;  1DJI A;  2EHB A;  4D1E A;  1B4C A;  4N1F A;  4GNK B;  3DF0 B;  3LK0 A;  3GOF A;  1YVL A;  3CWG A;  1R2U A;  2L4H A;  1JFJ A;  1BT6 A;  1QVI Y;  1S36 A;  1C7V A;  4ORB B;  1K9P A;  2CXJ A;  4ETO A;  1OZO A;  1K94 A;  2HQ8 A;  4OKH A;  2GGZ A;  1K93 D;  3JTD C;  3FIA A;  2K7D A;  2ZN9 A;  4L9M A;  1PVB A;  1TN4 A;  2M7L A;  1Y1X A;  2I2R E;  2K2A A;  1G8I A;  1S6C A;  3K21 A;  2L98 A;  1YRT B;  1TNW A;  1QAT A;  1DJH A;  1B8C A;  1ZFS A;  1YUR A;  1KFX S;  4OR9 B;  5B8I B;  1DT7 B;  1QIV A;  2R2I A;  2Y4Q A;  4YBH B;  3PLF B;  1YRU B;  1JBA A;  2BCA A;  5I2L A;  1SCM B;  2JWW A;  3I5H C;  2Y1N A;  3VRN A;  3BYA A;  4DRW A;  1WY9 A;  2DOQ A;  1OMD A;  1GQM A;  2K61 A;  2WCE A;  1TOP A;  3IQO A;  2WCF A;  2K7B A;  1YVH A;  4FTG A;  2LMU A;  4YRU A;  1N65 A;  2I94 A;  1XA5 A;  3CZT X;  1SK6 D;  2MJW B;  4PHK A;  1CLB A;  2KI4 B;  1QLK A;  4CLN A;  1CLM A;  2PAL A;  1J1D A;  2KFF A;  1IJ5 A;  1J7Q A;  1SL9 A;  1S5G Y;  3TZ1 A;  3O4Y A;  5IBW A;  2L0P A;  4WQ3 A;  1Y1U A;  3CR4 X;  2LHI A;  4OCI A;  1W7J B;  1L2O C;  5AER A;  1KQM B;  3DVM A;  1A75 B;  3D0Y A;  3SJS A;  1YUT A;  4QJ3 B;  2MBX A;  1FF1 A;  1XFU O;  1QS7 A;  5HLO A;  3ICB A;  2G9B A;  1G4Y R;  1OMR A;  1TNQ A;  3OB2 B;  4P5O E;  5K89 A;  1EG4 A;  1UHH A;  3IF7 A;  1B8R A;  5BPJ A;  5HKW A;  3LLE A;  1IGV A;  2HET A;  1A4P A;  4N5X A;  1RJV A;  3H4S E;  4ORC B;  1C07 A;  1ZOT B;  1QX5 B;  2CT9 A;  2JC2 A;  1K9K A;  1K90 D;  5CSJ A;  2F33 A;  4GUK A;  3MSE B;  4AOM A;  3O6B A;  1UHI A;  1MR8 A;  3AAK A;  1PSB A;  1QV1 A;  4DCK A;  3I5F B;  1BOD A;  4MEW A;  5AAN A;  1CDL A;  2FCE A;  3LCP C;  1EH2 A;  1MXE A;  1SL7 A;  1LA0 A;  1SYM A;  2BBM A;  2VRG A;  1CFP A;  2COL B;  3CR5 X;  3LL8 B;  2CBL A;  4CFQ A;  1SCM C;  2RGI A;  2V53 A;  1A2X A;  1NX2 A;  1MXL C;  3KEV A;  1ZMZ A;  1B7T Z;  1WRZ A;  2LLS A;  3KO0 A;  4QJ4 B;  4YI9 A;  3TUY B;  2WCB A;  4MRX A;  1KFX L;  1TIZ A;  1NX0 A;  2NCP A;  3KF9 A;  1LIN A;  2L5X B;  1MWN A;  1W7I B;  2NZ0 A;  4ZCU A;  3QRX A;  2KSP A;  1F70 A;  1UWO A;  1XYD A;  2EGD A;  2M0R A;  4JQ0 D;  1DJG A;  1WRL A;  3PAT A;  4YGE B;  2PVB A;  1JWD A;  1YUS A;  4USL A;  3PM8 A;  2L4I A;  3TDZ A;  1NPQ A;  2ZFD A;  1JFK A;  3CTN A;  1L7Z A;  1QAS A;  2LP2 A;  1SKT A;  3A4U B;  1J55 A;  5ER4 X;  2PMY A;  3SIB A;  2BKH B;  3I5G B;  4JPZ B;  1CNP A;  2D8N A;  1QX2 A;  3DVE A;  4I5N B;  4WRI A;  3ZNI A;  4YI8 A;  3TDU A;  1F71 A;  1S5G Z;  2MLE C;  4MZL A;  4NDD A;  3F45 A;  2LM5 A;  3SG2 A;  3VRQ A;  1PVA A;  1RFJ A;  3OP0 A;  1DF0 A;  5KU1 A;  2LC5 A;  3A8R A;  2GGM A;  1OQP A;  3SG3 A;  4HSZ A;  2H61 A;  1BMO A;  1NYA A;  2F3Z A;  3OHM B;  1KQV A;  1AHR A;  1Y6W A;  1K2H A;  1JF2 A;  1NX3 A;  1B7T Y;  2I7A A;  4MZJ A;  2M29 A;  3EKJ A;  5I2O A;  1CLL A;  2E6W A;  1WDC B;  1ZAC A;  2M49 B;  3EKH A;  5AFP A;  1SBJ A;  1K95 A;  1IG5 A;  2JXL A;  3I5F C;  1XO5 A;  3PAL A;  3GK2 A;  1QX7 A;  2MAZ A;  3BOW A;  2AMI A;  2Q4U A;  4GBA A;  2LUC A;  4UPG A;  5PAL A;  1M45 A;  1TNX A;  5G08 A;  4YGD B;  4U8D A;  1XK4 A;  1BJF A;  1AK8 A;  3CLN A;  2MA2 A;  1GGW A;  1K8U A;  4AQJ A;  2OS8 B;  1SPY A;  1JF0 A;  2ZND A;  1HQV A;  1MUX A;  1CFD A;  2KI6 C;  2MHH A;  1SMG A;  5KSZ A;  3TUY C;  2JRF A;  3CGA A;  1WRK A;  2JT0 A;  1BLQ A;  1DVI A;  1QTX A;  1QLS A;  4PE0 A;  5CSI A;  4XJK A;  4NDC A;  4A4C A;  5I8N A;  4CPV A;  3PSR A;  5GQQ C;  2QPT A;  2Q91 A;  4BY4 A;  1N0Y A;  1EG3 A;  1EL4 A;  1CTR A;  5DKQ A;  1XFZ O;  2LMV A;  1DJX A;  1KK8 C;  1UUS A;  1B9A A;  3AKB A;  4FQO A;  4PHN A;  4C0K A;  1F4Q A;  1BR1 B;  3I5G C;  5I2Q A;  2KFH A;  1XVJ A;  2AUC A;  3DD4 A;  3BXK A;  1KWO B;  3PN7 B;  2BL0 B;  3EK4 A;  2LLU A;  5J3X A;  2L50 A;  5TNC A;  1F55 A;  4C0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...