2D8NA

Crystal structure of human recoverin at 2.2 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Recoverin
publication title Crystal structure of human recoverin at 2.2 A resolution
rcsb
source organism Homo sapiens
total genus 67
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2d8nA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2d8nA01
2L51A 1IJ5A 1QXPA 4DIRA 1RWYA 2BCBA 1TNXA 1Y6WA 2HPSA 1IJ6A 2ZNDA 2NLNA 1W7IB 2PSRA 1QV0A 1LKJA 1QX2A 4YI9A 1B1GA 4MBEA 1A03A 5AEQA 1KFUL 2JZIA 2MHHA 2MLEC 2WCEA 3TDIA 1L7ZA 1DJGA 5FYXA 1CFCA 3F45A 1BLQA 3CR5X 1QLKA 2M97A 2M7LA 3VRRA 1JF0A 1M39A 1OSAA 1PALA 2ZN8A 4I5JA 5AANA 1NPQA 3JTDB 4I5NB 1U5IB 4DRWA 2KFHA 4DS7A 1KSMA 2BKHB 3JVTB 1G8IA 3I5IC 1U5IA 4ORAB 1TNPA 2H2KA 2LP3A 2I94A 1YURA 1OZOA 1CTRA 1XK4C 2LC5A 1FF1A 4E68A 1MUXA 2Q91A 1NX0A 5DKRA 2WCBA 5JOLA 1J7OA 4Q04A 3CR4X 4GNKB 3KHEA 2OTGC 1TRFA 3D10A 1X02A 4HRHA 1CDLA 3M0WA 2RGIA 4WRIA 3RLZA 4M2OA 4MZJA 4M2QA 3KPXA 1YVLA 2MRDA 3CS1A 2PVBA 1J1EA 3PM8A 4NDDA 2ZRTA 2JT3A 2JWWA 2KBIA 2KQYA 2CBLA 3I5FB 1NWDA 5TNCA 2H61C 2FJUB 2EHBA 3GK4X 1KFXL 4NDCA 2NCOA 3EVVA 1M63B 3KF9A 3O4YA 1L2OB 1ZFSA 1BT6A 5HKWA 4JWQA 2AMIA 1DF0B 4GGFC 4R1EA 3VGOA 2WCFA 2BECA 2JU0A 3AKBA 4U8DA 1EG3A 1UHKA 2K2FA 4WQ3A 3GOFA 2BL0C 1RECA 2LHLA 2LVKA 4MZLA 1YUSA 4UPGA 1UHHA 1B4CA 3PALA 3C1VA 4YRUA 1IWQA 3TS5B 1CFPA 5I2QA 1J1DA 1N65A 1CDMA 2JNFA 1S5GZ 3TZ1A 1A75A 3CGAA 4N1FA 2F3ZA 3SG3A 2KYCA 1CFFA 1B9AA 2VRGA 4MN0A 1DGUA 1PSRA 3O2PA 3JTDC 4PHKA 1H8BA 3BXKA 4A4CA 2SASA 1EG4A 1LVCD 1NIWA 1LINA 4YGCB 4QJ4B 1G4YR 1XA5A 1MXEA 1DTLA 4PHNA 1DT7B 3D0YB 2LLUA 4GAOA 2FCEA 1XFYO 3I5IB 1CDNA 5AXIA 4PE4A 1SL8A 1IH0A 1KK7Z 1KWOC 1OE9B 1CLLA 1J55A 2AUCA 2O60A 1XK4A 1NX2A 4MRXA 1SCVA 1SY9A 2BBNA 1QTXA 3DF0B 4OVNF 3BQ3A 2F2PA 2I7AA 3OX5A 2JT0A 1K90D 4XJKB 1TNWA 2OTGB 1CMFA 1PK0D 2M0RA 1S6IA 3LCPC 1JWDA 1UHNA 4MZKA 1K96A 2M9GA 3I5FC 1JUOA 2JXCA 2KAVA 1DGVA 1ZOTB 5CSIA 2BKIB 4USLA 3K21A 4WQ2A 1IRJA 1L2OC 2HQ8A 2CCMA 3WXAA 5I2LA 1QS7A 3BUOB 3GK1A 2H61A 3PLFB 1LA0A 2L50A 2M8UA 2PALA 2KI4B 1TOPA 2PASA 4YGDB 5ER5A 3TS5C 2PMYA 4GGFA 1K2HA 4OKHA 3O6BA 2BL0B 3SG4A 2QPTA 1JSAA 1AUIB 1CM4A 2P6BB 1ZMZA 2K7DA 3LLEA 2G9BA 3AAJA 2K2AA 1PULA 2M29A 2LAPA 1CB1A 1KQMB 2JTZA 1KFUS 3LK1A 4HREE 1DJHA 2AAOA 2M7NA 1J7QA 1H4BA 3DVMA 2I18A 1MF8B 4PALA 1WY9A 2Y4QA 2CT9A 3AAKA 4GGNA 2JXLA 1GQMA 3SG2A 1SCMB 1W7JB 1AK8A 2HQWA 1V1GA 2KSPA 3DVKA 1VRKA 2ZNEA 1WLMA 5HYDA 1K95A 1HQVA 4YI8A 3ZNIA 5HLVA 1Y1AA 2OS8B 2MJWB 1KWOB 3IQQA 1AHRA 1OMDA 1QASA 2WNDA 1LA3A 1XVJA 1ALWA 1WRKA 2CTNA 1M31A 1B8CA 1B7TY 1BODA 4P2YB 1BR1B 3CWGA 3NXAA 1XFZO 3A4UB 1TNQA 3WNXB 1SRAA 4C0JA 1JC2A 1MR8A 1NX3A 1SPYA 1PVAA 2R2IA 1NCYA 4ETOA 1UUSA 1D1OA 1BJFA 5KU1A 4CLNA 3SG7A 3HX4A 2K0JA 1YRTB 2MLFC 2NXQA 2EGDA 1BF5A 2LMVA 2LVJA 2M1UA 2KI4C 4MSPA 3KEVA 1F71A 1QX5B 1DJXA 1DF0A 2WC8A 1WLZA 4BY5A 4GUKA 4OCIA 1Y1XA 2GV5A 3EK7A 1SR6B 2KAXA 5KSZA 1DJYA 2GGZA 5D7FA 2LM5A 2V53A 3OP0A 1K8UA 1AP4A 2K7BA 3OB2B 2L0PA 2K61A 4PE0A 1KQMC 1FI5A 1DJWA 1QVIZ 3PN7B 3CZTX 5HLOA 4C0LA 1UURA 1WDCC 2BBMA 2JNXA 4BY4A 1KQVA 1JFKA 4MRYA 5F6TA 1K9KA 2MAZA 1TTXA 2TN4A 4XYNA 4YGAA 3FWCA 1UHIA 1SL9A 3TDZA 1EH2A 2F2OA 1SCMC 4ORBB 2K8MB 2LLSA 1Q80A 4GBAA 2LMTA 1J7PA 3BOWB 3E3RA 2NZ0A 1FI6A 3BOWA 4JQ0D 3D0YA 4HRGA 3FWBA 2HF5A 2OS8C 1ALVA 1RROA 2LVVA 2LE9B 2EC6B 1QJTA 1QIVA 4CFRA 4CPVA 3DVEA 2ISDA 4PE7A 5BPJA 3SIBA 2M49B 5D69A 1YRUB 1SW8A 1C7VA 4I5KA 5K89A 1CLMA 1JBAA 5DKQA 1DJZA 3DF0A 4D1EA 1M46A 1IQ3A 3CR2A 4XJKA 4P5OE 2KNEA 1MHOA 1S36A 3TDUA 1UHJA 1CNPA 3A8RA 3NSOA 1F54A 1S5GY 2E30A 5I2OA 3DVJA 3IF7A 4MEWA 1QLSA 5I8NA 2KOTA 1KK8B 4IL1A 1F4OA 4NDBA 1PSBA 1TCFA 1UP5A 2G2BA 2L5XB 3BUNB 4M2PA 3SJSA 1F55A 2L4HA 2GGMA 2JT8A 2KHNA 1MQ1A 2M3WA 2CXJA 3BUWB 1OMRA 1AJ5A 4A4BA 2QACA 1IG5A 4ZCUA 4N1GA 2B1UA 1SR6C 1NP8A 1QIWA 2SCPA 1B8LA 2KGRA 2LANA 1KK7Y 1N0YA 2F3YA 3GK2A 5GQQC 1A2XA 1F70A 1SMGA 1SKTA 3DD4A 3PN7C 3WHTB 3FS7A 1CM1A 5AERA 3I5HB 4PE1A 3KO0A 4N5XA 5CSNA 2K7CA 4MVFA 2L2EA 1DMOA 1E8AA 2ZKMX 1PVBA 4JPZB 1WDCB 3VRNA 4AQIA 5DKNA 1MXLC 2F33A 1SNLA 2Y1MA 1JFJA 1B7TZ 4HSZA 4YBHB 2LNKA 1M45A 1CLBA 4OV2A 2LVIA 1KSOA 2LUXA 3LL8B 2LMUA 1PRWA 2MA2A 4AQJA 1WRLA 4YGEB 4QJ5B 3EVRA 2EC6C 2JPTA 3RM1A 3BYAA 1K93D 1F4QA 2PRUA 1DJIA 4ZCVA 5PALA 3ICBA 4FQOA 2E6WA 2Q4UA 4C0KA 1S1EA 2FCDA 1SBJA 3O78A 3VROA 1UWOA 2L98A 2KYFA 1R6PA 2A4JA 1OQPA 5CSFA 1YX7A 4PCWA 2COLB 1TN4A 2KFFA 1SL7A 1HT9A 1CKKA 2JOJA 1ZUZA 3I5GB 1XO5A 4AOMA 2KQ6A 2LLTA 1XFXO 2LP2A 1K9UA 4GFTA 1ZACA 5KTYA 1R2UA 3SIAA 1KK8C 3OHMB 3MSEB 5B8IB 1YVHA 1JF2A 1YUUA 3BUXB 1N2DA 2Y1NA 2CNPA 3PFVA 1F8HA 2LCPA 3VRPA 2JRFA 5AFPA 1BR4B 2KAYA 1SYMA 2KI6D 3TUYB 4GPLB 5JJGA 1NUBA 1KFXS 2NCPA 4CFQA 4PHMA 1TIZA 1NCXA 1AVSA 4L9MA 2KBMA 1CDPA 1B8RA 2KDHA 5CSJA 1XFVO 1IGVA 2OPOA 1Y1UA 1NX1A 4NQGA 3WHUB 3I5HC 3PATA 1OMVA 3SG5A 1CMGA 1V1FA 3CLNA 1BG1A 1QX7A 3BUMB 3EK8A 1CFDA 3OB1B 5ER4X 1K9PA 1S3PA 1TCOB 2WORA 5CPVA 1DVIA 3EK4A 1J7RA 3NSKA 2I2RE 1RK9A 1RJVA 1YR5A 3IQOA 4QJ3B 1C07A 1BMOA 5G08A 1QV1A 1RFJA 4YGBB 1A29A 4ORCB 1FPWA 2JTTA 1FBVA 2O5GA 4PDZA 1RTP1 1K94A 4FTGA 1A75B 2Y5IA 3HCMA 1XFWO 5HKYA 1XYDA 1NYAA 1LXFC 1ODBA 3NSIA 2LHIA 2MBXA 4MLWA 3QRXA 3H4SE 4I5LB 2BE6A 2LV7A 1BOCA 1NCZA 2ZRSA 1SK6D 1GGWA 1A4PA 1KCYA 2FOTA 3JVTC 1WRZA 5J3XA 2ZFDA 3I5GC 2DOQA 5IBWA 1GJYA 1S6CA 1NSHA 1FW4A 4PHJA 3EKJA 4DUQA 2BCAA 1BU3A 2HETA 1IKUA 3OX6A 1MWNA 1QVIY 2BCXA 2K7OA 1C7WA 1S6JA 3VRQA 1OZSA 3LK0A 1YTZC 3SG6A 1OOJA 2ZN9A 4TNCA 3ZWHA 3TUYC 1S26D 1YUTA 1G33A 3NSLA 4F0ZB 2IS9A 2L4IA 3EVUA 2WOSA 1XFUO 2KFGA 4OR9B 1EJ3A 4CIDA 1QATA 2JULA 1IQ5A 2LUCA 4DCKA 2KI6C 2KGBC 2BE4A 1AJ4A 1EXRA 2F8PA 4ICBA 2JC2A 3AKAA 1EL4A 3FIAA 2D8NA 2M1KB 3CTNA 1Y0VH 5HKZA 1YX8A 2JQ6A 1GGZA 3EKHA 1B47A 3PSRA
chains in the Genus database with same CATH superfamily
2L51A 1IJ5A 1QXPA 3D76A 4DIRA 1RWYA 2BCBA 1TNXA 1Y6WA 2HPSA 1IJ6A 2ZNDA 2NLNA 1W7IB 2PSRA 1QV0A 1LKJA 1QX2A 4YI9A 1B1GA 4MBEA 1A03A 2PYQA 5AEQA 1KFUL 2JZIA 2MHHA 2MLEC 2WCEA 3TDIA 1L7ZA 1DJGA 3NGVA 5FYXA 1CFCA 3F45A 1BLQA 3CR5X 1QLKA 2M97A 3S0GA 2M7LA 3VRRA 1JF0A 1M39A 1OSAA 1PALA 2ZN8A 4I5JA 5AANA 1NPQA 3DY9A 3JTDB 4I5NB 1U5IB 4DRWA 2KFHA 4DS7A 1KSMA 2BKHB 3JVTB 1G8IA 3I5IC 1U5IA 4ORAB 1TNPA 3FE8A 2H2KA 3D73A 2LP3A 2I94A 1YURA 1OZOA 1CTRA 1XK4C 2LC5A 1FF1A 4E68A 1MUXA 2Q91A 1NX0A 5DKRA 3CYZA 2WCBA 5JOLA 1J7OA 4Q04A 3CR4X 4GNKB 2JPOA 3KHEA 2OTGC 1TRFA 3D10A 1X02A 4HRHA 1CDLA 3M0WA 2RGIA 4WRIA 3RLZA 4M2OA 4MZJA 4M2QA 3KPXA 1YVLA 2MRDA 3CS1A 2PVBA 1J1EA 3PM8A 4NDDA 2ZRTA 2JT3A 2JWWA 4PT1A 2KBIA 2KQYA 2CBLA 3I5FB 3FE6A 1NWDA 5TNCA 3VB1A 2H61C 2FJUB 3CZ0A 4JD9A 2EHBA 3GK4X 1OOGA 5DICA 1KFXL 4NDCA 2NCOA 3EVVA 1M63B 3KF9A 3O4YA 1L2OB 1ZFSA 1BT6A 5HKWA 4JWQA 2AMIA 1DF0B 4GGFC 4R1EA 3VGOA 2WCFA 2BECA 2JU0A 3AKBA 4U8DA 1EG3A 1UHKA 2K2FA 2QDIA 3GOFA 4WQ3A 3UNWA 2BL0C 1RECA 2LHLA 2LVKA 4MZLA 1YUSA 4UPGA 1UHHA 1B4CA 3PALA 3C1VA 4YRUA 1IWQA 3TS5B 1CFPA 5I2QA 1J1DA 1N65A 1CDMA 2JNFA 1S5GZ 3TZ1A 1A75A 3CGAA 4N1FA 2YGUA 2F3ZA 3SG3A 2KYCA 1CFFA 1B9AA 2L2CA 1OOHA 2VRGA 1OW4A 4MN0A 1DGUA 1PSRA 3O2PA 3JTDC 4PHKA 1H8BA 3BXKA 4A4CA 2SASA 1EG4A 1LVCD 1NIWA 1LINA 1TUJA 4YGCB 4QJ4B 1G4YR 1XA5A 5FI7A 1MXEA 1DTLA 4PHNA 1DT7B 3D0YB 2LLUA 4GAOA 2FCEA 1XFYO 3I5IB 1CDNA 5AXIA 4PE4A 2KPHA 1SL8A 1IH0A 1KK7Z 1KWOC 1OE9B 1CLLA 1J55A 2AUCA 2O60A 1XK4A 1NX2A 2H8VA 3NHIA 1SCVA 1SY9A 4MRXA 2BBNA 1QTXA 3DF0B 4OVNF 3BQ3A 2F2PA 3SS3A 2I7AA 3SS4A 3OX5A 2JT0A 3EG5B 1K90D 4XJKB 1TNWA 2OTGB 1CMFA 1PK0D 2M0RA 1S6IA 3LCPC 1JWDA 1UHNA 4MZKA 1K96A 2M9GA 3I5FC 1JUOA 2JXCA 2KAVA 1T14A 1TWOA 1DGVA 1ZOTB 5CSIA 1DQEA 2BKIB 4USLA 3K21A 4WQ2A 1IRJA 1L2OC 2HQ8A 2CCMA 3WXAA 5I2LA 1QS7A 3BUOB 3GK1A 3NHTA 2H61A 3L4LA 3PLFB 1LA0A 2L50A 2M8UA 2PALA 2KI4B 1TOPA 2PASA 4YGDB 3B6XA 5ER5A 2GTEA 3TS5C 2PMYA 4GGFA 1K2HA 4OKHA 3O6BA 2BL0B 3SG4A 2QPTA 1JSAA 1AUIB 1CM4A 2P6BB 1ZMZA 2K7DA 3LLEA 2G9BA 3N7HA 3AAJA 3PM2A 2K2AA 1PULA 2M29A 2LAPA 1CB1A 1KQMB 2JTZA 1KFUS 3LK1A 4HREE 1DJHA 2AAOA 2M7NA 1J7QA 1Z4HA 1H4BA 3DVMA 2I18A 1MF8B 4PALA 1WY9A 2Y4QA 2CT9A 3AAKA 4GGNA 2JXLA 3K1EA 1GQMA 3SG2A 1SCMB 1W7JB 1AK8A 2HQWA 1V1GA 2KSPA 3DVKA 1VRKA 3PJIA 2ZNEA 1WLMA 5HYDA 1K95A 1HQVA 4YI8A 3ZNIA 1OOFA 4INXA 1Y1AA 2OS8B 5HLVA 2MJWB 1KWOB 3IQQA 3B87A 1SSEB 1AHRA 1OMDA 1QASA 2WNDA 3BFBA 1LA3A 1XVJA 1ALWA 1WRKA 2CTNA 3B86A 1M31A 2QEVA 1B8CA 1B7TY 1BODA 4P2YB 2QEOA 1IIOA 1BR1B 1OOIX 3CWGA 1XFZO 3DYEA 3NXAA 3A4UB 1TNQA 3IVTA 1SRAA 3WNXB 4C0JA 2PQLA 1JC2A 1MR8A 1NX3A 1QWVA 1PVAA 1SPYA 2K60A 2R2IA 3D74A 1NCYA 4ETOA 1UUSA 1D1OA 1BJFA 5KU1A 4CLNA 3SG7A 3HX4A 3R1PA 2K0JA 1YRTB 2MLFC 2NXQA 2EGDA 1BF5A 5FI2A 2LMVA 2LVJA 2M1UA 2KI4C 4MSPA 3KEVA 1F71A 1QX5B 3SS5A 1DJXA 1DF0A 2WC8A 4KYNA 1WLZA 4BY5A 4GUKA 4OCIA 1Y1XA 2GV5A 3EK7A 1SR6B 2KAXA 5KSZA 1DJYA 2GGZA 5D7FA 2LM5A 2V53A 3OP0A 1K8UA 1AP4A 1Z2CB 2K7BA 3R1VA 3OB2B 2L0PA 2K61A 3OGNA 4PE0A 1DEKA 1KQMC 1DJWA 1QVIZ 3PN7B 3CZTX 5HLOA 1FI5A 4C0LA 1UURA 1WDCC 2BBMA 2JNXA 4BY4A 1KQVA 1JFKA 3FE9A 4MRYA 3S0DA 5F6TA 1K9KA 2MAZA 1TTXA 2TN4A 4XYNA 4YGAA 3FWCA 1UHIA 1SL9A 3TDZA 1EH2A 2F2OA 1SCMC 4ORBB 2K8MB 2LLSA 1Q80A 4GBAA 2LMTA 1J7PA 3BOWB 3E3RA 3S0AA 2NZ0A 1FI6A 3BOWA 4JQ0D 3D0YA 3R1OA 4HRGA 3FWBA 2HF5A 2OS8C 1ALVA 4AQJA 1RROA 2LVVA 2LE9B 2EC6B 1QJTA 1QIVA 4CFRA 4CPVA 3DVEA 2ISDA 4PE7A 5BPJA 3SIBA 2M49B 5D69A 1YRUB 1SW8A 1C7VA 4I5KA 5K89A 1CLMA 1JBAA 5DKQA 1DJZA 3DF0A 4D1EA 1M46A 2ERBA 1IQ3A 2KLDA 3CR2A 4XJKA 4P5OE 2KNEA 1MHOA 1S36A 3TDUA 1UHJA 3DXLA 1TUZA 1CNPA 3A8RA 3NSOA 1F54A 1S5GY 2E30A 5I2OA 1XFRA 3B88A 3DVJA 1DELA 3IF7A 5D3OA 3O4XA 3S0EA 4MEWA 1QLSA 5I8NA 2KOTA 1KK8B 4IL1A 1F4OA 4NDBA 1PSBA 1TCFA 1UP5A 2G2BA 2L5XB 3BUNB 4M2PA 3SJSA 4JKTA 3RZSA 2L4HA 1F55A 2GGMA 2JT8A 2KHNA 1MQ1A 2M3WA 2CXJA 3BUWB 1OMRA 1AJ5A 4A4BA 2QACA 1IG5A 4ZCUA 4N1GA 2B1UA 1SR6C 1NP8A 1QIWA 2SCPA 1B8LA 2KGRA 3QMEA 2LANA 1KK7Y 1N0YA 2F3YA 3GK2A 5GQQC 1A2XA 1F70A 1SMGA 1SKTA 3DD4A 3PN7C 3WHTB 3FS7A 1CM1A 5AERA 3I5HB 4PE1A 3KO0A 4N5XA 5CSNA 2K7CA 4MVFA 2L2EA 1DMOA 1E8AA 2ZKMX 1PVBA 4JPZB 1WDCB 3VRNA 4AQIA 4IJ7A 5DKNA 1MXLC 1W9ZA 2F33A 1SNLA 2Y1MA 1JFJA 1B7TZ 4HSZA 4YBHB 2LNKA 2WC5A 1M45A 1CLBA 4OV2A 2LVIA 1KSOA 3B7AA 2LUXA 3LL8B 2LMUA 1PRWA 2MA2A 2WC6A 3BFHA 1WRLA 3R72A 4YGEB 3S0BA 3EVRA 2EC6C 4QJ5B 2JPTA 3RM1A 3BYAA 1K93D 1F4QA 2PRUA 1DJIA 4ZCVA 5PALA 3D77A 3ICBA 2E6WA 4FQOA 2Q4UA 4C0KA 1S1EA 2FCDA 1SBJA 3O78A 3VROA 3CZ2A 1UWOA 2L98A 2KYFA 1R6PA 2A4JA 2WCLA 1P28A 1OQPA 2WCHA 5CSFA 1YX7A 4PCWA 2COLB 1TN4A 2KFFA 1SL7A 1HT9A 1CKKA 2JOJA 1ZUZA 3L4AA 3I5GB 4INWA 1XO5A 4AOMA 2KQ6A 2LLTA 1XFXO 2LP2A 1K9UA 4GFTA 1ZACA 5KTYA 1R2UA 3SIAA 1KK8C 3OHMB 1C3YA 3MSEB 5B8IB 1YVHA 1JF2A 1YUUA 3BUXB 3D78A 1N2DA 2Y1NA 2CNPA 2P71A 3PFVA 2QEHA 1F8HA 2LCPA 2P70A 3VRPA 2JRFA 5AFPA 1BR4B 2FJYA 2KAYA 1SYMA 2KI6D 3TUYB 4GPLB 5JJGA 1NUBA 1KFXS 2NCPA 4CFQA 4PHMA 1TIZA 2KLEA 1NCXA 1AVSA 3V2LA 4L9MA 2KBMA 5HL1A 1CDPA 2WCKA 1B8RA 2KDHA 5CSJA 1XFVO 1IGVA 2OPOA 1Y1UA 1NX1A 4NQGA 3WHUB 3I5HC 3PATA 1OMVA 3SG5A 1CMGA 1V1FA 3CLNA 1BG1A 1QX7A 3BUMB 3EK8A 1CFDA 3OB1B 5ER4X 1K9PA 1S3PA 1TCOB 2WORA 3L47A 5CPVA 1DVIA 3EK4A 1J7RA 3NSKA 2I2RE 3OBVA 1RK9A 1RJVA 1YR5A 3IQOA 4QJ3B 1C07A 1BMOA 5G08A 1QV1A 1RFJA 4YGBB 1A29A 4ORCB 4F7FA 1FPWA 2JTTA 1FBVA 2O5GA 4PDZA 1RTP1 1K94A 4FTGA 3BJHA 1A75B 5I94A 2Y5IA 3HCMA 1XFWO 5HKYA 3CABA 1XYDA 1NYAA 1LXFC 1ODBA 3NSIA 2LHIA 2MBXA 1C3ZA 4MLWA 2QEBA 3H4SE 3QRXA 4I5LB 5EL2A 2BE6A 2LV7A 4FQTA 1BOCA 1NCZA 2ZRSA 1SK6D 1GGWA 2WCJA 1A4PA 1KCYA 2FOTA 3JVTC 1WRZA 5J3XA 2ZFDA 3I5GC 2DOQA 5IBWA 1GJYA 1S6CA 1NSHA 1FW4A 3CDNA 4PHJA 3EKJA 4DUQA 3D75A 2BCAA 1BU3A 2HETA 2L5YA 1IKUA 3OX6A 1MWNA 1QVIY 2WCMA 2BCXA 2K7OA 1C7WA 1LS8A 1S6JA 3VRQA 1OZSA 3LK0A 1YTZC 3SG6A 1OOJA 2ZN9A 4TNCA 3ZWHA 3TUYC 2BNXA 1S26D 1YUTA 1G33A 3NSLA 3BFAA 4F0ZB 2IS9A 4OZDA 2L4IA 3EVUA 2WOSA 1GM0A 1XFUO 2KFGA 3CZ1A 1DC1A 4OR9B 1EJ3A 4CIDA 1ORGA 1QATA 2JULA 1IQ5A 2LUCA 4DCKA 2KI6C 2KGBC 2BE4A 5FI6A 3Q8IA 3S0FA 1AJ4A 1EXRA 2BAPA 2F8PA 4ICBA 3UO9A 3DZTA 2JC2A 3AKAA 1EL4A 3FIAA 2D8NA 2M1KB 3CTNA 1Y0VH 5HKZA 1YX8A 2JQ6A 1GGZA 3EKHA 1B47A 3PSRA
chains in the Genus database with same CATH topology
2L51A 1IJ5A 1QXPA 4DIRA 1RWYA 2BCBA 1TNXA 1Y6WA 2HPSA 1IJ6A 2ZNDA 2NLNA 1W7IB 2PSRA 1QV0A 1LKJA 1QX2A 4YI9A 1B1GA 4MBEA 1A03A 5AEQA 1KFUL 2JZIA 2MHHA 2MLEC 2WCEA 3TDIA 1L7ZA 1DJGA 5FYXA 1CFCA 3F45A 1BLQA 3CR5X 1QLKA 2M97A 2M7LA 3VRRA 1JF0A 1M39A 1OSAA 1PALA 2ZN8A 4I5JA 5AANA 1NPQA 3JTDB 4I5NB 1U5IB 4DRWA 2KFHA 4DS7A 1KSMA 2BKHB 3JVTB 1G8IA 3I5IC 1U5IA 4ORAB 1TNPA 2H2KA 2LP3A 2I94A 1YURA 1OZOA 1CTRA 1XK4C 2LC5A 1FF1A 4E68A 1MUXA 2Q91A 1NX0A 5DKRA 2WCBA 5JOLA 1J7OA 4Q04A 3CR4X 4GNKB 3KHEA 2OTGC 1TRFA 3D10A 1X02A 4HRHA 1CDLA 3M0WA 2RGIA 4WRIA 3RLZA 4M2OA 4MZJA 4M2QA 3KPXA 1YVLA 2MRDA 3CS1A 2PVBA 1J1EA 3PM8A 4NDDA 2ZRTA 2JT3A 2JWWA 2KBIA 2KQYA 2CBLA 3I5FB 1NWDA 5TNCA 2H61C 2FJUB 2EHBA 3GK4X 1KFXL 4NDCA 2NCOA 3EVVA 1M63B 3KF9A 3O4YA 1L2OB 1ZFSA 1BT6A 5HKWA 4JWQA 2AMIA 1DF0B 4GGFC 4R1EA 3VGOA 2WCFA 2BECA 2JU0A 3AKBA 4U8DA 1EG3A 1UHKA 2K2FA 4WQ3A 3GOFA 2BL0C 1RECA 2LHLA 2LVKA 4MZLA 1YUSA 4UPGA 1UHHA 1B4CA 3PALA 3C1VA 4YRUA 1IWQA 3TS5B 1CFPA 5I2QA 1J1DA 1N65A 1CDMA 2JNFA 1S5GZ 3TZ1A 1A75A 3CGAA 4N1FA 2F3ZA 3SG3A 2KYCA 1CFFA 1B9AA 2VRGA 4MN0A 1DGUA 1PSRA 3O2PA 3JTDC 4PHKA 1H8BA 3BXKA 4A4CA 2SASA 1EG4A 1LVCD 1NIWA 1LINA 4YGCB 4QJ4B 1G4YR 1XA5A 1MXEA 1DTLA 4PHNA 1DT7B 3D0YB 2LLUA 4GAOA 2FCEA 1XFYO 3I5IB 1CDNA 5AXIA 4PE4A 1SL8A 1IH0A 1KK7Z 1KWOC 1OE9B 1CLLA 1J55A 2AUCA 2O60A 1XK4A 1NX2A 4MRXA 1SCVA 1SY9A 2BBNA 1QTXA 3DF0B 4OVNF 3BQ3A 2F2PA 2I7AA 3OX5A 2JT0A 1K90D 4XJKB 1TNWA 2OTGB 1CMFA 1PK0D 2M0RA 1S6IA 3LCPC 1JWDA 1UHNA 4MZKA 1K96A 2M9GA 3I5FC 1JUOA 2JXCA 2KAVA 1DGVA 1ZOTB 5CSIA 2BKIB 4USLA 3K21A 4WQ2A 1IRJA 1L2OC 2HQ8A 2CCMA 3WXAA 5I2LA 1QS7A 3BUOB 3GK1A 2H61A 3PLFB 1LA0A 2L50A 2M8UA 2PALA 2KI4B 1TOPA 2PASA 4YGDB 5ER5A 3TS5C 2PMYA 4GGFA 1K2HA 4OKHA 3O6BA 2BL0B 3SG4A 2QPTA 1JSAA 1AUIB 1CM4A 2P6BB 1ZMZA 2K7DA 3LLEA 2G9BA 3AAJA 2K2AA 1PULA 2M29A 2LAPA 1CB1A 1KQMB 2JTZA 1KFUS 3LK1A 4HREE 1DJHA 2AAOA 2M7NA 1J7QA 1H4BA 3DVMA 2I18A 1MF8B 4PALA 1WY9A 2Y4QA 2CT9A 3AAKA 4GGNA 2JXLA 1GQMA 3SG2A 1SCMB 1W7JB 1AK8A 2HQWA 1V1GA 2KSPA 3DVKA 1VRKA 2ZNEA 1WLMA 5HYDA 1K95A 1HQVA 4YI8A 3ZNIA 5HLVA 1Y1AA 2OS8B 2MJWB 1KWOB 3IQQA 1AHRA 1OMDA 1QASA 2WNDA 1LA3A 1XVJA 1ALWA 1WRKA 2CTNA 1M31A 1B8CA 1B7TY 1BODA 4P2YB 1BR1B 3CWGA 3NXAA 1XFZO 3A4UB 1TNQA 3WNXB 1SRAA 4C0JA 1JC2A 1MR8A 1NX3A 1SPYA 1PVAA 2R2IA 1NCYA 4ETOA 1UUSA 1D1OA 1BJFA 5KU1A 4CLNA 3SG7A 3HX4A 2K0JA 1YRTB 2MLFC 2NXQA 2EGDA 1BF5A 2LMVA 2LVJA 2M1UA 2KI4C 4MSPA 3KEVA 1F71A 1QX5B 1DJXA 1DF0A 2WC8A 1WLZA 4BY5A 4GUKA 4OCIA 1Y1XA 2GV5A 3EK7A 1SR6B 2KAXA 5KSZA 1DJYA 2GGZA 5D7FA 2LM5A 2V53A 3OP0A 1K8UA 1AP4A 2K7BA 3OB2B 2L0PA 2K61A 4PE0A 1KQMC 1FI5A 1DJWA 1QVIZ 3PN7B 3CZTX 5HLOA 4C0LA 1UURA 1WDCC 2BBMA 2JNXA 4BY4A 1KQVA 1JFKA 4MRYA 5F6TA 1K9KA 2MAZA 1TTXA 2TN4A 4XYNA 4YGAA 3FWCA 1UHIA 1SL9A 3TDZA 1EH2A 2F2OA 1SCMC 4ORBB 2K8MB 2LLSA 1Q80A 4GBAA 2LMTA 1J7PA 3BOWB 3E3RA 2NZ0A 1FI6A 3BOWA 4JQ0D 3D0YA 4HRGA 3FWBA 2HF5A 2OS8C 1ALVA 1RROA 2LVVA 2LE9B 2EC6B 1QJTA 1QIVA 4CFRA 4CPVA 3DVEA 2ISDA 4PE7A 5BPJA 3SIBA 2M49B 5D69A 1YRUB 1SW8A 1C7VA 4I5KA 5K89A 1CLMA 1JBAA 5DKQA 1DJZA 3DF0A 4D1EA 1M46A 1IQ3A 3CR2A 4XJKA 4P5OE 2KNEA 1MHOA 1S36A 3TDUA 1UHJA 1CNPA 3A8RA 3NSOA 1F54A 1S5GY 2E30A 5I2OA 3DVJA 3IF7A 4MEWA 1QLSA 5I8NA 2KOTA 1KK8B 4IL1A 1F4OA 4NDBA 1PSBA 1TCFA 1UP5A 2G2BA 2L5XB 3BUNB 4M2PA 3SJSA 1F55A 2L4HA 2GGMA 2JT8A 2KHNA 1MQ1A 2M3WA 2CXJA 3BUWB 1OMRA 1AJ5A 4A4BA 2QACA 1IG5A 4ZCUA 4N1GA 2B1UA 1SR6C 1NP8A 1QIWA 2SCPA 1B8LA 2KGRA 2LANA 1KK7Y 1N0YA 2F3YA 3GK2A 5GQQC 1A2XA 1F70A 1SMGA 1SKTA 3DD4A 3PN7C 3WHTB 3FS7A 1CM1A 5AERA 3I5HB 4PE1A 3KO0A 4N5XA 5CSNA 2K7CA 4MVFA 2L2EA 1DMOA 1E8AA 2ZKMX 1PVBA 4JPZB 1WDCB 3VRNA 4AQIA 5DKNA 1MXLC 2F33A 1SNLA 2Y1MA 1JFJA 1B7TZ 4HSZA 4YBHB 2LNKA 1M45A 1CLBA 4OV2A 2LVIA 1KSOA 2LUXA 3LL8B 2LMUA 1PRWA 2MA2A 4AQJA 1WRLA 4YGEB 4QJ5B 3EVRA 2EC6C 2JPTA 3RM1A 3BYAA 1K93D 1F4QA 2PRUA 1DJIA 4ZCVA 5PALA 3ICBA 4FQOA 2E6WA 2Q4UA 4C0KA 1S1EA 2FCDA 1SBJA 3O78A 3VROA 1UWOA 2L98A 2KYFA 1R6PA 2A4JA 1OQPA 5CSFA 1YX7A 4PCWA 2COLB 1TN4A 2KFFA 1SL7A 1HT9A 1CKKA 2JOJA 1ZUZA 3I5GB 1XO5A 4AOMA 2KQ6A 2LLTA 1XFXO 2LP2A 1K9UA 4GFTA 1ZACA 5KTYA 1R2UA 3SIAA 1KK8C 3OHMB 3MSEB 5B8IB 1YVHA 1JF2A 1YUUA 3BUXB 1N2DA 2Y1NA 2CNPA 3PFVA 1F8HA 2LCPA 3VRPA 2JRFA 5AFPA 1BR4B 2KAYA 1SYMA 2KI6D 3TUYB 4GPLB 5JJGA 1NUBA 1KFXS 2NCPA 4CFQA 4PHMA 1TIZA 1NCXA 1AVSA 4L9MA 2KBMA 1CDPA 1B8RA 2KDHA 5CSJA 1XFVO 1IGVA 2OPOA 1Y1UA 1NX1A 4NQGA 3WHUB 3I5HC 3PATA 1OMVA 3SG5A 1CMGA 1V1FA 3CLNA 1BG1A 1QX7A 3BUMB 3EK8A 1CFDA 3OB1B 5ER4X 1K9PA 1S3PA 1TCOB 2WORA 5CPVA 1DVIA 3EK4A 1J7RA 3NSKA 2I2RE 1RK9A 1RJVA 1YR5A 3IQOA 4QJ3B 1C07A 1BMOA 5G08A 1QV1A 1RFJA 4YGBB 1A29A 4ORCB 1FPWA 2JTTA 1FBVA 2O5GA 4PDZA 1RTP1 1K94A 4FTGA 1A75B 2Y5IA 3HCMA 1XFWO 5HKYA 1XYDA 1NYAA 1LXFC 1ODBA 3NSIA 2LHIA 2MBXA 4MLWA 3QRXA 3H4SE 4I5LB 2BE6A 2LV7A 1BOCA 1NCZA 2ZRSA 1SK6D 1GGWA 1A4PA 1KCYA 2FOTA 3JVTC 1WRZA 5J3XA 2ZFDA 3I5GC 2DOQA 5IBWA 1GJYA 1S6CA 1NSHA 1FW4A 4PHJA 3EKJA 4DUQA 2BCAA 1BU3A 2HETA 1IKUA 3OX6A 1MWNA 1QVIY 2BCXA 2K7OA 1C7WA 1S6JA 3VRQA 1OZSA 3LK0A 1YTZC 3SG6A 1OOJA 2ZN9A 4TNCA 3ZWHA 3TUYC 1S26D 1YUTA 1G33A 3NSLA 4F0ZB 2IS9A 2L4IA 3EVUA 2WOSA 1XFUO 2KFGA 4OR9B 1EJ3A 4CIDA 1QATA 2JULA 1IQ5A 2LUCA 4DCKA 2KI6C 2KGBC 2BE4A 1AJ4A 1EXRA 2F8PA 4ICBA 2JC2A 3AKAA 1EL4A 3FIAA 2D8NA 2M1KB 3CTNA 1Y0VH 5HKZA 1YX8A 2JQ6A 1GGZA 3EKHA 1B47A 3PSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L51 A;  1IJ5 A;  1QXP A;  4DIR A;  1RWY A;  2BCB A;  1TNX A;  1Y6W A;  2HPS A;  1IJ6 A;  2ZND A;  2NLN A;  1W7I B;  2PSR A;  1QV0 A;  1LKJ A;  1QX2 A;  4YI9 A;  1B1G A;  4MBE A;  1A03 A;  5AEQ A;  1KFU L;  2JZI A;  2MHH A;  2MLE C;  2WCE A;  3TDI A;  1L7Z A;  1DJG A;  5FYX A;  1CFC A;  3F45 A;  1BLQ A;  3CR5 X;  1QLK A;  2M97 A;  2M7L A;  3VRR A;  1JF0 A;  1M39 A;  1OSA A;  1PAL A;  2ZN8 A;  4I5J A;  5AAN A;  1NPQ A;  3JTD B;  4I5N B;  1U5I B;  4DRW A;  2KFH A;  4DS7 A;  1KSM A;  2BKH B;  3JVT B;  1G8I A;  3I5I C;  1U5I A;  4ORA B;  1TNP A;  2H2K A;  2LP3 A;  2I94 A;  1YUR A;  1OZO A;  1CTR A;  1XK4 C;  2LC5 A;  1FF1 A;  4E68 A;  1MUX A;  2Q91 A;  1NX0 A;  5DKR A;  2WCB A;  5JOL A;  1J7O A;  4Q04 A;  3CR4 X;  4GNK B;  3KHE A;  2OTG C;  1TRF A;  3D10 A;  1X02 A;  4HRH A;  1CDL A;  3M0W A;  2RGI A;  4WRI A;  3RLZ A;  4M2O A;  4MZJ A;  4M2Q A;  3KPX A;  1YVL A;  2MRD A;  3CS1 A;  2PVB A;  1J1E A;  3PM8 A;  4NDD A;  2ZRT A;  2JT3 A;  2JWW A;  2KBI A;  2KQY A;  2CBL A;  3I5F B;  1NWD A;  5TNC A;  2H61 C;  2FJU B;  2EHB A;  3GK4 X;  1KFX L;  4NDC A;  2NCO A;  3EVV A;  1M63 B;  3KF9 A;  3O4Y A;  1L2O B;  1ZFS A;  1BT6 A;  5HKW A;  4JWQ A;  2AMI A;  1DF0 B;  4GGF C;  4R1E A;  3VGO A;  2WCF A;  2BEC A;  2JU0 A;  3AKB A;  4U8D A;  1EG3 A;  1UHK A;  2K2F A;  4WQ3 A;  3GOF A;  2BL0 C;  1REC A;  2LHL A;  2LVK A;  4MZL A;  1YUS A;  4UPG A;  1UHH A;  1B4C A;  3PAL A;  3C1V A;  4YRU A;  1IWQ A;  3TS5 B;  1CFP A;  5I2Q A;  1J1D A;  1N65 A;  1CDM A;  2JNF A;  1S5G Z;  3TZ1 A;  1A75 A;  3CGA A;  4N1F A;  2F3Z A;  3SG3 A;  2KYC A;  1CFF A;  1B9A A;  2VRG A;  4MN0 A;  1DGU A;  1PSR A;  3O2P A;  3JTD C;  4PHK A;  1H8B A;  3BXK A;  4A4C A;  2SAS A;  1EG4 A;  1LVC D;  1NIW A;  1LIN A;  4YGC B;  4QJ4 B;  1G4Y R;  1XA5 A;  1MXE A;  1DTL A;  4PHN A;  1DT7 B;  3D0Y B;  2LLU A;  4GAO A;  2FCE A;  1XFY O;  3I5I B;  1CDN A;  5AXI A;  4PE4 A;  1SL8 A;  1IH0 A;  1KK7 Z;  1KWO C;  1OE9 B;  1CLL A;  1J55 A;  2AUC A;  2O60 A;  1XK4 A;  1NX2 A;  4MRX A;  1SCV A;  1SY9 A;  2BBN A;  1QTX A;  3DF0 B;  4OVN F;  3BQ3 A;  2F2P A;  2I7A A;  3OX5 A;  2JT0 A;  1K90 D;  4XJK B;  1TNW A;  2OTG B;  1CMF A;  1PK0 D;  2M0R A;  1S6I A;  3LCP C;  1JWD A;  1UHN A;  4MZK A;  1K96 A;  2M9G A;  3I5F C;  1JUO A;  2JXC A;  2KAV A;  1DGV A;  1ZOT B;  5CSI A;  2BKI B;  4USL A;  3K21 A;  4WQ2 A;  1IRJ A;  1L2O C;  2HQ8 A;  2CCM A;  3WXA A;  5I2L A;  1QS7 A;  3BUO B;  3GK1 A;  2H61 A;  3PLF B;  1LA0 A;  2L50 A;  2M8U A;  2PAL A;  2KI4 B;  1TOP A;  2PAS A;  4YGD B;  5ER5 A;  3TS5 C;  2PMY A;  4GGF A;  1K2H A;  4OKH A;  3O6B A;  2BL0 B;  3SG4 A;  2QPT A;  1JSA A;  1AUI B;  1CM4 A;  2P6B B;  1ZMZ A;  2K7D A;  3LLE A;  2G9B A;  3AAJ A;  2K2A A;  1PUL A;  2M29 A;  2LAP A;  1CB1 A;  1KQM B;  2JTZ A;  1KFU S;  3LK1 A;  4HRE E;  1DJH A;  2AAO A;  2M7N A;  1J7Q A;  1H4B A;  3DVM A;  2I18 A;  1MF8 B;  4PAL A;  1WY9 A;  2Y4Q A;  2CT9 A;  3AAK A;  4GGN A;  2JXL A;  1GQM A;  3SG2 A;  1SCM B;  1W7J B;  1AK8 A;  2HQW A;  1V1G A;  2KSP A;  3DVK A;  1VRK A;  2ZNE A;  1WLM A;  5HYD A;  1K95 A;  1HQV A;  4YI8 A;  3ZNI A;  5HLV A;  1Y1A A;  2OS8 B;  2MJW B;  1KWO B;  3IQQ A;  1AHR A;  1OMD A;  1QAS A;  2WND A;  1LA3 A;  1XVJ A;  1ALW A;  1WRK A;  2CTN A;  1M31 A;  1B8C A;  1B7T Y;  1BOD A;  4P2Y B;  1BR1 B;  3CWG A;  3NXA A;  1XFZ O;  3A4U B;  1TNQ A;  3WNX B;  1SRA A;  4C0J A;  1JC2 A;  1MR8 A;  1NX3 A;  1SPY A;  1PVA A;  2R2I A;  1NCY A;  4ETO A;  1UUS A;  1D1O A;  1BJF A;  5KU1 A;  4CLN A;  3SG7 A;  3HX4 A;  2K0J A;  1YRT B;  2MLF C;  2NXQ A;  2EGD A;  1BF5 A;  2LMV A;  2LVJ A;  2M1U A;  2KI4 C;  4MSP A;  3KEV A;  1F71 A;  1QX5 B;  1DJX A;  1DF0 A;  2WC8 A;  1WLZ A;  4BY5 A;  4GUK A;  4OCI A;  1Y1X A;  2GV5 A;  3EK7 A;  1SR6 B;  2KAX A;  5KSZ A;  1DJY A;  2GGZ A;  5D7F A;  2LM5 A;  2V53 A;  3OP0 A;  1K8U A;  1AP4 A;  2K7B A;  3OB2 B;  2L0P A;  2K61 A;  4PE0 A;  1KQM C;  1FI5 A;  1DJW A;  1QVI Z;  3PN7 B;  3CZT X;  5HLO A;  4C0L A;  1UUR A;  1WDC C;  2BBM A;  2JNX A;  4BY4 A;  1KQV A;  1JFK A;  4MRY A;  5F6T A;  1K9K A;  2MAZ A;  1TTX A;  2TN4 A;  4XYN A;  4YGA A;  3FWC A;  1UHI A;  1SL9 A;  3TDZ A;  1EH2 A;  2F2O A;  1SCM C;  4ORB B;  2K8M B;  2LLS A;  1Q80 A;  4GBA A;  2LMT A;  1J7P A;  3BOW B;  3E3R A;  2NZ0 A;  1FI6 A;  3BOW A;  4JQ0 D;  3D0Y A;  4HRG A;  3FWB A;  2HF5 A;  2OS8 C;  1ALV A;  1RRO A;  2LVV A;  2LE9 B;  2EC6 B;  1QJT A;  1QIV A;  4CFR A;  4CPV A;  3DVE A;  2ISD A;  4PE7 A;  5BPJ A;  3SIB A;  2M49 B;  5D69 A;  1YRU B;  1SW8 A;  1C7V A;  4I5K A;  5K89 A;  1CLM A;  1JBA A;  5DKQ A;  1DJZ A;  3DF0 A;  4D1E A;  1M46 A;  1IQ3 A;  3CR2 A;  4XJK A;  4P5O E;  2KNE A;  1MHO A;  1S36 A;  3TDU A;  1UHJ A;  1CNP A;  3A8R A;  3NSO A;  1F54 A;  1S5G Y;  2E30 A;  5I2O A;  3DVJ A;  3IF7 A;  4MEW A;  1QLS A;  5I8N A;  2KOT A;  1KK8 B;  4IL1 A;  1F4O A;  4NDB A;  1PSB A;  1TCF A;  1UP5 A;  2G2B A;  2L5X B;  3BUN B;  4M2P A;  3SJS A;  1F55 A;  2L4H A;  2GGM A;  2JT8 A;  2KHN A;  1MQ1 A;  2M3W A;  2CXJ A;  3BUW B;  1OMR A;  1AJ5 A;  4A4B A;  2QAC A;  1IG5 A;  4ZCU A;  4N1G A;  2B1U A;  1SR6 C;  1NP8 A;  1QIW A;  2SCP A;  1B8L A;  2KGR A;  2LAN A;  1KK7 Y;  1N0Y A;  2F3Y A;  3GK2 A;  5GQQ C;  1A2X A;  1F70 A;  1SMG A;  1SKT A;  3DD4 A;  3PN7 C;  3WHT B;  3FS7 A;  1CM1 A;  5AER A;  3I5H B;  4PE1 A;  3KO0 A;  4N5X A;  5CSN A;  2K7C A;  4MVF A;  2L2E A;  1DMO A;  1E8A A;  2ZKM X;  1PVB A;  4JPZ B;  1WDC B;  3VRN A;  4AQI A;  5DKN A;  1MXL C;  2F33 A;  1SNL A;  2Y1M A;  1JFJ A;  1B7T Z;  4HSZ A;  4YBH B;  2LNK A;  1M45 A;  1CLB A;  4OV2 A;  2LVI A;  1KSO A;  2LUX A;  3LL8 B;  2LMU A;  1PRW A;  2MA2 A;  4AQJ A;  1WRL A;  4YGE B;  4QJ5 B;  3EVR A;  2EC6 C;  2JPT A;  3RM1 A;  3BYA A;  1K93 D;  1F4Q A;  2PRU A;  1DJI A;  4ZCV A;  5PAL A;  3ICB A;  4FQO A;  2E6W A;  2Q4U A;  4C0K A;  1S1E A;  2FCD A;  1SBJ A;  3O78 A;  3VRO A;  1UWO A;  2L98 A;  2KYF A;  1R6P A;  2A4J A;  1OQP A;  5CSF A;  1YX7 A;  4PCW A;  2COL B;  1TN4 A;  2KFF A;  1SL7 A;  1HT9 A;  1CKK A;  2JOJ A;  1ZUZ A;  3I5G B;  1XO5 A;  4AOM A;  2KQ6 A;  2LLT A;  1XFX O;  2LP2 A;  1K9U A;  4GFT A;  1ZAC A;  5KTY A;  1R2U A;  3SIA A;  1KK8 C;  3OHM B;  3MSE B;  5B8I B;  1YVH A;  1JF2 A;  1YUU A;  3BUX B;  1N2D A;  2Y1N A;  2CNP A;  3PFV A;  1F8H A;  2LCP A;  3VRP A;  2JRF A;  5AFP A;  1BR4 B;  2KAY A;  1SYM A;  2KI6 D;  3TUY B;  4GPL B;  5JJG A;  1NUB A;  1KFX S;  2NCP A;  4CFQ A;  4PHM A;  1TIZ A;  1NCX A;  1AVS A;  4L9M A;  2KBM A;  1CDP A;  1B8R A;  2KDH A;  5CSJ A;  1XFV O;  1IGV A;  2OPO A;  1Y1U A;  1NX1 A;  4NQG A;  3WHU B;  3I5H C;  3PAT A;  1OMV A;  3SG5 A;  1CMG A;  1V1F A;  3CLN A;  1BG1 A;  1QX7 A;  3BUM B;  3EK8 A;  1CFD A;  3OB1 B;  5ER4 X;  1K9P A;  1S3P A;  1TCO B;  2WOR A;  5CPV A;  1DVI A;  3EK4 A;  1J7R A;  3NSK A;  2I2R E;  1RK9 A;  1RJV A;  1YR5 A;  3IQO A;  4QJ3 B;  1C07 A;  1BMO A;  5G08 A;  1QV1 A;  1RFJ A;  4YGB B;  1A29 A;  4ORC B;  1FPW A;  2JTT A;  1FBV A;  2O5G A;  4PDZ A;  1RTP 1;  1K94 A;  4FTG A;  1A75 B;  2Y5I A;  3HCM A;  1XFW O;  5HKY A;  1XYD A;  1NYA A;  1LXF C;  1ODB A;  3NSI A;  2LHI A;  2MBX A;  4MLW A;  3QRX A;  3H4S E;  4I5L B;  2BE6 A;  2LV7 A;  1BOC A;  1NCZ A;  2ZRS A;  1SK6 D;  1GGW A;  1A4P A;  1KCY A;  2FOT A;  3JVT C;  1WRZ A;  5J3X A;  2ZFD A;  3I5G C;  2DOQ A;  5IBW A;  1GJY A;  1S6C A;  1NSH A;  1FW4 A;  4PHJ A;  3EKJ A;  4DUQ A;  2BCA A;  1BU3 A;  2HET A;  1IKU A;  3OX6 A;  1MWN A;  1QVI Y;  2BCX A;  2K7O A;  1C7W A;  1S6J A;  3VRQ A;  1OZS A;  3LK0 A;  1YTZ C;  3SG6 A;  1OOJ A;  2ZN9 A;  4TNC A;  3ZWH A;  3TUY C;  1S26 D;  1YUT A;  1G33 A;  3NSL A;  4F0Z B;  2IS9 A;  2L4I A;  3EVU A;  2WOS A;  1XFU O;  2KFG A;  4OR9 B;  1EJ3 A;  4CID A;  1QAT A;  2JUL A;  1IQ5 A;  2LUC A;  4DCK A;  2KI6 C;  2KGB C;  2BE4 A;  1AJ4 A;  1EXR A;  2F8P A;  4ICB A;  2JC2 A;  3AKA A;  1EL4 A;  3FIA A;  2D8N A;  2M1K B;  3CTN A;  1Y0V H;  5HKZ A;  1YX8 A;  2JQ6 A;  1GGZ A;  3EKH A;  1B47 A;  3PSR A; 
#chains in the Genus database with same CATH topology
 2L51 A;  1IJ5 A;  1QXP A;  3D76 A;  4DIR A;  1RWY A;  2BCB A;  1TNX A;  1Y6W A;  2HPS A;  1IJ6 A;  2ZND A;  2NLN A;  1W7I B;  2PSR A;  1QV0 A;  1LKJ A;  1QX2 A;  4YI9 A;  1B1G A;  4MBE A;  1A03 A;  2PYQ A;  5AEQ A;  1KFU L;  2JZI A;  2MHH A;  2MLE C;  2WCE A;  3TDI A;  1L7Z A;  1DJG A;  3NGV A;  5FYX A;  1CFC A;  3F45 A;  1BLQ A;  3CR5 X;  1QLK A;  2M97 A;  3S0G A;  2M7L A;  3VRR A;  1JF0 A;  1M39 A;  1OSA A;  1PAL A;  2ZN8 A;  4I5J A;  5AAN A;  1NPQ A;  3DY9 A;  3JTD B;  4I5N B;  1U5I B;  4DRW A;  2KFH A;  4DS7 A;  1KSM A;  2BKH B;  3JVT B;  1G8I A;  3I5I C;  1U5I A;  4ORA B;  1TNP A;  3FE8 A;  2H2K A;  3D73 A;  2LP3 A;  2I94 A;  1YUR A;  1OZO A;  1CTR A;  1XK4 C;  2LC5 A;  1FF1 A;  4E68 A;  1MUX A;  2Q91 A;  1NX0 A;  5DKR A;  3CYZ A;  2WCB A;  5JOL A;  1J7O A;  4Q04 A;  3CR4 X;  4GNK B;  2JPO A;  3KHE A;  2OTG C;  1TRF A;  3D10 A;  1X02 A;  4HRH A;  1CDL A;  3M0W A;  2RGI A;  4WRI A;  3RLZ A;  4M2O A;  4MZJ A;  4M2Q A;  3KPX A;  1YVL A;  2MRD A;  3CS1 A;  2PVB A;  1J1E A;  3PM8 A;  4NDD A;  2ZRT A;  2JT3 A;  2JWW A;  4PT1 A;  2KBI A;  2KQY A;  2CBL A;  3I5F B;  3FE6 A;  1NWD A;  5TNC A;  3VB1 A;  2H61 C;  2FJU B;  3CZ0 A;  4JD9 A;  2EHB A;  3GK4 X;  1OOG A;  5DIC A;  1KFX L;  4NDC A;  2NCO A;  3EVV A;  1M63 B;  3KF9 A;  3O4Y A;  1L2O B;  1ZFS A;  1BT6 A;  5HKW A;  4JWQ A;  2AMI A;  1DF0 B;  4GGF C;  4R1E A;  3VGO A;  2WCF A;  2BEC A;  2JU0 A;  3AKB A;  4U8D A;  1EG3 A;  1UHK A;  2K2F A;  2QDI A;  3GOF A;  4WQ3 A;  3UNW A;  2BL0 C;  1REC A;  2LHL A;  2LVK A;  4MZL A;  1YUS A;  4UPG A;  1UHH A;  1B4C A;  3PAL A;  3C1V A;  4YRU A;  1IWQ A;  3TS5 B;  1CFP A;  5I2Q A;  1J1D A;  1N65 A;  1CDM A;  2JNF A;  1S5G Z;  3TZ1 A;  1A75 A;  3CGA A;  4N1F A;  2YGU A;  2F3Z A;  3SG3 A;  2KYC A;  1CFF A;  1B9A A;  2L2C A;  1OOH A;  2VRG A;  1OW4 A;  4MN0 A;  1DGU A;  1PSR A;  3O2P A;  3JTD C;  4PHK A;  1H8B A;  3BXK A;  4A4C A;  2SAS A;  1EG4 A;  1LVC D;  1NIW A;  1LIN A;  1TUJ A;  4YGC B;  4QJ4 B;  1G4Y R;  1XA5 A;  5FI7 A;  1MXE A;  1DTL A;  4PHN A;  1DT7 B;  3D0Y B;  2LLU A;  4GAO A;  2FCE A;  1XFY O;  3I5I B;  1CDN A;  5AXI A;  4PE4 A;  2KPH A;  1SL8 A;  1IH0 A;  1KK7 Z;  1KWO C;  1OE9 B;  1CLL A;  1J55 A;  2AUC A;  2O60 A;  1XK4 A;  1NX2 A;  2H8V A;  3NHI A;  1SCV A;  1SY9 A;  4MRX A;  2BBN A;  1QTX A;  3DF0 B;  4OVN F;  3BQ3 A;  2F2P A;  3SS3 A;  2I7A A;  3SS4 A;  3OX5 A;  2JT0 A;  3EG5 B;  1K90 D;  4XJK B;  1TNW A;  2OTG B;  1CMF A;  1PK0 D;  2M0R A;  1S6I A;  3LCP C;  1JWD A;  1UHN A;  4MZK A;  1K96 A;  2M9G A;  3I5F C;  1JUO A;  2JXC A;  2KAV A;  1T14 A;  1TWO A;  1DGV A;  1ZOT B;  5CSI A;  1DQE A;  2BKI B;  4USL A;  3K21 A;  4WQ2 A;  1IRJ A;  1L2O C;  2HQ8 A;  2CCM A;  3WXA A;  5I2L A;  1QS7 A;  3BUO B;  3GK1 A;  3NHT A;  2H61 A;  3L4L A;  3PLF B;  1LA0 A;  2L50 A;  2M8U A;  2PAL A;  2KI4 B;  1TOP A;  2PAS A;  4YGD B;  3B6X A;  5ER5 A;  2GTE A;  3TS5 C;  2PMY A;  4GGF A;  1K2H A;  4OKH A;  3O6B A;  2BL0 B;  3SG4 A;  2QPT A;  1JSA A;  1AUI B;  1CM4 A;  2P6B B;  1ZMZ A;  2K7D A;  3LLE A;  2G9B A;  3N7H A;  3AAJ A;  3PM2 A;  2K2A A;  1PUL A;  2M29 A;  2LAP A;  1CB1 A;  1KQM B;  2JTZ A;  1KFU S;  3LK1 A;  4HRE E;  1DJH A;  2AAO A;  2M7N A;  1J7Q A;  1Z4H A;  1H4B A;  3DVM A;  2I18 A;  1MF8 B;  4PAL A;  1WY9 A;  2Y4Q A;  2CT9 A;  3AAK A;  4GGN A;  2JXL A;  3K1E A;  1GQM A;  3SG2 A;  1SCM B;  1W7J B;  1AK8 A;  2HQW A;  1V1G A;  2KSP A;  3DVK A;  1VRK A;  3PJI A;  2ZNE A;  1WLM A;  5HYD A;  1K95 A;  1HQV A;  4YI8 A;  3ZNI A;  1OOF A;  4INX A;  1Y1A A;  2OS8 B;  5HLV A;  2MJW B;  1KWO B;  3IQQ A;  3B87 A;  1SSE B;  1AHR A;  1OMD A;  1QAS A;  2WND A;  3BFB A;  1LA3 A;  1XVJ A;  1ALW A;  1WRK A;  2CTN A;  3B86 A;  1M31 A;  2QEV A;  1B8C A;  1B7T Y;  1BOD A;  4P2Y B;  2QEO A;  1IIO A;  1BR1 B;  1OOI X;  3CWG A;  1XFZ O;  3DYE A;  3NXA A;  3A4U B;  1TNQ A;  3IVT A;  1SRA A;  3WNX B;  4C0J A;  2PQL A;  1JC2 A;  1MR8 A;  1NX3 A;  1QWV A;  1PVA A;  1SPY A;  2K60 A;  2R2I A;  3D74 A;  1NCY A;  4ETO A;  1UUS A;  1D1O A;  1BJF A;  5KU1 A;  4CLN A;  3SG7 A;  3HX4 A;  3R1P A;  2K0J A;  1YRT B;  2MLF C;  2NXQ A;  2EGD A;  1BF5 A;  5FI2 A;  2LMV A;  2LVJ A;  2M1U A;  2KI4 C;  4MSP A;  3KEV A;  1F71 A;  1QX5 B;  3SS5 A;  1DJX A;  1DF0 A;  2WC8 A;  4KYN A;  1WLZ A;  4BY5 A;  4GUK A;  4OCI A;  1Y1X A;  2GV5 A;  3EK7 A;  1SR6 B;  2KAX A;  5KSZ A;  1DJY A;  2GGZ A;  5D7F A;  2LM5 A;  2V53 A;  3OP0 A;  1K8U A;  1AP4 A;  1Z2C B;  2K7B A;  3R1V A;  3OB2 B;  2L0P A;  2K61 A;  3OGN A;  4PE0 A;  1DEK A;  1KQM C;  1DJW A;  1QVI Z;  3PN7 B;  3CZT X;  5HLO A;  1FI5 A;  4C0L A;  1UUR A;  1WDC C;  2BBM A;  2JNX A;  4BY4 A;  1KQV A;  1JFK A;  3FE9 A;  4MRY A;  3S0D A;  5F6T A;  1K9K A;  2MAZ A;  1TTX A;  2TN4 A;  4XYN A;  4YGA A;  3FWC A;  1UHI A;  1SL9 A;  3TDZ A;  1EH2 A;  2F2O A;  1SCM C;  4ORB B;  2K8M B;  2LLS A;  1Q80 A;  4GBA A;  2LMT A;  1J7P A;  3BOW B;  3E3R A;  3S0A A;  2NZ0 A;  1FI6 A;  3BOW A;  4JQ0 D;  3D0Y A;  3R1O A;  4HRG A;  3FWB A;  2HF5 A;  2OS8 C;  1ALV A;  4AQJ A;  1RRO A;  2LVV A;  2LE9 B;  2EC6 B;  1QJT A;  1QIV A;  4CFR A;  4CPV A;  3DVE A;  2ISD A;  4PE7 A;  5BPJ A;  3SIB A;  2M49 B;  5D69 A;  1YRU B;  1SW8 A;  1C7V A;  4I5K A;  5K89 A;  1CLM A;  1JBA A;  5DKQ A;  1DJZ A;  3DF0 A;  4D1E A;  1M46 A;  2ERB A;  1IQ3 A;  2KLD A;  3CR2 A;  4XJK A;  4P5O E;  2KNE A;  1MHO A;  1S36 A;  3TDU A;  1UHJ A;  3DXL A;  1TUZ A;  1CNP A;  3A8R A;  3NSO A;  1F54 A;  1S5G Y;  2E30 A;  5I2O A;  1XFR A;  3B88 A;  3DVJ A;  1DEL A;  3IF7 A;  5D3O A;  3O4X A;  3S0E A;  4MEW A;  1QLS A;  5I8N A;  2KOT A;  1KK8 B;  4IL1 A;  1F4O A;  4NDB A;  1PSB A;  1TCF A;  1UP5 A;  2G2B A;  2L5X B;  3BUN B;  4M2P A;  3SJS A;  4JKT A;  3RZS A;  2L4H A;  1F55 A;  2GGM A;  2JT8 A;  2KHN A;  1MQ1 A;  2M3W A;  2CXJ A;  3BUW B;  1OMR A;  1AJ5 A;  4A4B A;  2QAC A;  1IG5 A;  4ZCU A;  4N1G A;  2B1U A;  1SR6 C;  1NP8 A;  1QIW A;  2SCP A;  1B8L A;  2KGR A;  3QME A;  2LAN A;  1KK7 Y;  1N0Y A;  2F3Y A;  3GK2 A;  5GQQ C;  1A2X A;  1F70 A;  1SMG A;  1SKT A;  3DD4 A;  3PN7 C;  3WHT B;  3FS7 A;  1CM1 A;  5AER A;  3I5H B;  4PE1 A;  3KO0 A;  4N5X A;  5CSN A;  2K7C A;  4MVF A;  2L2E A;  1DMO A;  1E8A A;  2ZKM X;  1PVB A;  4JPZ B;  1WDC B;  3VRN A;  4AQI A;  4IJ7 A;  5DKN A;  1MXL C;  1W9Z A;  2F33 A;  1SNL A;  2Y1M A;  1JFJ A;  1B7T Z;  4HSZ A;  4YBH B;  2LNK A;  2WC5 A;  1M45 A;  1CLB A;  4OV2 A;  2LVI A;  1KSO A;  3B7A A;  2LUX A;  3LL8 B;  2LMU A;  1PRW A;  2MA2 A;  2WC6 A;  3BFH A;  1WRL A;  3R72 A;  4YGE B;  3S0B A;  3EVR A;  2EC6 C;  4QJ5 B;  2JPT A;  3RM1 A;  3BYA A;  1K93 D;  1F4Q A;  2PRU A;  1DJI A;  4ZCV A;  5PAL A;  3D77 A;  3ICB A;  2E6W A;  4FQO A;  2Q4U A;  4C0K A;  1S1E A;  2FCD A;  1SBJ A;  3O78 A;  3VRO A;  3CZ2 A;  1UWO A;  2L98 A;  2KYF A;  1R6P A;  2A4J A;  2WCL A;  1P28 A;  1OQP A;  2WCH A;  5CSF A;  1YX7 A;  4PCW A;  2COL B;  1TN4 A;  2KFF A;  1SL7 A;  1HT9 A;  1CKK A;  2JOJ A;  1ZUZ A;  3L4A A;  3I5G B;  4INW A;  1XO5 A;  4AOM A;  2KQ6 A;  2LLT A;  1XFX O;  2LP2 A;  1K9U A;  4GFT A;  1ZAC A;  5KTY A;  1R2U A;  3SIA A;  1KK8 C;  3OHM B;  1C3Y A;  3MSE B;  5B8I B;  1YVH A;  1JF2 A;  1YUU A;  3BUX B;  3D78 A;  1N2D A;  2Y1N A;  2CNP A;  2P71 A;  3PFV A;  2QEH A;  1F8H A;  2LCP A;  2P70 A;  3VRP A;  2JRF A;  5AFP A;  1BR4 B;  2FJY A;  2KAY A;  1SYM A;  2KI6 D;  3TUY B;  4GPL B;  5JJG A;  1NUB A;  1KFX S;  2NCP A;  4CFQ A;  4PHM A;  1TIZ A;  2KLE A;  1NCX A;  1AVS A;  3V2L A;  4L9M A;  2KBM A;  5HL1 A;  1CDP A;  2WCK A;  1B8R A;  2KDH A;  5CSJ A;  1XFV O;  1IGV A;  2OPO A;  1Y1U A;  1NX1 A;  4NQG A;  3WHU B;  3I5H C;  3PAT A;  1OMV A;  3SG5 A;  1CMG A;  1V1F A;  3CLN A;  1BG1 A;  1QX7 A;  3BUM B;  3EK8 A;  1CFD A;  3OB1 B;  5ER4 X;  1K9P A;  1S3P A;  1TCO B;  2WOR A;  3L47 A;  5CPV A;  1DVI A;  3EK4 A;  1J7R A;  3NSK A;  2I2R E;  3OBV A;  1RK9 A;  1RJV A;  1YR5 A;  3IQO A;  4QJ3 B;  1C07 A;  1BMO A;  5G08 A;  1QV1 A;  1RFJ A;  4YGB B;  1A29 A;  4ORC B;  4F7F A;  1FPW A;  2JTT A;  1FBV A;  2O5G A;  4PDZ A;  1RTP 1;  1K94 A;  4FTG A;  3BJH A;  1A75 B;  5I94 A;  2Y5I A;  3HCM A;  1XFW O;  5HKY A;  3CAB A;  1XYD A;  1NYA A;  1LXF C;  1ODB A;  3NSI A;  2LHI A;  2MBX A;  1C3Z A;  4MLW A;  2QEB A;  3H4S E;  3QRX A;  4I5L B;  5EL2 A;  2BE6 A;  2LV7 A;  4FQT A;  1BOC A;  1NCZ A;  2ZRS A;  1SK6 D;  1GGW A;  2WCJ A;  1A4P A;  1KCY A;  2FOT A;  3JVT C;  1WRZ A;  5J3X A;  2ZFD A;  3I5G C;  2DOQ A;  5IBW A;  1GJY A;  1S6C A;  1NSH A;  1FW4 A;  3CDN A;  4PHJ A;  3EKJ A;  4DUQ A;  3D75 A;  2BCA A;  1BU3 A;  2HET A;  2L5Y A;  1IKU A;  3OX6 A;  1MWN A;  1QVI Y;  2WCM A;  2BCX A;  2K7O A;  1C7W A;  1LS8 A;  1S6J A;  3VRQ A;  1OZS A;  3LK0 A;  1YTZ C;  3SG6 A;  1OOJ A;  2ZN9 A;  4TNC A;  3ZWH A;  3TUY C;  2BNX A;  1S26 D;  1YUT A;  1G33 A;  3NSL A;  3BFA A;  4F0Z B;  2IS9 A;  4OZD A;  2L4I A;  3EVU A;  2WOS A;  1GM0 A;  1XFU O;  2KFG A;  3CZ1 A;  1DC1 A;  4OR9 B;  1EJ3 A;  4CID A;  1ORG A;  1QAT A;  2JUL A;  1IQ5 A;  2LUC A;  4DCK A;  2KI6 C;  2KGB C;  2BE4 A;  5FI6 A;  3Q8I A;  3S0F A;  1AJ4 A;  1EXR A;  2BAP A;  2F8P A;  4ICB A;  3UO9 A;  3DZT A;  2JC2 A;  3AKA A;  1EL4 A;  3FIA A;  2D8N A;  2M1K B;  3CTN A;  1Y0V H;  5HKZ A;  1YX8 A;  2JQ6 A;  1GGZ A;  3EKH A;  1B47 A;  3PSR A; 
#chains in the Genus database with same CATH homology
 2L51 A;  1IJ5 A;  1QXP A;  4DIR A;  1RWY A;  2BCB A;  1TNX A;  1Y6W A;  2HPS A;  1IJ6 A;  2ZND A;  2NLN A;  1W7I B;  2PSR A;  1QV0 A;  1LKJ A;  1QX2 A;  4YI9 A;  1B1G A;  4MBE A;  1A03 A;  5AEQ A;  1KFU L;  2JZI A;  2MHH A;  2MLE C;  2WCE A;  3TDI A;  1L7Z A;  1DJG A;  5FYX A;  1CFC A;  3F45 A;  1BLQ A;  3CR5 X;  1QLK A;  2M97 A;  2M7L A;  3VRR A;  1JF0 A;  1M39 A;  1OSA A;  1PAL A;  2ZN8 A;  4I5J A;  5AAN A;  1NPQ A;  3JTD B;  4I5N B;  1U5I B;  4DRW A;  2KFH A;  4DS7 A;  1KSM A;  2BKH B;  3JVT B;  1G8I A;  3I5I C;  1U5I A;  4ORA B;  1TNP A;  2H2K A;  2LP3 A;  2I94 A;  1YUR A;  1OZO A;  1CTR A;  1XK4 C;  2LC5 A;  1FF1 A;  4E68 A;  1MUX A;  2Q91 A;  1NX0 A;  5DKR A;  2WCB A;  5JOL A;  1J7O A;  4Q04 A;  3CR4 X;  4GNK B;  3KHE A;  2OTG C;  1TRF A;  3D10 A;  1X02 A;  4HRH A;  1CDL A;  3M0W A;  2RGI A;  4WRI A;  3RLZ A;  4M2O A;  4MZJ A;  4M2Q A;  3KPX A;  1YVL A;  2MRD A;  3CS1 A;  2PVB A;  1J1E A;  3PM8 A;  4NDD A;  2ZRT A;  2JT3 A;  2JWW A;  2KBI A;  2KQY A;  2CBL A;  3I5F B;  1NWD A;  5TNC A;  2H61 C;  2FJU B;  2EHB A;  3GK4 X;  1KFX L;  4NDC A;  2NCO A;  3EVV A;  1M63 B;  3KF9 A;  3O4Y A;  1L2O B;  1ZFS A;  1BT6 A;  5HKW A;  4JWQ A;  2AMI A;  1DF0 B;  4GGF C;  4R1E A;  3VGO A;  2WCF A;  2BEC A;  2JU0 A;  3AKB A;  4U8D A;  1EG3 A;  1UHK A;  2K2F A;  4WQ3 A;  3GOF A;  2BL0 C;  1REC A;  2LHL A;  2LVK A;  4MZL A;  1YUS A;  4UPG A;  1UHH A;  1B4C A;  3PAL A;  3C1V A;  4YRU A;  1IWQ A;  3TS5 B;  1CFP A;  5I2Q A;  1J1D A;  1N65 A;  1CDM A;  2JNF A;  1S5G Z;  3TZ1 A;  1A75 A;  3CGA A;  4N1F A;  2F3Z A;  3SG3 A;  2KYC A;  1CFF A;  1B9A A;  2VRG A;  4MN0 A;  1DGU A;  1PSR A;  3O2P A;  3JTD C;  4PHK A;  1H8B A;  3BXK A;  4A4C A;  2SAS A;  1EG4 A;  1LVC D;  1NIW A;  1LIN A;  4YGC B;  4QJ4 B;  1G4Y R;  1XA5 A;  1MXE A;  1DTL A;  4PHN A;  1DT7 B;  3D0Y B;  2LLU A;  4GAO A;  2FCE A;  1XFY O;  3I5I B;  1CDN A;  5AXI A;  4PE4 A;  1SL8 A;  1IH0 A;  1KK7 Z;  1KWO C;  1OE9 B;  1CLL A;  1J55 A;  2AUC A;  2O60 A;  1XK4 A;  1NX2 A;  4MRX A;  1SCV A;  1SY9 A;  2BBN A;  1QTX A;  3DF0 B;  4OVN F;  3BQ3 A;  2F2P A;  2I7A A;  3OX5 A;  2JT0 A;  1K90 D;  4XJK B;  1TNW A;  2OTG B;  1CMF A;  1PK0 D;  2M0R A;  1S6I A;  3LCP C;  1JWD A;  1UHN A;  4MZK A;  1K96 A;  2M9G A;  3I5F C;  1JUO A;  2JXC A;  2KAV A;  1DGV A;  1ZOT B;  5CSI A;  2BKI B;  4USL A;  3K21 A;  4WQ2 A;  1IRJ A;  1L2O C;  2HQ8 A;  2CCM A;  3WXA A;  5I2L A;  1QS7 A;  3BUO B;  3GK1 A;  2H61 A;  3PLF B;  1LA0 A;  2L50 A;  2M8U A;  2PAL A;  2KI4 B;  1TOP A;  2PAS A;  4YGD B;  5ER5 A;  3TS5 C;  2PMY A;  4GGF A;  1K2H A;  4OKH A;  3O6B A;  2BL0 B;  3SG4 A;  2QPT A;  1JSA A;  1AUI B;  1CM4 A;  2P6B B;  1ZMZ A;  2K7D A;  3LLE A;  2G9B A;  3AAJ A;  2K2A A;  1PUL A;  2M29 A;  2LAP A;  1CB1 A;  1KQM B;  2JTZ A;  1KFU S;  3LK1 A;  4HRE E;  1DJH A;  2AAO A;  2M7N A;  1J7Q A;  1H4B A;  3DVM A;  2I18 A;  1MF8 B;  4PAL A;  1WY9 A;  2Y4Q A;  2CT9 A;  3AAK A;  4GGN A;  2JXL A;  1GQM A;  3SG2 A;  1SCM B;  1W7J B;  1AK8 A;  2HQW A;  1V1G A;  2KSP A;  3DVK A;  1VRK A;  2ZNE A;  1WLM A;  5HYD A;  1K95 A;  1HQV A;  4YI8 A;  3ZNI A;  5HLV A;  1Y1A A;  2OS8 B;  2MJW B;  1KWO B;  3IQQ A;  1AHR A;  1OMD A;  1QAS A;  2WND A;  1LA3 A;  1XVJ A;  1ALW A;  1WRK A;  2CTN A;  1M31 A;  1B8C A;  1B7T Y;  1BOD A;  4P2Y B;  1BR1 B;  3CWG A;  3NXA A;  1XFZ O;  3A4U B;  1TNQ A;  3WNX B;  1SRA A;  4C0J A;  1JC2 A;  1MR8 A;  1NX3 A;  1SPY A;  1PVA A;  2R2I A;  1NCY A;  4ETO A;  1UUS A;  1D1O A;  1BJF A;  5KU1 A;  4CLN A;  3SG7 A;  3HX4 A;  2K0J A;  1YRT B;  2MLF C;  2NXQ A;  2EGD A;  1BF5 A;  2LMV A;  2LVJ A;  2M1U A;  2KI4 C;  4MSP A;  3KEV A;  1F71 A;  1QX5 B;  1DJX A;  1DF0 A;  2WC8 A;  1WLZ A;  4BY5 A;  4GUK A;  4OCI A;  1Y1X A;  2GV5 A;  3EK7 A;  1SR6 B;  2KAX A;  5KSZ A;  1DJY A;  2GGZ A;  5D7F A;  2LM5 A;  2V53 A;  3OP0 A;  1K8U A;  1AP4 A;  2K7B A;  3OB2 B;  2L0P A;  2K61 A;  4PE0 A;  1KQM C;  1FI5 A;  1DJW A;  1QVI Z;  3PN7 B;  3CZT X;  5HLO A;  4C0L A;  1UUR A;  1WDC C;  2BBM A;  2JNX A;  4BY4 A;  1KQV A;  1JFK A;  4MRY A;  5F6T A;  1K9K A;  2MAZ A;  1TTX A;  2TN4 A;  4XYN A;  4YGA A;  3FWC A;  1UHI A;  1SL9 A;  3TDZ A;  1EH2 A;  2F2O A;  1SCM C;  4ORB B;  2K8M B;  2LLS A;  1Q80 A;  4GBA A;  2LMT A;  1J7P A;  3BOW B;  3E3R A;  2NZ0 A;  1FI6 A;  3BOW A;  4JQ0 D;  3D0Y A;  4HRG A;  3FWB A;  2HF5 A;  2OS8 C;  1ALV A;  1RRO A;  2LVV A;  2LE9 B;  2EC6 B;  1QJT A;  1QIV A;  4CFR A;  4CPV A;  3DVE A;  2ISD A;  4PE7 A;  5BPJ A;  3SIB A;  2M49 B;  5D69 A;  1YRU B;  1SW8 A;  1C7V A;  4I5K A;  5K89 A;  1CLM A;  1JBA A;  5DKQ A;  1DJZ A;  3DF0 A;  4D1E A;  1M46 A;  1IQ3 A;  3CR2 A;  4XJK A;  4P5O E;  2KNE A;  1MHO A;  1S36 A;  3TDU A;  1UHJ A;  1CNP A;  3A8R A;  3NSO A;  1F54 A;  1S5G Y;  2E30 A;  5I2O A;  3DVJ A;  3IF7 A;  4MEW A;  1QLS A;  5I8N A;  2KOT A;  1KK8 B;  4IL1 A;  1F4O A;  4NDB A;  1PSB A;  1TCF A;  1UP5 A;  2G2B A;  2L5X B;  3BUN B;  4M2P A;  3SJS A;  1F55 A;  2L4H A;  2GGM A;  2JT8 A;  2KHN A;  1MQ1 A;  2M3W A;  2CXJ A;  3BUW B;  1OMR A;  1AJ5 A;  4A4B A;  2QAC A;  1IG5 A;  4ZCU A;  4N1G A;  2B1U A;  1SR6 C;  1NP8 A;  1QIW A;  2SCP A;  1B8L A;  2KGR A;  2LAN A;  1KK7 Y;  1N0Y A;  2F3Y A;  3GK2 A;  5GQQ C;  1A2X A;  1F70 A;  1SMG A;  1SKT A;  3DD4 A;  3PN7 C;  3WHT B;  3FS7 A;  1CM1 A;  5AER A;  3I5H B;  4PE1 A;  3KO0 A;  4N5X A;  5CSN A;  2K7C A;  4MVF A;  2L2E A;  1DMO A;  1E8A A;  2ZKM X;  1PVB A;  4JPZ B;  1WDC B;  3VRN A;  4AQI A;  5DKN A;  1MXL C;  2F33 A;  1SNL A;  2Y1M A;  1JFJ A;  1B7T Z;  4HSZ A;  4YBH B;  2LNK A;  1M45 A;  1CLB A;  4OV2 A;  2LVI A;  1KSO A;  2LUX A;  3LL8 B;  2LMU A;  1PRW A;  2MA2 A;  4AQJ A;  1WRL A;  4YGE B;  4QJ5 B;  3EVR A;  2EC6 C;  2JPT A;  3RM1 A;  3BYA A;  1K93 D;  1F4Q A;  2PRU A;  1DJI A;  4ZCV A;  5PAL A;  3ICB A;  4FQO A;  2E6W A;  2Q4U A;  4C0K A;  1S1E A;  2FCD A;  1SBJ A;  3O78 A;  3VRO A;  1UWO A;  2L98 A;  2KYF A;  1R6P A;  2A4J A;  1OQP A;  5CSF A;  1YX7 A;  4PCW A;  2COL B;  1TN4 A;  2KFF A;  1SL7 A;  1HT9 A;  1CKK A;  2JOJ A;  1ZUZ A;  3I5G B;  1XO5 A;  4AOM A;  2KQ6 A;  2LLT A;  1XFX O;  2LP2 A;  1K9U A;  4GFT A;  1ZAC A;  5KTY A;  1R2U A;  3SIA A;  1KK8 C;  3OHM B;  3MSE B;  5B8I B;  1YVH A;  1JF2 A;  1YUU A;  3BUX B;  1N2D A;  2Y1N A;  2CNP A;  3PFV A;  1F8H A;  2LCP A;  3VRP A;  2JRF A;  5AFP A;  1BR4 B;  2KAY A;  1SYM A;  2KI6 D;  3TUY B;  4GPL B;  5JJG A;  1NUB A;  1KFX S;  2NCP A;  4CFQ A;  4PHM A;  1TIZ A;  1NCX A;  1AVS A;  4L9M A;  2KBM A;  1CDP A;  1B8R A;  2KDH A;  5CSJ A;  1XFV O;  1IGV A;  2OPO A;  1Y1U A;  1NX1 A;  4NQG A;  3WHU B;  3I5H C;  3PAT A;  1OMV A;  3SG5 A;  1CMG A;  1V1F A;  3CLN A;  1BG1 A;  1QX7 A;  3BUM B;  3EK8 A;  1CFD A;  3OB1 B;  5ER4 X;  1K9P A;  1S3P A;  1TCO B;  2WOR A;  5CPV A;  1DVI A;  3EK4 A;  1J7R A;  3NSK A;  2I2R E;  1RK9 A;  1RJV A;  1YR5 A;  3IQO A;  4QJ3 B;  1C07 A;  1BMO A;  5G08 A;  1QV1 A;  1RFJ A;  4YGB B;  1A29 A;  4ORC B;  1FPW A;  2JTT A;  1FBV A;  2O5G A;  4PDZ A;  1RTP 1;  1K94 A;  4FTG A;  1A75 B;  2Y5I A;  3HCM A;  1XFW O;  5HKY A;  1XYD A;  1NYA A;  1LXF C;  1ODB A;  3NSI A;  2LHI A;  2MBX A;  4MLW A;  3QRX A;  3H4S E;  4I5L B;  2BE6 A;  2LV7 A;  1BOC A;  1NCZ A;  2ZRS A;  1SK6 D;  1GGW A;  1A4P A;  1KCY A;  2FOT A;  3JVT C;  1WRZ A;  5J3X A;  2ZFD A;  3I5G C;  2DOQ A;  5IBW A;  1GJY A;  1S6C A;  1NSH A;  1FW4 A;  4PHJ A;  3EKJ A;  4DUQ A;  2BCA A;  1BU3 A;  2HET A;  1IKU A;  3OX6 A;  1MWN A;  1QVI Y;  2BCX A;  2K7O A;  1C7W A;  1S6J A;  3VRQ A;  1OZS A;  3LK0 A;  1YTZ C;  3SG6 A;  1OOJ A;  2ZN9 A;  4TNC A;  3ZWH A;  3TUY C;  1S26 D;  1YUT A;  1G33 A;  3NSL A;  4F0Z B;  2IS9 A;  2L4I A;  3EVU A;  2WOS A;  1XFU O;  2KFG A;  4OR9 B;  1EJ3 A;  4CID A;  1QAT A;  2JUL A;  1IQ5 A;  2LUC A;  4DCK A;  2KI6 C;  2KGB C;  2BE4 A;  1AJ4 A;  1EXR A;  2F8P A;  4ICB A;  2JC2 A;  3AKA A;  1EL4 A;  3FIA A;  2D8N A;  2M1K B;  3CTN A;  1Y0V H;  5HKZ A;  1YX8 A;  2JQ6 A;  1GGZ A;  3EKH A;  1B47 A;  3PSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...