2E30A

Solution structure of the cytoplasmic region of na+/h+ exchanger 1 complexed with essential cofactor calcineurin b homologous protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
195
structure length
195
Chain Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transport protein
molecule keywords Calcium-binding protein p22
total genus 45
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2006-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e30A01
1IJ6A 2L2EA 4YI9A 5GQQC 1NCZA 2JXCA 4JPZB 2WCEA 2O60A 2JRFA 3SG4A 2FOTA 2H61A 2EGDA 5D69A 1SL9A 4GGFA 3H4SE 1WRKA 3LL8B 1Y6WA 3NSLA 2WNDA 4C0LA 2M8UA 4MZKA 1AJ5A 2MA2A 1K9KA 1TNXA 4WRIA 2JPTA 3ICBA 1TTXA 1MHOA 4GUKA 3TUYB 3SJSA 1CM1A 1OMDA 2HPSA 2BL0C 2M0RA 3VRQA 1AP4A 1KQMB 1K8UA 1CFDA 2LLTA 3EK7A 1TOPA 5I2OA 4P2YB 2BBMA 1BMOA 2M97A 4YGAA 5ER4X 4XJKB 1B1GA 2HQWA 1F54A 2GV5A 1S6JA 1WDCC 4PE0A 5DKRA 3SIBA 4PHJA 1BT6A 3BYAA 2CBLA 2LV7A 1YRUB 1M45A 4OVNF 1RTP1 2EC6C 5CSJA 2G2BA 1KFUL 2COLB 5DKQA 1MUXA 1K90D 1OE9B 1SCMC 1UHKA 3EKJA 4MVFA 3O6BA 3JVTC 1K9UA 1JUOA 3I5FC 1K96A 1DJIA 1LXFC 5K89A 5I2LA 2JWWA 4AOMA 1CM4A 3OB1B 5ER5A 1M31A 1XFWO 3EKHA 4OR9B 4C0KA 2KYCA 5IBWA 1B9AA 1AUIB 2OTGB 4WQ3A 4L9MA 2KBMA 4DRWA 1KSOA 1DVIA 5F6TA 1A4PA 1OSAA 2M3WA 1VRKA 1C7VA 2Y4QA 3BUOB 2I18A 1DMOA 4CLNA 1ZMZA 1Y0VH 2K7CA 1L2OB 2JTTA 2OPOA 1V1FA 4OV2A 1YUUA 2KGBC 4N1GA 1QX7A 2JU0A 2JTZA 2F3YA 3D0YB 1V1GA 3KEVA 1G8IA 1Y1UA 5HLVA 1ZUZA 1R6PA 2ISDA 2B1UA 2KFFA 4GNKB 2JNFA 2KQ6A 1NWDA 3WNXB 5AERA 1CLMA 4N5XA 2KFGA 1EG4A 2KSPA 2PALA 3DVMA 3WHUB 3O2PA 2D8NA 1KK7Y 2JOJA 1DJXA 1CB1A 2ZNEA 3DD4A 1JBAA 5HKWA 3LK0A 1EH2A 1SR6C 2JULA 1PK0D 1M46A 1OZSA 4YBHB 2O5GA 4ORAB 1BR1B 3EVRA 1FBVA 3FWBA 2ZRTA 1F4QA 2LUCA 2TN4A 1DJYA 3TS5B 5BPJA 4ORBB 3SG3A 4D1EA 1F70A 3K21A 1CKKA 4AQJA 1SRAA 2LE9B 5AXIA 1WY9A 1B7TZ 1FF1A 1S6CA 2LNKA 4HRHA 1G33A 2JC2A 2KOTA 1BLQA 3KF9A 2FCEA 3IQQA 3O78A 3FIAA 3CZTX 3AAKA 1NX0A 2AUCA 2OS8C 3NSIA 2MRDA 1NPQA 2JQ6A 4TNCA 5J3XA 3DF0B 4JQ0D 1QXPA 1N65A 2L5XB 3GK1A 3PFVA 4MRYA 1S1EA 4E68A 1WDCB 1J7PA 1F71A 1YUSA 1IH0A 1CDNA 1QASA 2SCPA 3GK2A 1NIWA 3IF7A 2M1UA 3VROA 5JOLA 3BXKA 1SCMB 3LLEA 4DCKA 2HF5A 2M7LA 3PATA 1S5GY 1YUTA 4U8DA 1LINA 2LUXA 1N2DA 1NP8A 2K2AA 2IS9A 1QVIZ 1OMVA 1UWOA 2L98A 2LCPA 1QLSA 2LP3A 1RWYA 2H61C 2M9GA 2WORA 1S5GZ 1SPYA 2L4HA 4PHMA 4P5OE 2LHIA 3CWGA 3DVJA 2KHNA 2K2FA 1WRZA 1LA3A 4NDBA 1ZOTB 1K2HA 1KWOB 3TDZA 4IL1A 1JF0A 1KFXS 1QATA 1CLLA 1QJTA 1QTXA 1UHNA 1XK4A 2NLNA 3LK1A 4HRGA 4I5LB 2LMUA 4NDCA 2G9BA 2M7NA 2WC8A 1IRJA 1AVSA 3RM1A 1HT9A 3VRPA 1XFZO 1CNPA 4CIDA 1SNLA 1F55A 1A2XA 1DGVA 4GBAA 5D7FA 1NSHA 1JSAA 1CFFA 1F4OA 2ZRSA 1IGVA 4BY4A 1BF5A 1A75A 3PM8A 3WHTB 4AQIA 1J7OA 2GGMA 2EC6B 3EK8A 3TZ1A 1J55A 2KI4C 3JVTB 1A29A 4I5KA 1SY9A 4MBEA 1S6IA 2BE6A 1YTZC 3CS1A 3OP0A 1A75B 1KK7Z 2BBNA 1UHJA 1PULA 1EXRA 4A4BA 4NDDA 1JFKA 2K0JA 2LAPA 2Y1MA 4WQ2A 3PLFB 2L50A 2CT9A 1UHHA 3EVUA 4PE4A 1CLBA 1K9PA 3TUYC 1ZFSA 5HLOA 1YURA 2JT3A 1EL4A 1UURA 2BECA 5CPVA 4DUQA 2BCXA 2LHLA 2PRUA 1TNQA 3LCPC 1NX3A 1S26D 3MSEB 3I5HB 3O4YA 2LVVA 2NCOA 1KK8B 2LLSA 2LVJA 4FTGA 1XYDA 1SW8A 3PN7B 2JXLA 1IG5A 2ZNDA 1MQ1A 3A4UB 1TIZA 1U5IA 4GAOA 4C0JA 5CSFA 3BOWB 1QV1A 2OS8B 4PALA 3IQOA 1NX1A 2R2IA 3NSOA 2LANA 1BODA 1CMGA 1WLMA 1OMRA 1NCYA 1B8CA 3CR5X 3I5FB 1AJ4A 1XK4C 3SIAA 1RK9A 2KI6C 1SCVA 2BCAA 1RFJA 1IQ3A 2CNPA 1J7QA 1K95A 1GJYA 1H8BA 1LVCD 4MSPA 4MZLA 1AHRA 2K7OA 1UP5A 2KFHA 2QACA 4ZCUA 2NCPA 1FI6A 2KAXA 2PMYA 2WCFA 1E8AA 3F45A 4MEWA 4USLA 4F0ZB 1CFPA 4DS7A 3I5IC 2BE4A 2NZ0A 4MRXA 3C1VA 4PE7A 4ZCVA 1DJHA 3PSRA 1Y1AA 2Q4UA 5KSZA 3JTDC 2L4IA 5PALA 1ZACA 1XFUO 2K7DA 2K61A 2L51A 2PVBA 4YRUA 5I8NA 1H4BA 1NUBA 4QJ3B 1W7IB 1J1EA 2F2OA 4M2OA 1TCOB 4I5NB 1DT7B 1J7RA 2KI6D 2PSRA 2WCBA 1B47A 1CFCA 1XO5A 2L0PA 3RLZA 1IQ5A 4PCWA 4MZJA 5TNCA 4YGCB 2MHHA 3HCMA 5CSNA 1PVBA 1CDLA 1IWQA 1YRTB 1F8HA 2LM5A 3BUWB 2MAZA 4HREE 4YI8A 2JZIA 1J1DA 1DF0B 1PALA 1BOCA 2E30A 1EJ3A 1KFXL 3I5GB 3GK4X 2WOSA 1LKJA 1YR5A 1Q80A 3D10A 1MXLC 2LMVA 3DF0A 1XVJA 1L7ZA 2ZKMX 4OKHA 2LP2A 1CTRA 5AFPA 2ZN9A 2LC5A 4DIRA 4QJ4B 1QIWA 3BUXB 1MXEA 1CMFA 1IJ5A 1M63B 3CR4X 3OHMB 1K94A 2KNEA 4MLWA 3QRXA 2A4JA 3BUMB 5CSIA 2CXJA 1N0YA 1R2UA 1OZOA 1SBJA 2CCMA 2HQ8A 2ZFDA 2BKIB 1KWOC 1D1OA 1PVAA 1FW4A 1TRFA 3EVVA 1XFXO 3AKBA 3KPXA 2LMTA 3FWCA 4ETOA 1SL7A 2JNXA 3ZWHA 3FS7A 2BL0B 1KSMA 3TDUA 1SYMA 3AKAA 2I94A 4GGNA 1KK8C 2K7BA 1K93D 1QV0A 1GGWA 1QVIY 2M1KB 4ORCB 1RECA 2BKHB 2HETA 2F3ZA 4NQGA 2MLEC 3PALA 2ZN8A 1SKTA 2EHBA 1W7JB 2JT0A 5G08A 4FQOA 1S3PA 2AMIA 3GOFA 4XYNA 1RJVA 1X02A 3CLNA 3D0YA 3TDIA 4GPLB 1NCXA 3CTNA 1HQVA 4CFQA 1NX2A 4CFRA 2Y5IA 1PSBA 4PHNA 2KAVA 1UHIA 2KDHA 1YX7A 2I2RE 1G4YR 1QX2A 4HSZA 1QLKA 4XJKA 2M49B 3VRRA 1UUSA 4Q04A 4PDZA 3CR2A 1WRLA 3NXAA 3DVKA 5FYXA 1FPWA 4YGDB 3SG2A 1C7WA 1ODBA 1NYAA 3VRNA 2LLUA 4BY5A 2K8MB 1QS7A 2JT8A 2MJWB 3E3RA 2OTGC 5HKYA 4GFTA 3I5HC 3NSKA 4PHKA 5DKNA 1KQMC 1BU3A 1M39A 1TNWA 3TS5C 1DJZA 3JTDB 3DVEA 1MWNA 1YVHA 2LVKA 1LA0A 2Q91A 2Y1NA 1JC2A 1QX5B 1JWDA 2RGIA 3SG6A 1L2OC 1WLZA 2KAYA 4PE1A 5JJGA 4YGEB 1B8LA 1OOJA 1CDPA 3M0WA 2FCDA 1JFJA 1DF0A 4M2PA 1DGUA 2QPTA 1KFUS 1BJFA 2P6BB 2F2PA 3ZNIA 1TCFA 1Y1XA 2GGZA 4GGFC 2E6WA 1DJWA 1XA5A 3HX4A 3KHEA 2BCBA 2DOQA 3BOWA 4YGBB 1B8RA 1YVLA 2H2KA 1GQMA 2MLFC 5B8IB 1IKUA 1SR6B 3OX6A 1ALWA 3OX5A 3SG7A 2FJUB 3VGOA 1RROA 3CGAA 1MF8B 1PRWA 4R1EA 3SG5A 1BR4B 2MBXA 1AK8A 2KYFA 1ALVA 3OB2B 4CPVA 4JWQA 1SMGA 1S36A 1YX8A 4ICBA 2V53A 2LVIA 2I7AA 2M29A 5AEQA 1SK6D 1DJGA 5KU1A 4M2QA 1SL8A 3BQ3A 2KQYA 2F8PA 1XFVO 5HYDA 1PSRA 5KTYA 1KCYA 4A4CA 1MR8A 1TNPA 1BG1A 1KQVA 1XFYO 2KBIA 3EK4A 2CTNA 1B4CA 4N1FA 5AANA 4I5JA 4OCIA 5HKZA 1FI5A 3WXAA 3BUNB 5I2QA 2VRGA 2PASA 3I5GC 2NXQA 1TN4A 2KGRA 3KO0A 2SASA 4QJ5B 1C07A 1OQPA 1U5IB 1A03A 1QIVA 1DTLA 2AAOA 2F33A 3AAJA 4MN0A 3PN7C 3I5IB 1EG3A 1JF2A 3A8RA 4UPGA 1B7TY 1GGZA 1CDMA 2KI4B
chains in the Genus database with same CATH superfamily
1IJ6A 3D75A 2L2EA 4YI9A 5GQQC 1NCZA 2JXCA 4JPZB 2WCEA 2O60A 2JRFA 3SG4A 2FOTA 2H61A 2EGDA 5D69A 1SL9A 4GGFA 3H4SE 1WRKA 3LL8B 1Y6WA 3NSLA 2WNDA 4C0LA 2M8UA 4MZKA 1AJ5A 2MA2A 1K9KA 1TNXA 1DELA 2JPTA 3CZ2A 3Q8IA 4WRIA 3ICBA 1TTXA 1MHOA 4GUKA 3TUYB 3SJSA 1CM1A 1OMDA 1Z2CB 2HPSA 2BL0C 2M0RA 3VRQA 1AP4A 1KQMB 1K8UA 1CFDA 2LLTA 3EK7A 5D3OA 1TOPA 5I2OA 4P2YB 2BBMA 1BMOA 2M97A 4YGAA 5ER4X 4XJKB 1B1GA 2HQWA 1F54A 2GV5A 1S6JA 1WDCC 3FE6A 4PE0A 5DKRA 3SIBA 4PHJA 1BT6A 2KLDA 3BYAA 4INWA 2CBLA 2LV7A 1YRUB 1M45A 4OVNF 1RTP1 2EC6C 5CSJA 2G2BA 1KFUL 2COLB 5DKQA 1MUXA 1K90D 1OE9B 1OOHA 1DQEA 1OOGA 1SCMC 1UHKA 3EKJA 3R72A 4MVFA 3O6BA 3JVTC 1K9UA 1JUOA 3I5FC 1K96A 1DJIA 1LXFC 4F7FA 5K89A 5I2LA 2JWWA 4AOMA 1CM4A 3OB1B 3CYZA 1M31A 5ER5A 2BNXA 1IIOA 1XFWO 3EKHA 2JPOA 4OR9B 2KYCA 4C0KA 5IBWA 1B9AA 3UNWA 1AUIB 2OTGB 4WQ3A 3S0DA 3D77A 4L9MA 2KBMA 2WCJA 3D78A 4DRWA 1T14A 2P70A 1KSOA 1DVIA 5F6TA 1A4PA 1OSAA 2M3WA 1VRKA 1C7VA 2QEOA 2Y4QA 3BUOB 2I18A 1DMOA 3S0EA 4CLNA 1ZMZA 1Y0VH 2K7CA 1L2OB 2JTTA 2OPOA 1V1FA 4OV2A 1YUUA 2KGBC 4N1GA 1QX7A 2JU0A 2JTZA 3FE8A 3VB1A 2F3YA 3D0YB 1V1GA 3KEVA 1G8IA 1Y1UA 5HLVA 1ZUZA 2WCMA 2QEBA 1R6PA 2ISDA 2B1UA 2KFFA 4GNKB 2JNFA 2KQ6A 1NWDA 3WNXB 5AERA 1CLMA 4N5XA 2KFGA 1EG4A 2KSPA 2PALA 3DVMA 3WHUB 3O2PA 2D8NA 3S0GA 1C3ZA 1KK7Y 2JOJA 1DJXA 2H8VA 1CB1A 2ZNEA 3DD4A 1JBAA 5HKWA 3LK0A 1EH2A 1SR6C 2JULA 1PK0D 1M46A 1OZSA 4YBHB 2O5GA 4ORAB 1BR1B 3EVRA 1FBVA 3FWBA 2ZRTA 1F4QA 3D76A 2LUCA 2TN4A 1DJYA 3TS5B 5BPJA 4ORBB 3SG3A 3QMEA 4D1EA 1F70A 3K21A 2L5YA 1CKKA 4AQJA 2QDIA 2KLEA 1SRAA 2LE9B 5AXIA 1WY9A 1B7TZ 1FF1A 3DY9A 1S6CA 2LNKA 4HRHA 1G33A 2JC2A 2KOTA 1BLQA 3KF9A 2FCEA 3IQQA 3O78A 3FIAA 3CZTX 3N7HA 1P28A 1NX0A 3AAKA 2AUCA 2OS8C 3NSIA 2MRDA 1NPQA 2JQ6A 4TNCA 5J3XA 3DF0B 4JQ0D 3IVTA 3DZTA 1QXPA 1N65A 2L5XB 3GK1A 3NHIA 3PFVA 3PJIA 4MRYA 1S1EA 4PT1A 4E68A 1WDCB 1J7PA 1F71A 3B6XA 1YUSA 1IH0A 1CDNA 1QASA 2SCPA 3GK2A 1NIWA 3IF7A 2M1UA 3VROA 5JOLA 3BXKA 1SCMB 1TUZA 3LLEA 4DCKA 2HF5A 2M7LA 3PATA 1S5GY 1YUTA 4U8DA 1LINA 2LUXA 1N2DA 1NP8A 2K2AA 2IS9A 1QVIZ 1OMVA 1UWOA 1TWOA 2L98A 1QLSA 2LCPA 1RWYA 2H61C 2LP3A 2M9GA 2WORA 5I94A 1S5GZ 1SPYA 2L4HA 4PHMA 4P5OE 2LHIA 3CWGA 3DVJA 2KHNA 2K2FA 1WRZA 1LA3A 4NDBA 2WCKA 1ZOTB 1K2HA 1KWOB 2QEHA 2WC6A 3TDZA 4IL1A 1JF0A 1KFXS 1QATA 1CLLA 1QJTA 1QTXA 1UHNA 1XK4A 2NLNA 3LK1A 4HRGA 4I5LB 2LMUA 4NDCA 2G9BA 2L2CA 2M7NA 2WC8A 1IRJA 1AVSA 3RM1A 1HT9A 3VRPA 1XFZO 3NGVA 1CNPA 4CIDA 3K1EA 1SNLA 1F55A 4INXA 1A2XA 1DGVA 4GBAA 5D7FA 1NSHA 3SS3A 1JSAA 1CFFA 1F4OA 2P71A 2ZRSA 1IGVA 4BY4A 1BF5A 1A75A 3BFAA 3PM8A 3WHTB 4AQIA 1J7OA 2GGMA 2EC6B 3EK8A 3TZ1A 3SS4A 1J55A 2KI4C 3JVTB 2KPHA 1A29A 4I5KA 3D73A 1SY9A 4MBEA 1OW4A 1S6IA 2BE6A 1YTZC 3CS1A 3OP0A 1A75B 1KK7Z 2BBNA 1UHJA 3OGNA 2PQLA 1PULA 1EXRA 4A4BA 4NDDA 1JFKA 2K0JA 2LAPA 2Y1MA 1GM0A 4WQ2A 3PLFB 2L50A 2CT9A 1UHHA 3EVUA 4PE4A 1CLBA 1K9PA 3TUYC 3FE9A 1ZFSA 5HLOA 1YURA 2JT3A 1EL4A 1UURA 2BECA 5CPVA 4DUQA 2BCXA 2LHLA 2PRUA 1TNQA 3LCPC 3V2LA 1NX3A 1S26D 2WCLA 3MSEB 1DC1A 3I5HB 3O4YA 2LVVA 2NCOA 1KK8B 1QWVA 2LLSA 2LVJA 4FTGA 3DYEA 1XYDA 1SW8A 3PN7B 2JXLA 3R1OA 1IG5A 2ZNDA 1MQ1A 3A4UB 1TIZA 1U5IA 4GAOA 4C0JA 5CSFA 3BOWB 1QV1A 3SS5A 1C3YA 2OS8B 4PALA 3IQOA 1NX1A 2R2IA 3NSOA 2LANA 1BODA 1CMGA 1WLMA 1OMRA 1NCYA 1B8CA 2GTEA 3CR5X 3I5FB 5FI7A 3L4AA 1AJ4A 1XK4C 3SIAA 1RK9A 2KI6C 1SCVA 2BCAA 1RFJA 3CZ0A 1IQ3A 2CNPA 1J7QA 1K95A 1GJYA 1H8BA 1LVCD 4MSPA 4MZLA 1AHRA 3DXLA 2K7OA 1UP5A 2KFHA 2QACA 3OBVA 2NCPA 4ZCUA 3S0AA 1FI6A 2KAXA 2PMYA 2WCFA 1E8AA 3B88A 3F45A 4MEWA 4USLA 4F0ZB 4DS7A 1CFPA 3I5IC 2BE4A 2NZ0A 4MRXA 3C1VA 3RZSA 4PE7A 1Z4HA 4ZCVA 1DJHA 3PSRA 1Y1AA 2Q4UA 5KSZA 1ORGA 3JTDC 3B86A 2L4IA 5PALA 3S0FA 1ZACA 1XFUO 2K7DA 2K61A 2L51A 2PVBA 4YRUA 5EL2A 5I8NA 1H4BA 1NUBA 4QJ3B 1W7IB 1J1EA 2F2OA 4M2OA 1TCOB 4I5NB 1DT7B 1J7RA 2KI6D 2PSRA 2WCBA 1B47A 3BFHA 2FJYA 1CFCA 1XO5A 2L0PA 3RLZA 1IQ5A 4PCWA 4MZJA 5TNCA 4YGCB 2MHHA 3HCMA 5CSNA 1PVBA 1CDLA 5HL1A 1IWQA 1YRTB 1F8HA 2LM5A 3BUWB 2MAZA 4HREE 4YI8A 2JZIA 1J1DA 1DF0B 1PALA 1BOCA 4JKTA 2E30A 1EJ3A 1KFXL 3I5GB 3GK4X 2WOSA 1LKJA 1YR5A 1Q80A 3D10A 1MXLC 2LMVA 3DF0A 1XVJA 1L7ZA 2ZKMX 4OKHA 2LP2A 1CTRA 5AFPA 2ZN9A 2LC5A 4DIRA 4QJ4B 2YGUA 1QIWA 3BUXB 1MXEA 1CMFA 1IJ5A 1M63B 3CR4X 3OHMB 1K94A 2KNEA 4MLWA 3QRXA 2A4JA 3BUMB 5CSIA 2CXJA 1N0YA 1R2UA 1OZOA 3R1VA 1SBJA 2CCMA 2HQ8A 2ZFDA 2BKIB 2PYQA 3PM2A 1KWOC 1D1OA 1PVAA 1FW4A 1TRFA 2QEVA 3EVVA 1XFXO 3AKBA 3KPXA 2LMTA 3FWCA 4ETOA 1SL7A 2JNXA 3ZWHA 3FS7A 2BL0B 1KSMA 3TDUA 1SYMA 3AKAA 2I94A 4GGNA 1KK8C 2K7BA 1K93D 1QV0A 1GGWA 1QVIY 2M1KB 4ORCB 1RECA 2BKHB 2HETA 2F3ZA 4NQGA 3O4XA 2MLEC 3PALA 2ZN8A 1SKTA 2EHBA 1W7JB 2JT0A 5G08A 4FQOA 1S3PA 2AMIA 3GOFA 4XYNA 1W9ZA 1RJVA 1X02A 3CLNA 3D0YA 3TDIA 4GPLB 1NCXA 3CTNA 1HQVA 4CFQA 1NX2A 1TUJA 4CFRA 2Y5IA 1PSBA 4PHNA 2KAVA 1UHIA 2KDHA 1YX7A 2I2RE 1G4YR 1QX2A 4HSZA 1QLKA 4XJKA 2M49B 3VRRA 1UUSA 2ERBA 4Q04A 3B7AA 1DEKA 4PDZA 3CR2A 1WRLA 3NXAA 3CZ1A 2WC5A 3DVKA 3BFBA 5FYXA 1FPWA 4YGDB 3SG2A 1C7WA 1ODBA 1NYAA 3VRNA 2LLUA 4BY5A 5FI6A 2K8MB 1QS7A 2JT8A 2MJWB 3E3RA 2OTGC 5HKYA 4GFTA 3I5HC 3NSKA 4PHKA 5DKNA 1KQMC 1BU3A 1M39A 1TNWA 3TS5C 1DJZA 3JTDB 3DVEA 1MWNA 1YVHA 2LVKA 1LA0A 1LS8A 2Q91A 2Y1NA 1JC2A 1QX5B 1JWDA 2RGIA 3SG6A 1L2OC 3NHTA 3R1PA 1WLZA 2KAYA 4PE1A 5JJGA 4YGEB 1B8LA 1OOJA 1CDPA 1SSEB 1OOFA 3M0WA 2FCDA 3CDNA 4FQTA 1DF0A 1JFJA 4M2PA 1DGUA 1XFRA 2QPTA 3L4LA 1KFUS 4OZDA 5FI2A 1BJFA 2P6BB 2F2PA 3ZNIA 1TCFA 1Y1XA 2GGZA 2K60A 2E6WA 1DJWA 1XA5A 4GGFC 3HX4A 1OOIX 3KHEA 2BCBA 2DOQA 3BOWA 4YGBB 1B8RA 1YVLA 2H2KA 1GQMA 2MLFC 5B8IB 1IKUA 1SR6B 3OX6A 1ALWA 3BJHA 3B87A 3OX5A 3SG7A 2FJUB 3UO9A 3VGOA 1RROA 3CGAA 4JD9A 1MF8B 1PRWA 4R1EA 3SG5A 1BR4B 2MBXA 1AK8A 2KYFA 1ALVA 3OB2B 2BAPA 4CPVA 4JWQA 1SMGA 1S36A 1YX8A 4ICBA 2V53A 3D74A 2LVIA 2I7AA 2M29A 5AEQA 3EG5B 1SK6D 1DJGA 5KU1A 4M2QA 1SL8A 3BQ3A 2KQYA 1XFVO 2F8PA 5HYDA 1PSRA 5KTYA 3L47A 1KCYA 4A4CA 1MR8A 1TNPA 1BG1A 2WCHA 1KQVA 1XFYO 2KBIA 3EK4A 5DICA 2CTNA 1B4CA 4N1FA 5AANA 4IJ7A 4I5JA 4OCIA 5HKZA 4KYNA 1FI5A 3WXAA 3BUNB 5I2QA 2VRGA 2PASA 3I5GC 2NXQA 1TN4A 2KGRA 3KO0A 2SASA 4QJ5B 1C07A 1OQPA 1U5IB 1A03A 1QIVA 1DTLA 2AAOA 2F33A 3AAJA 4MN0A 3PN7C 3CABA 3S0BA 3I5IB 1EG3A 1JF2A 3A8RA 4UPGA 1B7TY 1GGZA 1CDMA 2KI4B
chains in the Genus database with same CATH topology
1IJ6A 2L2EA 4YI9A 5GQQC 1NCZA 2JXCA 4JPZB 2WCEA 2O60A 2JRFA 3SG4A 2FOTA 2H61A 2EGDA 5D69A 1SL9A 4GGFA 3H4SE 1WRKA 3LL8B 1Y6WA 3NSLA 2WNDA 4C0LA 2M8UA 4MZKA 1AJ5A 2MA2A 1K9KA 1TNXA 4WRIA 2JPTA 3ICBA 1TTXA 1MHOA 4GUKA 3TUYB 3SJSA 1CM1A 1OMDA 2HPSA 2BL0C 2M0RA 3VRQA 1AP4A 1KQMB 1K8UA 1CFDA 2LLTA 3EK7A 1TOPA 5I2OA 4P2YB 2BBMA 1BMOA 2M97A 4YGAA 5ER4X 4XJKB 1B1GA 2HQWA 1F54A 2GV5A 1S6JA 1WDCC 4PE0A 5DKRA 3SIBA 4PHJA 1BT6A 3BYAA 2CBLA 2LV7A 1YRUB 1M45A 4OVNF 1RTP1 2EC6C 5CSJA 2G2BA 1KFUL 2COLB 5DKQA 1MUXA 1K90D 1OE9B 1SCMC 1UHKA 3EKJA 4MVFA 3O6BA 3JVTC 1K9UA 1JUOA 3I5FC 1K96A 1DJIA 1LXFC 5K89A 5I2LA 2JWWA 4AOMA 1CM4A 3OB1B 5ER5A 1M31A 1XFWO 3EKHA 4OR9B 4C0KA 2KYCA 5IBWA 1B9AA 1AUIB 2OTGB 4WQ3A 4L9MA 2KBMA 4DRWA 1KSOA 1DVIA 5F6TA 1A4PA 1OSAA 2M3WA 1VRKA 1C7VA 2Y4QA 3BUOB 2I18A 1DMOA 4CLNA 1ZMZA 1Y0VH 2K7CA 1L2OB 2JTTA 2OPOA 1V1FA 4OV2A 1YUUA 2KGBC 4N1GA 1QX7A 2JU0A 2JTZA 2F3YA 3D0YB 1V1GA 3KEVA 1G8IA 1Y1UA 5HLVA 1ZUZA 1R6PA 2ISDA 2B1UA 2KFFA 4GNKB 2JNFA 2KQ6A 1NWDA 3WNXB 5AERA 1CLMA 4N5XA 2KFGA 1EG4A 2KSPA 2PALA 3DVMA 3WHUB 3O2PA 2D8NA 1KK7Y 2JOJA 1DJXA 1CB1A 2ZNEA 3DD4A 1JBAA 5HKWA 3LK0A 1EH2A 1SR6C 2JULA 1PK0D 1M46A 1OZSA 4YBHB 2O5GA 4ORAB 1BR1B 3EVRA 1FBVA 3FWBA 2ZRTA 1F4QA 2LUCA 2TN4A 1DJYA 3TS5B 5BPJA 4ORBB 3SG3A 4D1EA 1F70A 3K21A 1CKKA 4AQJA 1SRAA 2LE9B 5AXIA 1WY9A 1B7TZ 1FF1A 1S6CA 2LNKA 4HRHA 1G33A 2JC2A 2KOTA 1BLQA 3KF9A 2FCEA 3IQQA 3O78A 3FIAA 3CZTX 3AAKA 1NX0A 2AUCA 2OS8C 3NSIA 2MRDA 1NPQA 2JQ6A 4TNCA 5J3XA 3DF0B 4JQ0D 1QXPA 1N65A 2L5XB 3GK1A 3PFVA 4MRYA 1S1EA 4E68A 1WDCB 1J7PA 1F71A 1YUSA 1IH0A 1CDNA 1QASA 2SCPA 3GK2A 1NIWA 3IF7A 2M1UA 3VROA 5JOLA 3BXKA 1SCMB 3LLEA 4DCKA 2HF5A 2M7LA 3PATA 1S5GY 1YUTA 4U8DA 1LINA 2LUXA 1N2DA 1NP8A 2K2AA 2IS9A 1QVIZ 1OMVA 1UWOA 2L98A 2LCPA 1QLSA 2LP3A 1RWYA 2H61C 2M9GA 2WORA 1S5GZ 1SPYA 2L4HA 4PHMA 4P5OE 2LHIA 3CWGA 3DVJA 2KHNA 2K2FA 1WRZA 1LA3A 4NDBA 1ZOTB 1K2HA 1KWOB 3TDZA 4IL1A 1JF0A 1KFXS 1QATA 1CLLA 1QJTA 1QTXA 1UHNA 1XK4A 2NLNA 3LK1A 4HRGA 4I5LB 2LMUA 4NDCA 2G9BA 2M7NA 2WC8A 1IRJA 1AVSA 3RM1A 1HT9A 3VRPA 1XFZO 1CNPA 4CIDA 1SNLA 1F55A 1A2XA 1DGVA 4GBAA 5D7FA 1NSHA 1JSAA 1CFFA 1F4OA 2ZRSA 1IGVA 4BY4A 1BF5A 1A75A 3PM8A 3WHTB 4AQIA 1J7OA 2GGMA 2EC6B 3EK8A 3TZ1A 1J55A 2KI4C 3JVTB 1A29A 4I5KA 1SY9A 4MBEA 1S6IA 2BE6A 1YTZC 3CS1A 3OP0A 1A75B 1KK7Z 2BBNA 1UHJA 1PULA 1EXRA 4A4BA 4NDDA 1JFKA 2K0JA 2LAPA 2Y1MA 4WQ2A 3PLFB 2L50A 2CT9A 1UHHA 3EVUA 4PE4A 1CLBA 1K9PA 3TUYC 1ZFSA 5HLOA 1YURA 2JT3A 1EL4A 1UURA 2BECA 5CPVA 4DUQA 2BCXA 2LHLA 2PRUA 1TNQA 3LCPC 1NX3A 1S26D 3MSEB 3I5HB 3O4YA 2LVVA 2NCOA 1KK8B 2LLSA 2LVJA 4FTGA 1XYDA 1SW8A 3PN7B 2JXLA 1IG5A 2ZNDA 1MQ1A 3A4UB 1TIZA 1U5IA 4GAOA 4C0JA 5CSFA 3BOWB 1QV1A 2OS8B 4PALA 3IQOA 1NX1A 2R2IA 3NSOA 2LANA 1BODA 1CMGA 1WLMA 1OMRA 1NCYA 1B8CA 3CR5X 3I5FB 1AJ4A 1XK4C 3SIAA 1RK9A 2KI6C 1SCVA 2BCAA 1RFJA 1IQ3A 2CNPA 1J7QA 1K95A 1GJYA 1H8BA 1LVCD 4MSPA 4MZLA 1AHRA 2K7OA 1UP5A 2KFHA 2QACA 4ZCUA 2NCPA 1FI6A 2KAXA 2PMYA 2WCFA 1E8AA 3F45A 4MEWA 4USLA 4F0ZB 1CFPA 4DS7A 3I5IC 2BE4A 2NZ0A 4MRXA 3C1VA 4PE7A 4ZCVA 1DJHA 3PSRA 1Y1AA 2Q4UA 5KSZA 3JTDC 2L4IA 5PALA 1ZACA 1XFUO 2K7DA 2K61A 2L51A 2PVBA 4YRUA 5I8NA 1H4BA 1NUBA 4QJ3B 1W7IB 1J1EA 2F2OA 4M2OA 1TCOB 4I5NB 1DT7B 1J7RA 2KI6D 2PSRA 2WCBA 1B47A 1CFCA 1XO5A 2L0PA 3RLZA 1IQ5A 4PCWA 4MZJA 5TNCA 4YGCB 2MHHA 3HCMA 5CSNA 1PVBA 1CDLA 1IWQA 1YRTB 1F8HA 2LM5A 3BUWB 2MAZA 4HREE 4YI8A 2JZIA 1J1DA 1DF0B 1PALA 1BOCA 2E30A 1EJ3A 1KFXL 3I5GB 3GK4X 2WOSA 1LKJA 1YR5A 1Q80A 3D10A 1MXLC 2LMVA 3DF0A 1XVJA 1L7ZA 2ZKMX 4OKHA 2LP2A 1CTRA 5AFPA 2ZN9A 2LC5A 4DIRA 4QJ4B 1QIWA 3BUXB 1MXEA 1CMFA 1IJ5A 1M63B 3CR4X 3OHMB 1K94A 2KNEA 4MLWA 3QRXA 2A4JA 3BUMB 5CSIA 2CXJA 1N0YA 1R2UA 1OZOA 1SBJA 2CCMA 2HQ8A 2ZFDA 2BKIB 1KWOC 1D1OA 1PVAA 1FW4A 1TRFA 3EVVA 1XFXO 3AKBA 3KPXA 2LMTA 3FWCA 4ETOA 1SL7A 2JNXA 3ZWHA 3FS7A 2BL0B 1KSMA 3TDUA 1SYMA 3AKAA 2I94A 4GGNA 1KK8C 2K7BA 1K93D 1QV0A 1GGWA 1QVIY 2M1KB 4ORCB 1RECA 2BKHB 2HETA 2F3ZA 4NQGA 2MLEC 3PALA 2ZN8A 1SKTA 2EHBA 1W7JB 2JT0A 5G08A 4FQOA 1S3PA 2AMIA 3GOFA 4XYNA 1RJVA 1X02A 3CLNA 3D0YA 3TDIA 4GPLB 1NCXA 3CTNA 1HQVA 4CFQA 1NX2A 4CFRA 2Y5IA 1PSBA 4PHNA 2KAVA 1UHIA 2KDHA 1YX7A 2I2RE 1G4YR 1QX2A 4HSZA 1QLKA 4XJKA 2M49B 3VRRA 1UUSA 4Q04A 4PDZA 3CR2A 1WRLA 3NXAA 3DVKA 5FYXA 1FPWA 4YGDB 3SG2A 1C7WA 1ODBA 1NYAA 3VRNA 2LLUA 4BY5A 2K8MB 1QS7A 2JT8A 2MJWB 3E3RA 2OTGC 5HKYA 4GFTA 3I5HC 3NSKA 4PHKA 5DKNA 1KQMC 1BU3A 1M39A 1TNWA 3TS5C 1DJZA 3JTDB 3DVEA 1MWNA 1YVHA 2LVKA 1LA0A 2Q91A 2Y1NA 1JC2A 1QX5B 1JWDA 2RGIA 3SG6A 1L2OC 1WLZA 2KAYA 4PE1A 5JJGA 4YGEB 1B8LA 1OOJA 1CDPA 3M0WA 2FCDA 1JFJA 1DF0A 4M2PA 1DGUA 2QPTA 1KFUS 1BJFA 2P6BB 2F2PA 3ZNIA 1TCFA 1Y1XA 2GGZA 4GGFC 2E6WA 1DJWA 1XA5A 3HX4A 3KHEA 2BCBA 2DOQA 3BOWA 4YGBB 1B8RA 1YVLA 2H2KA 1GQMA 2MLFC 5B8IB 1IKUA 1SR6B 3OX6A 1ALWA 3OX5A 3SG7A 2FJUB 3VGOA 1RROA 3CGAA 1MF8B 1PRWA 4R1EA 3SG5A 1BR4B 2MBXA 1AK8A 2KYFA 1ALVA 3OB2B 4CPVA 4JWQA 1SMGA 1S36A 1YX8A 4ICBA 2V53A 2LVIA 2I7AA 2M29A 5AEQA 1SK6D 1DJGA 5KU1A 4M2QA 1SL8A 3BQ3A 2KQYA 2F8PA 1XFVO 5HYDA 1PSRA 5KTYA 1KCYA 4A4CA 1MR8A 1TNPA 1BG1A 1KQVA 1XFYO 2KBIA 3EK4A 2CTNA 1B4CA 4N1FA 5AANA 4I5JA 4OCIA 5HKZA 1FI5A 3WXAA 3BUNB 5I2QA 2VRGA 2PASA 3I5GC 2NXQA 1TN4A 2KGRA 3KO0A 2SASA 4QJ5B 1C07A 1OQPA 1U5IB 1A03A 1QIVA 1DTLA 2AAOA 2F33A 3AAJA 4MN0A 3PN7C 3I5IB 1EG3A 1JF2A 3A8RA 4UPGA 1B7TY 1GGZA 1CDMA 2KI4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ6 A;  2L2E A;  4YI9 A;  5GQQ C;  1NCZ A;  2JXC A;  4JPZ B;  2WCE A;  2O60 A;  2JRF A;  3SG4 A;  2FOT A;  2H61 A;  2EGD A;  5D69 A;  1SL9 A;  4GGF A;  3H4S E;  1WRK A;  3LL8 B;  1Y6W A;  3NSL A;  2WND A;  4C0L A;  2M8U A;  4MZK A;  1AJ5 A;  2MA2 A;  1K9K A;  1TNX A;  4WRI A;  2JPT A;  3ICB A;  1TTX A;  1MHO A;  4GUK A;  3TUY B;  3SJS A;  1CM1 A;  1OMD A;  2HPS A;  2BL0 C;  2M0R A;  3VRQ A;  1AP4 A;  1KQM B;  1K8U A;  1CFD A;  2LLT A;  3EK7 A;  1TOP A;  5I2O A;  4P2Y B;  2BBM A;  1BMO A;  2M97 A;  4YGA A;  5ER4 X;  4XJK B;  1B1G A;  2HQW A;  1F54 A;  2GV5 A;  1S6J A;  1WDC C;  4PE0 A;  5DKR A;  3SIB A;  4PHJ A;  1BT6 A;  3BYA A;  2CBL A;  2LV7 A;  1YRU B;  1M45 A;  4OVN F;  1RTP 1;  2EC6 C;  5CSJ A;  2G2B A;  1KFU L;  2COL B;  5DKQ A;  1MUX A;  1K90 D;  1OE9 B;  1SCM C;  1UHK A;  3EKJ A;  4MVF A;  3O6B A;  3JVT C;  1K9U A;  1JUO A;  3I5F C;  1K96 A;  1DJI A;  1LXF C;  5K89 A;  5I2L A;  2JWW A;  4AOM A;  1CM4 A;  3OB1 B;  5ER5 A;  1M31 A;  1XFW O;  3EKH A;  4OR9 B;  4C0K A;  2KYC A;  5IBW A;  1B9A A;  1AUI B;  2OTG B;  4WQ3 A;  4L9M A;  2KBM A;  4DRW A;  1KSO A;  1DVI A;  5F6T A;  1A4P A;  1OSA A;  2M3W A;  1VRK A;  1C7V A;  2Y4Q A;  3BUO B;  2I18 A;  1DMO A;  4CLN A;  1ZMZ A;  1Y0V H;  2K7C A;  1L2O B;  2JTT A;  2OPO A;  1V1F A;  4OV2 A;  1YUU A;  2KGB C;  4N1G A;  1QX7 A;  2JU0 A;  2JTZ A;  2F3Y A;  3D0Y B;  1V1G A;  3KEV A;  1G8I A;  1Y1U A;  5HLV A;  1ZUZ A;  1R6P A;  2ISD A;  2B1U A;  2KFF A;  4GNK B;  2JNF A;  2KQ6 A;  1NWD A;  3WNX B;  5AER A;  1CLM A;  4N5X A;  2KFG A;  1EG4 A;  2KSP A;  2PAL A;  3DVM A;  3WHU B;  3O2P A;  2D8N A;  1KK7 Y;  2JOJ A;  1DJX A;  1CB1 A;  2ZNE A;  3DD4 A;  1JBA A;  5HKW A;  3LK0 A;  1EH2 A;  1SR6 C;  2JUL A;  1PK0 D;  1M46 A;  1OZS A;  4YBH B;  2O5G A;  4ORA B;  1BR1 B;  3EVR A;  1FBV A;  3FWB A;  2ZRT A;  1F4Q A;  2LUC A;  2TN4 A;  1DJY A;  3TS5 B;  5BPJ A;  4ORB B;  3SG3 A;  4D1E A;  1F70 A;  3K21 A;  1CKK A;  4AQJ A;  1SRA A;  2LE9 B;  5AXI A;  1WY9 A;  1B7T Z;  1FF1 A;  1S6C A;  2LNK A;  4HRH A;  1G33 A;  2JC2 A;  2KOT A;  1BLQ A;  3KF9 A;  2FCE A;  3IQQ A;  3O78 A;  3FIA A;  3CZT X;  3AAK A;  1NX0 A;  2AUC A;  2OS8 C;  3NSI A;  2MRD A;  1NPQ A;  2JQ6 A;  4TNC A;  5J3X A;  3DF0 B;  4JQ0 D;  1QXP A;  1N65 A;  2L5X B;  3GK1 A;  3PFV A;  4MRY A;  1S1E A;  4E68 A;  1WDC B;  1J7P A;  1F71 A;  1YUS A;  1IH0 A;  1CDN A;  1QAS A;  2SCP A;  3GK2 A;  1NIW A;  3IF7 A;  2M1U A;  3VRO A;  5JOL A;  3BXK A;  1SCM B;  3LLE A;  4DCK A;  2HF5 A;  2M7L A;  3PAT A;  1S5G Y;  1YUT A;  4U8D A;  1LIN A;  2LUX A;  1N2D A;  1NP8 A;  2K2A A;  2IS9 A;  1QVI Z;  1OMV A;  1UWO A;  2L98 A;  2LCP A;  1QLS A;  2LP3 A;  1RWY A;  2H61 C;  2M9G A;  2WOR A;  1S5G Z;  1SPY A;  2L4H A;  4PHM A;  4P5O E;  2LHI A;  3CWG A;  3DVJ A;  2KHN A;  2K2F A;  1WRZ A;  1LA3 A;  4NDB A;  1ZOT B;  1K2H A;  1KWO B;  3TDZ A;  4IL1 A;  1JF0 A;  1KFX S;  1QAT A;  1CLL A;  1QJT A;  1QTX A;  1UHN A;  1XK4 A;  2NLN A;  3LK1 A;  4HRG A;  4I5L B;  2LMU A;  4NDC A;  2G9B A;  2M7N A;  2WC8 A;  1IRJ A;  1AVS A;  3RM1 A;  1HT9 A;  3VRP A;  1XFZ O;  1CNP A;  4CID A;  1SNL A;  1F55 A;  1A2X A;  1DGV A;  4GBA A;  5D7F A;  1NSH A;  1JSA A;  1CFF A;  1F4O A;  2ZRS A;  1IGV A;  4BY4 A;  1BF5 A;  1A75 A;  3PM8 A;  3WHT B;  4AQI A;  1J7O A;  2GGM A;  2EC6 B;  3EK8 A;  3TZ1 A;  1J55 A;  2KI4 C;  3JVT B;  1A29 A;  4I5K A;  1SY9 A;  4MBE A;  1S6I A;  2BE6 A;  1YTZ C;  3CS1 A;  3OP0 A;  1A75 B;  1KK7 Z;  2BBN A;  1UHJ A;  1PUL A;  1EXR A;  4A4B A;  4NDD A;  1JFK A;  2K0J A;  2LAP A;  2Y1M A;  4WQ2 A;  3PLF B;  2L50 A;  2CT9 A;  1UHH A;  3EVU A;  4PE4 A;  1CLB A;  1K9P A;  3TUY C;  1ZFS A;  5HLO A;  1YUR A;  2JT3 A;  1EL4 A;  1UUR A;  2BEC A;  5CPV A;  4DUQ A;  2BCX A;  2LHL A;  2PRU A;  1TNQ A;  3LCP C;  1NX3 A;  1S26 D;  3MSE B;  3I5H B;  3O4Y A;  2LVV A;  2NCO A;  1KK8 B;  2LLS A;  2LVJ A;  4FTG A;  1XYD A;  1SW8 A;  3PN7 B;  2JXL A;  1IG5 A;  2ZND A;  1MQ1 A;  3A4U B;  1TIZ A;  1U5I A;  4GAO A;  4C0J A;  5CSF A;  3BOW B;  1QV1 A;  2OS8 B;  4PAL A;  3IQO A;  1NX1 A;  2R2I A;  3NSO A;  2LAN A;  1BOD A;  1CMG A;  1WLM A;  1OMR A;  1NCY A;  1B8C A;  3CR5 X;  3I5F B;  1AJ4 A;  1XK4 C;  3SIA A;  1RK9 A;  2KI6 C;  1SCV A;  2BCA A;  1RFJ A;  1IQ3 A;  2CNP A;  1J7Q A;  1K95 A;  1GJY A;  1H8B A;  1LVC D;  4MSP A;  4MZL A;  1AHR A;  2K7O A;  1UP5 A;  2KFH A;  2QAC A;  4ZCU A;  2NCP A;  1FI6 A;  2KAX A;  2PMY A;  2WCF A;  1E8A A;  3F45 A;  4MEW A;  4USL A;  4F0Z B;  1CFP A;  4DS7 A;  3I5I C;  2BE4 A;  2NZ0 A;  4MRX A;  3C1V A;  4PE7 A;  4ZCV A;  1DJH A;  3PSR A;  1Y1A A;  2Q4U A;  5KSZ A;  3JTD C;  2L4I A;  5PAL A;  1ZAC A;  1XFU O;  2K7D A;  2K61 A;  2L51 A;  2PVB A;  4YRU A;  5I8N A;  1H4B A;  1NUB A;  4QJ3 B;  1W7I B;  1J1E A;  2F2O A;  4M2O A;  1TCO B;  4I5N B;  1DT7 B;  1J7R A;  2KI6 D;  2PSR A;  2WCB A;  1B47 A;  1CFC A;  1XO5 A;  2L0P A;  3RLZ A;  1IQ5 A;  4PCW A;  4MZJ A;  5TNC A;  4YGC B;  2MHH A;  3HCM A;  5CSN A;  1PVB A;  1CDL A;  1IWQ A;  1YRT B;  1F8H A;  2LM5 A;  3BUW B;  2MAZ A;  4HRE E;  4YI8 A;  2JZI A;  1J1D A;  1DF0 B;  1PAL A;  1BOC A;  2E30 A;  1EJ3 A;  1KFX L;  3I5G B;  3GK4 X;  2WOS A;  1LKJ A;  1YR5 A;  1Q80 A;  3D10 A;  1MXL C;  2LMV A;  3DF0 A;  1XVJ A;  1L7Z A;  2ZKM X;  4OKH A;  2LP2 A;  1CTR A;  5AFP A;  2ZN9 A;  2LC5 A;  4DIR A;  4QJ4 B;  1QIW A;  3BUX B;  1MXE A;  1CMF A;  1IJ5 A;  1M63 B;  3CR4 X;  3OHM B;  1K94 A;  2KNE A;  4MLW A;  3QRX A;  2A4J A;  3BUM B;  5CSI A;  2CXJ A;  1N0Y A;  1R2U A;  1OZO A;  1SBJ A;  2CCM A;  2HQ8 A;  2ZFD A;  2BKI B;  1KWO C;  1D1O A;  1PVA A;  1FW4 A;  1TRF A;  3EVV A;  1XFX O;  3AKB A;  3KPX A;  2LMT A;  3FWC A;  4ETO A;  1SL7 A;  2JNX A;  3ZWH A;  3FS7 A;  2BL0 B;  1KSM A;  3TDU A;  1SYM A;  3AKA A;  2I94 A;  4GGN A;  1KK8 C;  2K7B A;  1K93 D;  1QV0 A;  1GGW A;  1QVI Y;  2M1K B;  4ORC B;  1REC A;  2BKH B;  2HET A;  2F3Z A;  4NQG A;  2MLE C;  3PAL A;  2ZN8 A;  1SKT A;  2EHB A;  1W7J B;  2JT0 A;  5G08 A;  4FQO A;  1S3P A;  2AMI A;  3GOF A;  4XYN A;  1RJV A;  1X02 A;  3CLN A;  3D0Y A;  3TDI A;  4GPL B;  1NCX A;  3CTN A;  1HQV A;  4CFQ A;  1NX2 A;  4CFR A;  2Y5I A;  1PSB A;  4PHN A;  2KAV A;  1UHI A;  2KDH A;  1YX7 A;  2I2R E;  1G4Y R;  1QX2 A;  4HSZ A;  1QLK A;  4XJK A;  2M49 B;  3VRR A;  1UUS A;  4Q04 A;  4PDZ A;  3CR2 A;  1WRL A;  3NXA A;  3DVK A;  5FYX A;  1FPW A;  4YGD B;  3SG2 A;  1C7W A;  1ODB A;  1NYA A;  3VRN A;  2LLU A;  4BY5 A;  2K8M B;  1QS7 A;  2JT8 A;  2MJW B;  3E3R A;  2OTG C;  5HKY A;  4GFT A;  3I5H C;  3NSK A;  4PHK A;  5DKN A;  1KQM C;  1BU3 A;  1M39 A;  1TNW A;  3TS5 C;  1DJZ A;  3JTD B;  3DVE A;  1MWN A;  1YVH A;  2LVK A;  1LA0 A;  2Q91 A;  2Y1N A;  1JC2 A;  1QX5 B;  1JWD A;  2RGI A;  3SG6 A;  1L2O C;  1WLZ A;  2KAY A;  4PE1 A;  5JJG A;  4YGE B;  1B8L A;  1OOJ A;  1CDP A;  3M0W A;  2FCD A;  1JFJ A;  1DF0 A;  4M2P A;  1DGU A;  2QPT A;  1KFU S;  1BJF A;  2P6B B;  2F2P A;  3ZNI A;  1TCF A;  1Y1X A;  2GGZ A;  4GGF C;  2E6W A;  1DJW A;  1XA5 A;  3HX4 A;  3KHE A;  2BCB A;  2DOQ A;  3BOW A;  4YGB B;  1B8R A;  1YVL A;  2H2K A;  1GQM A;  2MLF C;  5B8I B;  1IKU A;  1SR6 B;  3OX6 A;  1ALW A;  3OX5 A;  3SG7 A;  2FJU B;  3VGO A;  1RRO A;  3CGA A;  1MF8 B;  1PRW A;  4R1E A;  3SG5 A;  1BR4 B;  2MBX A;  1AK8 A;  2KYF A;  1ALV A;  3OB2 B;  4CPV A;  4JWQ A;  1SMG A;  1S36 A;  1YX8 A;  4ICB A;  2V53 A;  2LVI A;  2I7A A;  2M29 A;  5AEQ A;  1SK6 D;  1DJG A;  5KU1 A;  4M2Q A;  1SL8 A;  3BQ3 A;  2KQY A;  2F8P A;  1XFV O;  5HYD A;  1PSR A;  5KTY A;  1KCY A;  4A4C A;  1MR8 A;  1TNP A;  1BG1 A;  1KQV A;  1XFY O;  2KBI A;  3EK4 A;  2CTN A;  1B4C A;  4N1F A;  5AAN A;  4I5J A;  4OCI A;  5HKZ A;  1FI5 A;  3WXA A;  3BUN B;  5I2Q A;  2VRG A;  2PAS A;  3I5G C;  2NXQ A;  1TN4 A;  2KGR A;  3KO0 A;  2SAS A;  4QJ5 B;  1C07 A;  1OQP A;  1U5I B;  1A03 A;  1QIV A;  1DTL A;  2AAO A;  2F33 A;  3AAJ A;  4MN0 A;  3PN7 C;  3I5I B;  1EG3 A;  1JF2 A;  3A8R A;  4UPG A;  1B7T Y;  1GGZ A;  1CDM A;  2KI4 B; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  3D75 A;  2L2E A;  4YI9 A;  5GQQ C;  1NCZ A;  2JXC A;  4JPZ B;  2WCE A;  2O60 A;  2JRF A;  3SG4 A;  2FOT A;  2H61 A;  2EGD A;  5D69 A;  1SL9 A;  4GGF A;  3H4S E;  1WRK A;  3LL8 B;  1Y6W A;  3NSL A;  2WND A;  4C0L A;  2M8U A;  4MZK A;  1AJ5 A;  2MA2 A;  1K9K A;  1TNX A;  1DEL A;  2JPT A;  3CZ2 A;  3Q8I A;  4WRI A;  3ICB A;  1TTX A;  1MHO A;  4GUK A;  3TUY B;  3SJS A;  1CM1 A;  1OMD A;  1Z2C B;  2HPS A;  2BL0 C;  2M0R A;  3VRQ A;  1AP4 A;  1KQM B;  1K8U A;  1CFD A;  2LLT A;  3EK7 A;  5D3O A;  1TOP A;  5I2O A;  4P2Y B;  2BBM A;  1BMO A;  2M97 A;  4YGA A;  5ER4 X;  4XJK B;  1B1G A;  2HQW A;  1F54 A;  2GV5 A;  1S6J A;  1WDC C;  3FE6 A;  4PE0 A;  5DKR A;  3SIB A;  4PHJ A;  1BT6 A;  2KLD A;  3BYA A;  4INW A;  2CBL A;  2LV7 A;  1YRU B;  1M45 A;  4OVN F;  1RTP 1;  2EC6 C;  5CSJ A;  2G2B A;  1KFU L;  2COL B;  5DKQ A;  1MUX A;  1K90 D;  1OE9 B;  1OOH A;  1DQE A;  1OOG A;  1SCM C;  1UHK A;  3EKJ A;  3R72 A;  4MVF A;  3O6B A;  3JVT C;  1K9U A;  1JUO A;  3I5F C;  1K96 A;  1DJI A;  1LXF C;  4F7F A;  5K89 A;  5I2L A;  2JWW A;  4AOM A;  1CM4 A;  3OB1 B;  3CYZ A;  1M31 A;  5ER5 A;  2BNX A;  1IIO A;  1XFW O;  3EKH A;  2JPO A;  4OR9 B;  2KYC A;  4C0K A;  5IBW A;  1B9A A;  3UNW A;  1AUI B;  2OTG B;  4WQ3 A;  3S0D A;  3D77 A;  4L9M A;  2KBM A;  2WCJ A;  3D78 A;  4DRW A;  1T14 A;  2P70 A;  1KSO A;  1DVI A;  5F6T A;  1A4P A;  1OSA A;  2M3W A;  1VRK A;  1C7V A;  2QEO A;  2Y4Q A;  3BUO B;  2I18 A;  1DMO A;  3S0E A;  4CLN A;  1ZMZ A;  1Y0V H;  2K7C A;  1L2O B;  2JTT A;  2OPO A;  1V1F A;  4OV2 A;  1YUU A;  2KGB C;  4N1G A;  1QX7 A;  2JU0 A;  2JTZ A;  3FE8 A;  3VB1 A;  2F3Y A;  3D0Y B;  1V1G A;  3KEV A;  1G8I A;  1Y1U A;  5HLV A;  1ZUZ A;  2WCM A;  2QEB A;  1R6P A;  2ISD A;  2B1U A;  2KFF A;  4GNK B;  2JNF A;  2KQ6 A;  1NWD A;  3WNX B;  5AER A;  1CLM A;  4N5X A;  2KFG A;  1EG4 A;  2KSP A;  2PAL A;  3DVM A;  3WHU B;  3O2P A;  2D8N A;  3S0G A;  1C3Z A;  1KK7 Y;  2JOJ A;  1DJX A;  2H8V A;  1CB1 A;  2ZNE A;  3DD4 A;  1JBA A;  5HKW A;  3LK0 A;  1EH2 A;  1SR6 C;  2JUL A;  1PK0 D;  1M46 A;  1OZS A;  4YBH B;  2O5G A;  4ORA B;  1BR1 B;  3EVR A;  1FBV A;  3FWB A;  2ZRT A;  1F4Q A;  3D76 A;  2LUC A;  2TN4 A;  1DJY A;  3TS5 B;  5BPJ A;  4ORB B;  3SG3 A;  3QME A;  4D1E A;  1F70 A;  3K21 A;  2L5Y A;  1CKK A;  4AQJ A;  2QDI A;  2KLE A;  1SRA A;  2LE9 B;  5AXI A;  1WY9 A;  1B7T Z;  1FF1 A;  3DY9 A;  1S6C A;  2LNK A;  4HRH A;  1G33 A;  2JC2 A;  2KOT A;  1BLQ A;  3KF9 A;  2FCE A;  3IQQ A;  3O78 A;  3FIA A;  3CZT X;  3N7H A;  1P28 A;  1NX0 A;  3AAK A;  2AUC A;  2OS8 C;  3NSI A;  2MRD A;  1NPQ A;  2JQ6 A;  4TNC A;  5J3X A;  3DF0 B;  4JQ0 D;  3IVT A;  3DZT A;  1QXP A;  1N65 A;  2L5X B;  3GK1 A;  3NHI A;  3PFV A;  3PJI A;  4MRY A;  1S1E A;  4PT1 A;  4E68 A;  1WDC B;  1J7P A;  1F71 A;  3B6X A;  1YUS A;  1IH0 A;  1CDN A;  1QAS A;  2SCP A;  3GK2 A;  1NIW A;  3IF7 A;  2M1U A;  3VRO A;  5JOL A;  3BXK A;  1SCM B;  1TUZ A;  3LLE A;  4DCK A;  2HF5 A;  2M7L A;  3PAT A;  1S5G Y;  1YUT A;  4U8D A;  1LIN A;  2LUX A;  1N2D A;  1NP8 A;  2K2A A;  2IS9 A;  1QVI Z;  1OMV A;  1UWO A;  1TWO A;  2L98 A;  1QLS A;  2LCP A;  1RWY A;  2H61 C;  2LP3 A;  2M9G A;  2WOR A;  5I94 A;  1S5G Z;  1SPY A;  2L4H A;  4PHM A;  4P5O E;  2LHI A;  3CWG A;  3DVJ A;  2KHN A;  2K2F A;  1WRZ A;  1LA3 A;  4NDB A;  2WCK A;  1ZOT B;  1K2H A;  1KWO B;  2QEH A;  2WC6 A;  3TDZ A;  4IL1 A;  1JF0 A;  1KFX S;  1QAT A;  1CLL A;  1QJT A;  1QTX A;  1UHN A;  1XK4 A;  2NLN A;  3LK1 A;  4HRG A;  4I5L B;  2LMU A;  4NDC A;  2G9B A;  2L2C A;  2M7N A;  2WC8 A;  1IRJ A;  1AVS A;  3RM1 A;  1HT9 A;  3VRP A;  1XFZ O;  3NGV A;  1CNP A;  4CID A;  3K1E A;  1SNL A;  1F55 A;  4INX A;  1A2X A;  1DGV A;  4GBA A;  5D7F A;  1NSH A;  3SS3 A;  1JSA A;  1CFF A;  1F4O A;  2P71 A;  2ZRS A;  1IGV A;  4BY4 A;  1BF5 A;  1A75 A;  3BFA A;  3PM8 A;  3WHT B;  4AQI A;  1J7O A;  2GGM A;  2EC6 B;  3EK8 A;  3TZ1 A;  3SS4 A;  1J55 A;  2KI4 C;  3JVT B;  2KPH A;  1A29 A;  4I5K A;  3D73 A;  1SY9 A;  4MBE A;  1OW4 A;  1S6I A;  2BE6 A;  1YTZ C;  3CS1 A;  3OP0 A;  1A75 B;  1KK7 Z;  2BBN A;  1UHJ A;  3OGN A;  2PQL A;  1PUL A;  1EXR A;  4A4B A;  4NDD A;  1JFK A;  2K0J A;  2LAP A;  2Y1M A;  1GM0 A;  4WQ2 A;  3PLF B;  2L50 A;  2CT9 A;  1UHH A;  3EVU A;  4PE4 A;  1CLB A;  1K9P A;  3TUY C;  3FE9 A;  1ZFS A;  5HLO A;  1YUR A;  2JT3 A;  1EL4 A;  1UUR A;  2BEC A;  5CPV A;  4DUQ A;  2BCX A;  2LHL A;  2PRU A;  1TNQ A;  3LCP C;  3V2L A;  1NX3 A;  1S26 D;  2WCL A;  3MSE B;  1DC1 A;  3I5H B;  3O4Y A;  2LVV A;  2NCO A;  1KK8 B;  1QWV A;  2LLS A;  2LVJ A;  4FTG A;  3DYE A;  1XYD A;  1SW8 A;  3PN7 B;  2JXL A;  3R1O A;  1IG5 A;  2ZND A;  1MQ1 A;  3A4U B;  1TIZ A;  1U5I A;  4GAO A;  4C0J A;  5CSF A;  3BOW B;  1QV1 A;  3SS5 A;  1C3Y A;  2OS8 B;  4PAL A;  3IQO A;  1NX1 A;  2R2I A;  3NSO A;  2LAN A;  1BOD A;  1CMG A;  1WLM A;  1OMR A;  1NCY A;  1B8C A;  2GTE A;  3CR5 X;  3I5F B;  5FI7 A;  3L4A A;  1AJ4 A;  1XK4 C;  3SIA A;  1RK9 A;  2KI6 C;  1SCV A;  2BCA A;  1RFJ A;  3CZ0 A;  1IQ3 A;  2CNP A;  1J7Q A;  1K95 A;  1GJY A;  1H8B A;  1LVC D;  4MSP A;  4MZL A;  1AHR A;  3DXL A;  2K7O A;  1UP5 A;  2KFH A;  2QAC A;  3OBV A;  2NCP A;  4ZCU A;  3S0A A;  1FI6 A;  2KAX A;  2PMY A;  2WCF A;  1E8A A;  3B88 A;  3F45 A;  4MEW A;  4USL A;  4F0Z B;  4DS7 A;  1CFP A;  3I5I C;  2BE4 A;  2NZ0 A;  4MRX A;  3C1V A;  3RZS A;  4PE7 A;  1Z4H A;  4ZCV A;  1DJH A;  3PSR A;  1Y1A A;  2Q4U A;  5KSZ A;  1ORG A;  3JTD C;  3B86 A;  2L4I A;  5PAL A;  3S0F A;  1ZAC A;  1XFU O;  2K7D A;  2K61 A;  2L51 A;  2PVB A;  4YRU A;  5EL2 A;  5I8N A;  1H4B A;  1NUB A;  4QJ3 B;  1W7I B;  1J1E A;  2F2O A;  4M2O A;  1TCO B;  4I5N B;  1DT7 B;  1J7R A;  2KI6 D;  2PSR A;  2WCB A;  1B47 A;  3BFH A;  2FJY A;  1CFC A;  1XO5 A;  2L0P A;  3RLZ A;  1IQ5 A;  4PCW A;  4MZJ A;  5TNC A;  4YGC B;  2MHH A;  3HCM A;  5CSN A;  1PVB A;  1CDL A;  5HL1 A;  1IWQ A;  1YRT B;  1F8H A;  2LM5 A;  3BUW B;  2MAZ A;  4HRE E;  4YI8 A;  2JZI A;  1J1D A;  1DF0 B;  1PAL A;  1BOC A;  4JKT A;  2E30 A;  1EJ3 A;  1KFX L;  3I5G B;  3GK4 X;  2WOS A;  1LKJ A;  1YR5 A;  1Q80 A;  3D10 A;  1MXL C;  2LMV A;  3DF0 A;  1XVJ A;  1L7Z A;  2ZKM X;  4OKH A;  2LP2 A;  1CTR A;  5AFP A;  2ZN9 A;  2LC5 A;  4DIR A;  4QJ4 B;  2YGU A;  1QIW A;  3BUX B;  1MXE A;  1CMF A;  1IJ5 A;  1M63 B;  3CR4 X;  3OHM B;  1K94 A;  2KNE A;  4MLW A;  3QRX A;  2A4J A;  3BUM B;  5CSI A;  2CXJ A;  1N0Y A;  1R2U A;  1OZO A;  3R1V A;  1SBJ A;  2CCM A;  2HQ8 A;  2ZFD A;  2BKI B;  2PYQ A;  3PM2 A;  1KWO C;  1D1O A;  1PVA A;  1FW4 A;  1TRF A;  2QEV A;  3EVV A;  1XFX O;  3AKB A;  3KPX A;  2LMT A;  3FWC A;  4ETO A;  1SL7 A;  2JNX A;  3ZWH A;  3FS7 A;  2BL0 B;  1KSM A;  3TDU A;  1SYM A;  3AKA A;  2I94 A;  4GGN A;  1KK8 C;  2K7B A;  1K93 D;  1QV0 A;  1GGW A;  1QVI Y;  2M1K B;  4ORC B;  1REC A;  2BKH B;  2HET A;  2F3Z A;  4NQG A;  3O4X A;  2MLE C;  3PAL A;  2ZN8 A;  1SKT A;  2EHB A;  1W7J B;  2JT0 A;  5G08 A;  4FQO A;  1S3P A;  2AMI A;  3GOF A;  4XYN A;  1W9Z A;  1RJV A;  1X02 A;  3CLN A;  3D0Y A;  3TDI A;  4GPL B;  1NCX A;  3CTN A;  1HQV A;  4CFQ A;  1NX2 A;  1TUJ A;  4CFR A;  2Y5I A;  1PSB A;  4PHN A;  2KAV A;  1UHI A;  2KDH A;  1YX7 A;  2I2R E;  1G4Y R;  1QX2 A;  4HSZ A;  1QLK A;  4XJK A;  2M49 B;  3VRR A;  1UUS A;  2ERB A;  4Q04 A;  3B7A A;  1DEK A;  4PDZ A;  3CR2 A;  1WRL A;  3NXA A;  3CZ1 A;  2WC5 A;  3DVK A;  3BFB A;  5FYX A;  1FPW A;  4YGD B;  3SG2 A;  1C7W A;  1ODB A;  1NYA A;  3VRN A;  2LLU A;  4BY5 A;  5FI6 A;  2K8M B;  1QS7 A;  2JT8 A;  2MJW B;  3E3R A;  2OTG C;  5HKY A;  4GFT A;  3I5H C;  3NSK A;  4PHK A;  5DKN A;  1KQM C;  1BU3 A;  1M39 A;  1TNW A;  3TS5 C;  1DJZ A;  3JTD B;  3DVE A;  1MWN A;  1YVH A;  2LVK A;  1LA0 A;  1LS8 A;  2Q91 A;  2Y1N A;  1JC2 A;  1QX5 B;  1JWD A;  2RGI A;  3SG6 A;  1L2O C;  3NHT A;  3R1P A;  1WLZ A;  2KAY A;  4PE1 A;  5JJG A;  4YGE B;  1B8L A;  1OOJ A;  1CDP A;  1SSE B;  1OOF A;  3M0W A;  2FCD A;  3CDN A;  4FQT A;  1DF0 A;  1JFJ A;  4M2P A;  1DGU A;  1XFR A;  2QPT A;  3L4L A;  1KFU S;  4OZD A;  5FI2 A;  1BJF A;  2P6B B;  2F2P A;  3ZNI A;  1TCF A;  1Y1X A;  2GGZ A;  2K60 A;  2E6W A;  1DJW A;  1XA5 A;  4GGF C;  3HX4 A;  1OOI X;  3KHE A;  2BCB A;  2DOQ A;  3BOW A;  4YGB B;  1B8R A;  1YVL A;  2H2K A;  1GQM A;  2MLF C;  5B8I B;  1IKU A;  1SR6 B;  3OX6 A;  1ALW A;  3BJH A;  3B87 A;  3OX5 A;  3SG7 A;  2FJU B;  3UO9 A;  3VGO A;  1RRO A;  3CGA A;  4JD9 A;  1MF8 B;  1PRW A;  4R1E A;  3SG5 A;  1BR4 B;  2MBX A;  1AK8 A;  2KYF A;  1ALV A;  3OB2 B;  2BAP A;  4CPV A;  4JWQ A;  1SMG A;  1S36 A;  1YX8 A;  4ICB A;  2V53 A;  3D74 A;  2LVI A;  2I7A A;  2M29 A;  5AEQ A;  3EG5 B;  1SK6 D;  1DJG A;  5KU1 A;  4M2Q A;  1SL8 A;  3BQ3 A;  2KQY A;  1XFV O;  2F8P A;  5HYD A;  1PSR A;  5KTY A;  3L47 A;  1KCY A;  4A4C A;  1MR8 A;  1TNP A;  1BG1 A;  2WCH A;  1KQV A;  1XFY O;  2KBI A;  3EK4 A;  5DIC A;  2CTN A;  1B4C A;  4N1F A;  5AAN A;  4IJ7 A;  4I5J A;  4OCI A;  5HKZ A;  4KYN A;  1FI5 A;  3WXA A;  3BUN B;  5I2Q A;  2VRG A;  2PAS A;  3I5G C;  2NXQ A;  1TN4 A;  2KGR A;  3KO0 A;  2SAS A;  4QJ5 B;  1C07 A;  1OQP A;  1U5I B;  1A03 A;  1QIV A;  1DTL A;  2AAO A;  2F33 A;  3AAJ A;  4MN0 A;  3PN7 C;  3CAB A;  3S0B A;  3I5I B;  1EG3 A;  1JF2 A;  3A8R A;  4UPG A;  1B7T Y;  1GGZ A;  1CDM A;  2KI4 B; 
#chains in the Genus database with same CATH homology
 1IJ6 A;  2L2E A;  4YI9 A;  5GQQ C;  1NCZ A;  2JXC A;  4JPZ B;  2WCE A;  2O60 A;  2JRF A;  3SG4 A;  2FOT A;  2H61 A;  2EGD A;  5D69 A;  1SL9 A;  4GGF A;  3H4S E;  1WRK A;  3LL8 B;  1Y6W A;  3NSL A;  2WND A;  4C0L A;  2M8U A;  4MZK A;  1AJ5 A;  2MA2 A;  1K9K A;  1TNX A;  4WRI A;  2JPT A;  3ICB A;  1TTX A;  1MHO A;  4GUK A;  3TUY B;  3SJS A;  1CM1 A;  1OMD A;  2HPS A;  2BL0 C;  2M0R A;  3VRQ A;  1AP4 A;  1KQM B;  1K8U A;  1CFD A;  2LLT A;  3EK7 A;  1TOP A;  5I2O A;  4P2Y B;  2BBM A;  1BMO A;  2M97 A;  4YGA A;  5ER4 X;  4XJK B;  1B1G A;  2HQW A;  1F54 A;  2GV5 A;  1S6J A;  1WDC C;  4PE0 A;  5DKR A;  3SIB A;  4PHJ A;  1BT6 A;  3BYA A;  2CBL A;  2LV7 A;  1YRU B;  1M45 A;  4OVN F;  1RTP 1;  2EC6 C;  5CSJ A;  2G2B A;  1KFU L;  2COL B;  5DKQ A;  1MUX A;  1K90 D;  1OE9 B;  1SCM C;  1UHK A;  3EKJ A;  4MVF A;  3O6B A;  3JVT C;  1K9U A;  1JUO A;  3I5F C;  1K96 A;  1DJI A;  1LXF C;  5K89 A;  5I2L A;  2JWW A;  4AOM A;  1CM4 A;  3OB1 B;  5ER5 A;  1M31 A;  1XFW O;  3EKH A;  4OR9 B;  4C0K A;  2KYC A;  5IBW A;  1B9A A;  1AUI B;  2OTG B;  4WQ3 A;  4L9M A;  2KBM A;  4DRW A;  1KSO A;  1DVI A;  5F6T A;  1A4P A;  1OSA A;  2M3W A;  1VRK A;  1C7V A;  2Y4Q A;  3BUO B;  2I18 A;  1DMO A;  4CLN A;  1ZMZ A;  1Y0V H;  2K7C A;  1L2O B;  2JTT A;  2OPO A;  1V1F A;  4OV2 A;  1YUU A;  2KGB C;  4N1G A;  1QX7 A;  2JU0 A;  2JTZ A;  2F3Y A;  3D0Y B;  1V1G A;  3KEV A;  1G8I A;  1Y1U A;  5HLV A;  1ZUZ A;  1R6P A;  2ISD A;  2B1U A;  2KFF A;  4GNK B;  2JNF A;  2KQ6 A;  1NWD A;  3WNX B;  5AER A;  1CLM A;  4N5X A;  2KFG A;  1EG4 A;  2KSP A;  2PAL A;  3DVM A;  3WHU B;  3O2P A;  2D8N A;  1KK7 Y;  2JOJ A;  1DJX A;  1CB1 A;  2ZNE A;  3DD4 A;  1JBA A;  5HKW A;  3LK0 A;  1EH2 A;  1SR6 C;  2JUL A;  1PK0 D;  1M46 A;  1OZS A;  4YBH B;  2O5G A;  4ORA B;  1BR1 B;  3EVR A;  1FBV A;  3FWB A;  2ZRT A;  1F4Q A;  2LUC A;  2TN4 A;  1DJY A;  3TS5 B;  5BPJ A;  4ORB B;  3SG3 A;  4D1E A;  1F70 A;  3K21 A;  1CKK A;  4AQJ A;  1SRA A;  2LE9 B;  5AXI A;  1WY9 A;  1B7T Z;  1FF1 A;  1S6C A;  2LNK A;  4HRH A;  1G33 A;  2JC2 A;  2KOT A;  1BLQ A;  3KF9 A;  2FCE A;  3IQQ A;  3O78 A;  3FIA A;  3CZT X;  3AAK A;  1NX0 A;  2AUC A;  2OS8 C;  3NSI A;  2MRD A;  1NPQ A;  2JQ6 A;  4TNC A;  5J3X A;  3DF0 B;  4JQ0 D;  1QXP A;  1N65 A;  2L5X B;  3GK1 A;  3PFV A;  4MRY A;  1S1E A;  4E68 A;  1WDC B;  1J7P A;  1F71 A;  1YUS A;  1IH0 A;  1CDN A;  1QAS A;  2SCP A;  3GK2 A;  1NIW A;  3IF7 A;  2M1U A;  3VRO A;  5JOL A;  3BXK A;  1SCM B;  3LLE A;  4DCK A;  2HF5 A;  2M7L A;  3PAT A;  1S5G Y;  1YUT A;  4U8D A;  1LIN A;  2LUX A;  1N2D A;  1NP8 A;  2K2A A;  2IS9 A;  1QVI Z;  1OMV A;  1UWO A;  2L98 A;  2LCP A;  1QLS A;  2LP3 A;  1RWY A;  2H61 C;  2M9G A;  2WOR A;  1S5G Z;  1SPY A;  2L4H A;  4PHM A;  4P5O E;  2LHI A;  3CWG A;  3DVJ A;  2KHN A;  2K2F A;  1WRZ A;  1LA3 A;  4NDB A;  1ZOT B;  1K2H A;  1KWO B;  3TDZ A;  4IL1 A;  1JF0 A;  1KFX S;  1QAT A;  1CLL A;  1QJT A;  1QTX A;  1UHN A;  1XK4 A;  2NLN A;  3LK1 A;  4HRG A;  4I5L B;  2LMU A;  4NDC A;  2G9B A;  2M7N A;  2WC8 A;  1IRJ A;  1AVS A;  3RM1 A;  1HT9 A;  3VRP A;  1XFZ O;  1CNP A;  4CID A;  1SNL A;  1F55 A;  1A2X A;  1DGV A;  4GBA A;  5D7F A;  1NSH A;  1JSA A;  1CFF A;  1F4O A;  2ZRS A;  1IGV A;  4BY4 A;  1BF5 A;  1A75 A;  3PM8 A;  3WHT B;  4AQI A;  1J7O A;  2GGM A;  2EC6 B;  3EK8 A;  3TZ1 A;  1J55 A;  2KI4 C;  3JVT B;  1A29 A;  4I5K A;  1SY9 A;  4MBE A;  1S6I A;  2BE6 A;  1YTZ C;  3CS1 A;  3OP0 A;  1A75 B;  1KK7 Z;  2BBN A;  1UHJ A;  1PUL A;  1EXR A;  4A4B A;  4NDD A;  1JFK A;  2K0J A;  2LAP A;  2Y1M A;  4WQ2 A;  3PLF B;  2L50 A;  2CT9 A;  1UHH A;  3EVU A;  4PE4 A;  1CLB A;  1K9P A;  3TUY C;  1ZFS A;  5HLO A;  1YUR A;  2JT3 A;  1EL4 A;  1UUR A;  2BEC A;  5CPV A;  4DUQ A;  2BCX A;  2LHL A;  2PRU A;  1TNQ A;  3LCP C;  1NX3 A;  1S26 D;  3MSE B;  3I5H B;  3O4Y A;  2LVV A;  2NCO A;  1KK8 B;  2LLS A;  2LVJ A;  4FTG A;  1XYD A;  1SW8 A;  3PN7 B;  2JXL A;  1IG5 A;  2ZND A;  1MQ1 A;  3A4U B;  1TIZ A;  1U5I A;  4GAO A;  4C0J A;  5CSF A;  3BOW B;  1QV1 A;  2OS8 B;  4PAL A;  3IQO A;  1NX1 A;  2R2I A;  3NSO A;  2LAN A;  1BOD A;  1CMG A;  1WLM A;  1OMR A;  1NCY A;  1B8C A;  3CR5 X;  3I5F B;  1AJ4 A;  1XK4 C;  3SIA A;  1RK9 A;  2KI6 C;  1SCV A;  2BCA A;  1RFJ A;  1IQ3 A;  2CNP A;  1J7Q A;  1K95 A;  1GJY A;  1H8B A;  1LVC D;  4MSP A;  4MZL A;  1AHR A;  2K7O A;  1UP5 A;  2KFH A;  2QAC A;  4ZCU A;  2NCP A;  1FI6 A;  2KAX A;  2PMY A;  2WCF A;  1E8A A;  3F45 A;  4MEW A;  4USL A;  4F0Z B;  1CFP A;  4DS7 A;  3I5I C;  2BE4 A;  2NZ0 A;  4MRX A;  3C1V A;  4PE7 A;  4ZCV A;  1DJH A;  3PSR A;  1Y1A A;  2Q4U A;  5KSZ A;  3JTD C;  2L4I A;  5PAL A;  1ZAC A;  1XFU O;  2K7D A;  2K61 A;  2L51 A;  2PVB A;  4YRU A;  5I8N A;  1H4B A;  1NUB A;  4QJ3 B;  1W7I B;  1J1E A;  2F2O A;  4M2O A;  1TCO B;  4I5N B;  1DT7 B;  1J7R A;  2KI6 D;  2PSR A;  2WCB A;  1B47 A;  1CFC A;  1XO5 A;  2L0P A;  3RLZ A;  1IQ5 A;  4PCW A;  4MZJ A;  5TNC A;  4YGC B;  2MHH A;  3HCM A;  5CSN A;  1PVB A;  1CDL A;  1IWQ A;  1YRT B;  1F8H A;  2LM5 A;  3BUW B;  2MAZ A;  4HRE E;  4YI8 A;  2JZI A;  1J1D A;  1DF0 B;  1PAL A;  1BOC A;  2E30 A;  1EJ3 A;  1KFX L;  3I5G B;  3GK4 X;  2WOS A;  1LKJ A;  1YR5 A;  1Q80 A;  3D10 A;  1MXL C;  2LMV A;  3DF0 A;  1XVJ A;  1L7Z A;  2ZKM X;  4OKH A;  2LP2 A;  1CTR A;  5AFP A;  2ZN9 A;  2LC5 A;  4DIR A;  4QJ4 B;  1QIW A;  3BUX B;  1MXE A;  1CMF A;  1IJ5 A;  1M63 B;  3CR4 X;  3OHM B;  1K94 A;  2KNE A;  4MLW A;  3QRX A;  2A4J A;  3BUM B;  5CSI A;  2CXJ A;  1N0Y A;  1R2U A;  1OZO A;  1SBJ A;  2CCM A;  2HQ8 A;  2ZFD A;  2BKI B;  1KWO C;  1D1O A;  1PVA A;  1FW4 A;  1TRF A;  3EVV A;  1XFX O;  3AKB A;  3KPX A;  2LMT A;  3FWC A;  4ETO A;  1SL7 A;  2JNX A;  3ZWH A;  3FS7 A;  2BL0 B;  1KSM A;  3TDU A;  1SYM A;  3AKA A;  2I94 A;  4GGN A;  1KK8 C;  2K7B A;  1K93 D;  1QV0 A;  1GGW A;  1QVI Y;  2M1K B;  4ORC B;  1REC A;  2BKH B;  2HET A;  2F3Z A;  4NQG A;  2MLE C;  3PAL A;  2ZN8 A;  1SKT A;  2EHB A;  1W7J B;  2JT0 A;  5G08 A;  4FQO A;  1S3P A;  2AMI A;  3GOF A;  4XYN A;  1RJV A;  1X02 A;  3CLN A;  3D0Y A;  3TDI A;  4GPL B;  1NCX A;  3CTN A;  1HQV A;  4CFQ A;  1NX2 A;  4CFR A;  2Y5I A;  1PSB A;  4PHN A;  2KAV A;  1UHI A;  2KDH A;  1YX7 A;  2I2R E;  1G4Y R;  1QX2 A;  4HSZ A;  1QLK A;  4XJK A;  2M49 B;  3VRR A;  1UUS A;  4Q04 A;  4PDZ A;  3CR2 A;  1WRL A;  3NXA A;  3DVK A;  5FYX A;  1FPW A;  4YGD B;  3SG2 A;  1C7W A;  1ODB A;  1NYA A;  3VRN A;  2LLU A;  4BY5 A;  2K8M B;  1QS7 A;  2JT8 A;  2MJW B;  3E3R A;  2OTG C;  5HKY A;  4GFT A;  3I5H C;  3NSK A;  4PHK A;  5DKN A;  1KQM C;  1BU3 A;  1M39 A;  1TNW A;  3TS5 C;  1DJZ A;  3JTD B;  3DVE A;  1MWN A;  1YVH A;  2LVK A;  1LA0 A;  2Q91 A;  2Y1N A;  1JC2 A;  1QX5 B;  1JWD A;  2RGI A;  3SG6 A;  1L2O C;  1WLZ A;  2KAY A;  4PE1 A;  5JJG A;  4YGE B;  1B8L A;  1OOJ A;  1CDP A;  3M0W A;  2FCD A;  1JFJ A;  1DF0 A;  4M2P A;  1DGU A;  2QPT A;  1KFU S;  1BJF A;  2P6B B;  2F2P A;  3ZNI A;  1TCF A;  1Y1X A;  2GGZ A;  4GGF C;  2E6W A;  1DJW A;  1XA5 A;  3HX4 A;  3KHE A;  2BCB A;  2DOQ A;  3BOW A;  4YGB B;  1B8R A;  1YVL A;  2H2K A;  1GQM A;  2MLF C;  5B8I B;  1IKU A;  1SR6 B;  3OX6 A;  1ALW A;  3OX5 A;  3SG7 A;  2FJU B;  3VGO A;  1RRO A;  3CGA A;  1MF8 B;  1PRW A;  4R1E A;  3SG5 A;  1BR4 B;  2MBX A;  1AK8 A;  2KYF A;  1ALV A;  3OB2 B;  4CPV A;  4JWQ A;  1SMG A;  1S36 A;  1YX8 A;  4ICB A;  2V53 A;  2LVI A;  2I7A A;  2M29 A;  5AEQ A;  1SK6 D;  1DJG A;  5KU1 A;  4M2Q A;  1SL8 A;  3BQ3 A;  2KQY A;  2F8P A;  1XFV O;  5HYD A;  1PSR A;  5KTY A;  1KCY A;  4A4C A;  1MR8 A;  1TNP A;  1BG1 A;  1KQV A;  1XFY O;  2KBI A;  3EK4 A;  2CTN A;  1B4C A;  4N1F A;  5AAN A;  4I5J A;  4OCI A;  5HKZ A;  1FI5 A;  3WXA A;  3BUN B;  5I2Q A;  2VRG A;  2PAS A;  3I5G C;  2NXQ A;  1TN4 A;  2KGR A;  3KO0 A;  2SAS A;  4QJ5 B;  1C07 A;  1OQP A;  1U5I B;  1A03 A;  1QIV A;  1DTL A;  2AAO A;  2F33 A;  3AAJ A;  4MN0 A;  3PN7 C;  3I5I B;  1EG3 A;  1JF2 A;  3A8R A;  4UPG A;  1B7T Y;  1GGZ A;  1CDM A;  2KI4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...