2E30A

Solution structure of the cytoplasmic region of na+/h+ exchanger 1 complexed with essential cofactor calcineurin b homologous protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
195
structure length
195
Chain Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein p22
publication title Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transport protein
total genus 45
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2006-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e30A01
1SW8A 1B7TY 1FW4A 1JFKA 1TRFA 1WRZA 3DVKA 4GNKB 2I7AA 2MJWB 1M45A 3JTDC 1B4CA 1PRWA 1IJ6A 3KF9A 3O2PA 1U5IA 1CNPA 1YTZC 2I2RE 1L2OB 1IQ3A 5PALA 4M2OA 2KAVA 2LUXA 1KFXS 2LLSA 2LLUA 1DJXA 1G8IA 1K95A 1TN4A 3FWCA 3JTDB 4I5NB 1J7QA 1WY9A 1ODBA 1WDCC 1RTP1 1TNPA 2PMYA 4XYNA 1CMGA 1AUIB 4PE7A 2NCPA 4MZLA 2JXLA 3CWGA 1QIVA 4OCIA 3DF0A 1DT7B 1KCYA 4NDBA 1JUOA 4CPVA 2GGZA 2KFGA 2FCDA 4USLA 3GK4X 2M8UA 4NDDA 1WDCB 1WRLA 1BU3A 4L9MA 1KK7Y 1OZSA 4AQIA 3CGAA 4P5OE 5HKWA 4XJKA 4ORBB 3NXAA 2BECA 1TNXA 2L50A 4N5XA 5HLOA 1ZFSA 3SG4A 3SJSA 3QRXA 1NX1A 4HRGA 3IQQA 1BOCA 1CM4A 2FJUB 1BR1B 3BUOB 1SR6C 4YBHB 5HKZA 1UP5A 1KK8C 2D8NA 3ZNIA 1BT6A 2CXJA 1NPQA 3KPXA 1UHJA 1KFXL 1NIWA 1FBVA 1M46A 4P2YB 1G33A 1QX7A 2KBMA 1RK9A 5F6TA 1KK7Z 3F45A 1LINA 1TCFA 1BR4B 1SR6B 1M39A 2LMVA 1XFZO 3EVRA 4TNCA 1GGWA 1FI5A 2HPSA 1JSAA 1KK8B 1G4YR 1YVHA 2R2IA 2JTTA 2OPOA 3BOWB 3VROA 1QLKA 2KGBC 1IG5A 1XFYO 2K2AA 5AXIA 1OSAA 4R1EA 2Q4UA 1QLSA 2VRGA 2WCEA 4GGFA 4U8DA 1FPWA 2KOTA 2L51A 3I5GC 2Y1NA 3O78A 2KHNA 1K9UA 1XFWO 2K7OA 2SASA 3OP0A 1BJFA 1XFUO 2LNKA 1RECA 1S5GZ 5CSFA 2OS8C 2JQ6A 3AAKA 1OMDA 1HQVA 3I5GB 4YGEB 1HT9A 1UUSA 1Y1UA 2LUCA 2KYFA 3LLEA 3TZ1A 4HREE 1EXRA 3VGOA 5BPJA 1H4BA 2ZN8A 4QJ5B 1UWOA 4IL1A 3PN7C 1CDPA 4GPLB 2ZRSA 3NSOA 4MLWA 2OS8B 2JNFA 1YVLA 3ICBA 1A03A 2JWWA 1PSRA 1GJYA 2F2PA 1S6IA 1UHNA 1UURA 2WOSA 4A4CA 2L98A 3PN7B 1LA3A 3LK0A 3RLZA 3OB1B 1TTXA 5B8IB 3O4YA 2M29A 2FCEA 4FTGA 4YGBB 2ZNDA 2LHIA 1H8BA 1CLBA 5JJGA 1IJ5A 2WC8A 3IF7A 1IRJA 1R6PA 1SCMC 2AUCA 2CNPA 1J7OA 2G9BA 1QATA 1BODA 1J55A 3CLNA 2KFHA 1NX2A 1SBJA 1ZACA 4PHKA 2I18A 5HKYA 4PDZA 4YI9A 1CLLA 1MWNA 3WNXB 2M7LA 2MLFC 1YUTA 1SCMB 2L5XB 1QX5B 2M9GA 3OB2B 1B9AA 1YRUB 1A75B 3K21A 1XA5A 4I5LB 3TDIA 2O60A 1SYMA 1NP8A 2ZNEA 1RROA 4PE0A 4MN0A 1J7RA 1F70A 2ZRTA 1SL7A 1IH0A 2KI6D 3FWBA 3D10A 1QV0A 2BCAA 3D0YA 2QPTA 4PE4A 2MAZA 3DVEA 2M0RA 3E3RA 4NDCA 4DIRA 4F0ZB 3GK1A 4GFTA 3OHMB 2PALA 3SG5A 5IBWA 4I5KA 5KSZA 4ETOA 4WRIA 1UHKA 1PSBA 2PVBA 3LK1A 1XK4C 2KI6C 3C1VA 3EVVA 2IS9A 2LMTA 2BKHB 1YUUA 3SG6A 1EG3A 3EK4A 1CDLA 2K7BA 1QASA 1ZUZA 1B7TZ 5DKQA 1M31A 2KNEA 2GGMA 1A29A 3WXAA 2HQ8A 4BY4A 5HLVA 2H61C 5FYXA 4GUKA 1QIWA 5AFPA 4CLNA 2F2OA 3CS1A 1B47A 1QVIY 2CCMA 3PFVA 2M97A 1J1EA 2LVKA 5I2LA 4PE1A 2LVIA 1NX0A 3SG2A 3H4SE 3KEVA 5AEQA 4OKHA 1R2UA 1DMOA 4PHNA 4QJ4B 3IQOA 4NQGA 2BL0C 2TN4A 1NWDA 1PULA 2WCFA 3I5FC 1B8RA 1AHRA 2F3ZA 4A4BA 1PK0D 2E6WA 4D1EA 1KQVA 4OR9B 1V1FA 5J3XA 1SCVA 2LM5A 1NCYA 1N65A 1E8AA 4MRYA 5CSIA 2MBXA 2ZFDA 1CFPA 1DJWA 4MVFA 3CR4X 4OVNF 2BL0B 2FOTA 2HQWA 3EK8A 2A4JA 2KDHA 3I5FB 1MHOA 1MXLC 2JZIA 1NCXA 1EG4A 1QV1A 4QJ3B 3GOFA 1Q80A 1BF5A 1QVIZ 1TNQA 2K0JA 1B8CA 3AKBA 3EKJA 5DKRA 2K61A 4E68A 1NYAA 1WLMA 1J7PA 2KI4C 2M49B 1YRTB 4C0JA 3CR2A 1CFCA 4PHMA 4YGDB 1PVBA 2EHBA 3JVTC 1N2DA 1K90D 2Y4QA 1DJIA 4PCWA 1W7JB 2KI4B 3PATA 5CPVA 1IWQA 3BUNB 5ER4X 2EGDA 4OV2A 2NXQA 4N1FA 3DVMA 1WLZA 2KQ6A 1K9PA 1M63B 1OOJA 1DVIA 2I94A 4ZCVA 1DTLA 3JVTB 3EK7A 1S6CA 1DGVA 1SNLA 4I5JA 2V53A 3CZTX 2HETA 3KO0A 1DF0B 1CKKA 1VRKA 1QJTA 2L4HA 4YI8A 1CDMA 1QX2A 2NCOA 2ZN9A 4PHJA 1SL9A 4BY5A 2GV5A 3BUMB 1K96A 1S1EA 2SCPA 4AQJA 3A4UB 2JT8A 1B8LA 2M1UA 2JU0A 1ALVA 2Y1MA 1U5IB 1CDNA 3SG7A 2LANA 4C0LA 1SY9A 1AK8A 2LCPA 2MRDA 4JPZB 3PLFB 1IKUA 1AP4A 4AOMA 3I5IC 1B1GA 1F4OA 1LKJA 5D7FA 5GQQC 3LL8B 2Y5IA 3BUXB 4MSPA 1C7VA 1JF2A 1K9KA 4FQOA 3VRQA 5I8NA 1TCOB 1OZOA 1S6JA 2BCXA 1XVJA 2CTNA 3DF0B 3I5IB 2WORA 1L7ZA 1F8HA 3M0WA 1WRKA 2LLTA 2M7NA 4C0KA 2B1UA 1J1DA 2LP2A 1NUBA 2LVVA 2BKIB 2KQYA 1S26D 1TOPA 1KFUL 4XJKB 5KTYA 1OMVA 2JTZA 3SIAA 1SK6D 1EJ3A 4JQ0D 2F8PA 2L4IA 3MSEB 1UHHA 1N0YA 2JULA 3NSKA 2K7DA 1AJ4A 2JPTA 1NX3A 4MRXA 3TUYC 2LAPA 1KWOC 5CSJA 1K8UA 2NZ0A 3AKAA 1MUXA 2RGIA 3EKHA 1OMRA 3BYAA 3NSIA 1MF8B 2K2FA 3TUYB 2PASA 1JF0A 4ORAB 1KWOB 1ZOTB 1MXEA 1XO5A 1JBAA 2BBMA 2KSPA 1PVAA 1XYDA 2K7CA 3HX4A 1XFVO 1ZMZA 2K8MB 3CR5X 4N1GA 4DS7A 4GGNA 1A75A 3NSLA 2E30A 3TDZA 4GGFC 1JC2A 3WHUB 1W7IB 1EL4A 2ZKMX 4UPGA 2BE6A 4DCKA 1QTXA 3SIBA 3DVJA 3FIAA 2LE9B 1S36A 1SRAA 1IGVA 1Y0VH 4MZKA 3BXKA 1F55A 4GBAA 4CFRA 3FS7A 5HYDA 1RFJA 1X02A 1YX8A 4YRUA 2F33A 2G2BA 2PSRA 2PRUA 2JXCA 1UHIA 2AMIA 1MQ1A 2M1KB 1CTRA 1DJGA 1OE9B 2KBIA 3ZWHA 1NCZA 2KAXA 2QACA 3EVUA 1Y1XA 4MEWA 1D1OA 3LCPC 2WCBA 5ER5A 1FF1A 3BQ3A 4WQ3A 2BCBA 3OX6A 4GAOA 2LV7A 3PSRA 2H2KA 1IQ5A 4DRWA 4MBEA 1A4PA 1CLMA 1LXFC 1XK4A 2F3YA 1QS7A 2WNDA 5G08A 1CB1A 1S5GY 1Y1AA 2MA2A 2KGRA 2CT9A 1K94A 2MHHA 1NSHA 1RJVA 1CFFA 1C7WA 1RWYA 3VRNA 1BMOA 4JWQA 1A2XA 1LA0A 1AVSA 1BG1A 5I2QA 1JFJA 2JNXA 1SKTA 3A8RA 2H61A 1XFXO 1DJYA 2KAYA 2JC2A 2KFFA 3O6BA 3WHTB 1KFUS 3BUWB 2OTGC 1CM1A 1KQMC 5CSNA 2BE4A 1GQMA 1KSOA 4CFQA 2JT3A 3AAJA 2EC6C 4ORCB 4Q04A 1YURA 2LP3A 3PM8A 1F54A 1SL8A 4YGAA 4HSZA 3TS5C 2LMUA 1MR8A 4MZJA 1S3PA 2NLNA 4PALA 2OTGB 3SG3A 1DJHA 1KQMB 1TNWA 1TIZA 1V1GA 2KYCA 3BOWA 1PALA 4DUQA 3CTNA 2EC6B 2JOJA 4M2PA 4M2QA 2DOQA 2JT0A 3OX5A 5TNCA 3TS5B 1DJZA 1CMFA 5AANA 1AJ5A 1SPYA 1YR5A 4YGCB 3D0YB 2JRFA 1CFDA 1YX7A 2Q91A 1JWDA 1C07A 3TDUA 2P6BB 3PALA 5K89A 1Y6WA 3HCMA 5I2OA 5D69A 1YUSA 1K2HA 1BLQA 1ALWA 2AAOA 2LVJA 2O5GA 2ISDA 3VRPA 3KHEA 2L2EA 4ICBA 4ZCUA 2LC5A 5DKNA 4HRHA 3RM1A 3VRRA 4CIDA 5KU1A 1QXPA 3I5HC 1K93D 2CBLA 2COLB 2LHLA 1F71A 1DGUA 1OQPA 1KSMA 2L0PA 1EH2A 1LVCD 5JOLA 2HF5A 1DF0A 4WQ2A 1F4QA 1FI6A 3I5HB 1SMGA 5AERA 1GGZA 2MLEC 3DD4A 1L2OC 3GK2A 2M3WA 2BBNA
chains in the Genus database with same CATH superfamily
1SW8A 3L4AA 1B7TY 1FW4A 1JFKA 1TRFA 1WRZA 3DVKA 3OGNA 3S0AA 4GNKB 2I7AA 2MJWB 2YGUA 1M45A 3JTDC 1B4CA 1PRWA 1IJ6A 3KF9A 3O2PA 1U5IA 3V2LA 1CNPA 1YTZC 2I2RE 1L2OB 1IQ3A 5PALA 5FI2A 4M2OA 2KAVA 2LUXA 1KFXS 2LLSA 2LLUA 3PJIA 1DJXA 1G8IA 1K95A 1TN4A 3FWCA 3JTDB 4I5NB 1J7QA 1WY9A 3D73A 1ODBA 1WDCC 2QDIA 1RTP1 1TNPA 2PMYA 4XYNA 1CMGA 1AUIB 4PE7A 3BFAA 2QEBA 2NCPA 4MZLA 2JXLA 3CWGA 1QIVA 4OCIA 3DF0A 1DT7B 1KCYA 3D77A 4NDBA 3CZ0A 1JUOA 4CPVA 2GGZA 2KFGA 2FCDA 4USLA 3GK4X 2M8UA 4NDDA 1WDCB 1WRLA 1BU3A 4L9MA 1KK7Y 1OZSA 4AQIA 3CGAA 1IIOA 4P5OE 3S0GA 5HKWA 4XJKA 4ORBB 3NXAA 2BECA 1TNXA 2L50A 4N5XA 5HLOA 1ZFSA 3SG4A 3SJSA 1TUJA 3QRXA 2L2CA 1NX1A 4HRGA 3FE9A 2JPOA 3IQQA 1BOCA 1CM4A 2FJUB 1BR1B 3BUOB 1SR6C 4YBHB 5HKZA 1UP5A 1KK8C 2D8NA 1OOHA 3ZNIA 1BT6A 2CXJA 1NPQA 3KPXA 1SSEB 1KFXL 1UHJA 3N7HA 3IVTA 1NIWA 1FBVA 1M46A 4P2YB 1G33A 1QX7A 2KBMA 1RK9A 5F6TA 1KK7Z 3F45A 1LINA 3UNWA 1TCFA 3L47A 3R1VA 1BR4B 1SR6B 1M39A 2LMVA 1XFZO 3EVRA 2WCMA 4TNCA 1FI5A 1GGWA 2HPSA 1JSAA 1KK8B 1G4YR 1YVHA 2R2IA 2JTTA 2OPOA 3BOWB 3VROA 3PM2A 3QMEA 4F7FA 1QLKA 2KGBC 1IG5A 1XFYO 2K2AA 5AXIA 1OSAA 4R1EA 2Q4UA 1QLSA 2VRGA 2WCEA 2WCJA 4GGFA 4U8DA 1P28A 1FPWA 2KOTA 2L51A 3I5GC 2Y1NA 3O78A 2KHNA 3R1PA 1K9UA 1XFWO 2K7OA 2SASA 3OP0A 1BJFA 1XFUO 3CDNA 2LNKA 1RECA 1S5GZ 5CSFA 2OS8C 2JQ6A 3AAKA 1OMDA 1HQVA 3I5GB 4YGEB 1HT9A 1UUSA 1Y1UA 2LUCA 2KYFA 3LLEA 3TZ1A 4HREE 1EXRA 3VGOA 5BPJA 1H4BA 2ZN8A 4QJ5B 1UWOA 4IL1A 3PN7C 3CZ2A 1CDPA 4GPLB 2ZRSA 3NSOA 4MLWA 2OS8B 2JNFA 1YVLA 3ICBA 1LS8A 1A03A 2JWWA 1PSRA 1GJYA 2F2PA 1S6IA 1UHNA 3CABA 1UURA 2WOSA 5DICA 4A4CA 2L98A 3PN7B 1LA3A 3LK0A 5FI6A 3RLZA 3OB1B 1TTXA 5B8IB 5HL1A 4PT1A 3O4YA 2M29A 2FCEA 3NHTA 4FTGA 4YGBB 3L4LA 2ZNDA 2LHIA 1H8BA 1CLBA 5JJGA 1IJ5A 2WC8A 3IF7A 1IRJA 1R6PA 1SCMC 2AUCA 2CNPA 1J7OA 3BJHA 2G9BA 1QATA 1BODA 1J55A 3CLNA 2KFHA 1NX2A 1SBJA 1TUZA 1ZACA 4PHKA 2I18A 5HKYA 4PDZA 4YI9A 1CLLA 1MWNA 3D78A 3WNXB 2M7LA 2MLFC 1YUTA 1SCMB 2L5XB 1QX5B 2M9GA 3OB2B 1B9AA 1YRUB 1A75B 3K21A 1XA5A 4I5LB 3TDIA 2O60A 1SYMA 1NP8A 2ZNEA 1XFRA 1RROA 4PE0A 4MN0A 1J7RA 1F70A 2ZRTA 1SL7A 3R1OA 2KI6D 2WC6A 3FWBA 1IH0A 3O4XA 3D10A 1QV0A 2BCAA 3D0YA 2QPTA 3DXLA 4PE4A 2MAZA 3DVEA 2M0RA 3E3RA 4NDCA 3VB1A 4DIRA 4F0ZB 3GK1A 4GFTA 3OHMB 4INWA 2PALA 3SG5A 1QWVA 5IBWA 4I5KA 5KSZA 3D75A 4ETOA 4WRIA 1UHKA 1PSBA 2PVBA 3LK1A 1XK4C 4INXA 2KI6C 3C1VA 3DYEA 3EVVA 2IS9A 3B88A 2LMTA 2BKHB 1W9ZA 1YUUA 3SG6A 1EG3A 3EK4A 1CDLA 2K7BA 1QASA 1ZUZA 1B7TZ 5DKQA 1M31A 2KNEA 2GGMA 1A29A 3WXAA 2HQ8A 4BY4A 4KYNA 5HLVA 2H61C 3K1EA 5FYXA 4GUKA 5FI7A 1QIWA 5AFPA 4CLNA 2F2OA 3CS1A 1B47A 1QVIY 2CCMA 2FJYA 3CYZA 2L5YA 3PFVA 2M97A 1T14A 1J1EA 2LVKA 5I2LA 4PE1A 3DY9A 2LVIA 1NX0A 3SG2A 3H4SE 3SS4A 3KEVA 5AEQA 4OKHA 1R2UA 1DMOA 4PHNA 4QJ4B 3IQOA 4NQGA 2BL0C 2TN4A 1NWDA 1PULA 2WCFA 3B7AA 1B8RA 1AHRA 2F3ZA 2WCHA 1PK0D 2E6WA 2GTEA 4D1EA 1KQVA 3UO9A 4OR9B 1V1FA 5J3XA 1SCVA 2LM5A 1NCYA 1N65A 1E8AA 4MRYA 5CSIA 2MBXA 2ZFDA 1CFPA 1DJWA 4MVFA 3CR4X 4OVNF 2BL0B 2FOTA 2HQWA 3EK8A 2A4JA 2KDHA 1OW4A 3I5FB 1MHOA 1MXLC 2JZIA 1NCXA 4A4BA 3B6XA 3RZSA 1EG4A 1QV1A 4QJ3B 3GOFA 1Q80A 2KPHA 1BF5A 1QVIZ 3B86A 1TNQA 2K0JA 1B8CA 3AKBA 3EKJA 4JD9A 2K61A 5DKRA 4E68A 1NYAA 1WLMA 1J7PA 2KI4C 2M49B 1YRTB 4C0JA 3CR2A 1CFCA 4PHMA 4YGDB 1PVBA 2EHBA 3OBVA 3JVTC 1N2DA 1K90D 2Y4QA 1DJIA 4PCWA 1W7JB 2KI4B 3PATA 5CPVA 1IWQA 3BUNB 5ER4X 2EGDA 4OV2A 2PQLA 2NXQA 4N1FA 3DVMA 1WLZA 2KQ6A 3FE8A 1K9PA 1M63B 1OOJA 1DVIA 3CZ1A 2I94A 4ZCVA 1DTLA 3JVTB 3EK7A 1S6CA 1DGVA 1SNLA 4I5JA 2V53A 3CZTX 2HETA 3KO0A 1DF0B 1CKKA 1VRKA 1QJTA 2L4HA 4YI8A 3Q8IA 1CDMA 1QX2A 2NCOA 2ZN9A 4PHJA 1SL9A 4BY5A 2GV5A 3BUMB 1K96A 1S1EA 2SCPA 4AQJA 3S0DA 3A4UB 2JT8A 1B8LA 2M1UA 2JU0A 1ALVA 2Y1MA 1U5IB 1CDNA 3SG7A 2LANA 4C0LA 1SY9A 1AK8A 2LCPA 2MRDA 4JPZB 3PLFB 1IKUA 3BFBA 1AP4A 4AOMA 3I5IC 1B1GA 1F4OA 1LKJA 5D7FA 5GQQC 3LL8B 2Y5IA 3BUXB 4MSPA 5I94A 3SS5A 1C7VA 1JF2A 1K9KA 4FQOA 3VRQA 5I8NA 1OOFA 1OZOA 1TCOB 4IJ7A 1S6JA 2BCXA 1XVJA 2CTNA 3DF0B 2KLEA 1C3YA 3I5IB 2WORA 1L7ZA 1F8HA 3D74A 3M0WA 1WRKA 2LLTA 2M7NA 4C0KA 2B1UA 1J1DA 2LP2A 1NUBA 2LVVA 2BKIB 2KQYA 1S26D 1TOPA 1KFUL 4XJKB 5KTYA 1OMVA 2JTZA 3SIAA 1SK6D 1EJ3A 4JQ0D 2F8PA 2L4IA 3MSEB 1UHHA 1N0YA 2QEHA 2JULA 3NSKA 2K7DA 3R72A 1AJ4A 2JPTA 1NX3A 4MRXA 3DZTA 3TUYC 2LAPA 1KWOC 5CSJA 1K8UA 3NHIA 2NZ0A 3EG5B 3AKAA 1MUXA 2RGIA 3EKHA 1Z4HA 1OMRA 3SS3A 3BYAA 2BAPA 3NSIA 1MF8B 2PYQA 2K2FA 3TUYB 2PASA 1JF0A 4ORAB 1KWOB 1ZOTB 1MXEA 1XO5A 1JBAA 2BBMA 2KSPA 1PVAA 1XYDA 2K7CA 3HX4A 1XFVO 1ZMZA 2K8MB 3CR5X 4N1GA 4DS7A 4GGNA 1A75A 3NSLA 2E30A 3S0EA 3TDZA 4GGFC 1JC2A 3WHUB 1W7IB 1EL4A 2WC5A 2ZKMX 4UPGA 2BE6A 4DCKA 1QTXA 3SIBA 3DVJA 3B87A 3FIAA 1OOIX 2LE9B 1S36A 1SRAA 1IGVA 1Y0VH 4MZKA 2WCLA 3BXKA 1F55A 4GBAA 4CFRA 3FS7A 5HYDA 1RFJA 1X02A 1YX8A 1DC1A 4YRUA 2F33A 2G2BA 2PSRA 2PRUA 1DQEA 2JXCA 1UHIA 2AMIA 1MQ1A 2M1KB 1CTRA 1DJGA 1OE9B 2KBIA 1DELA 3ZWHA 1NCZA 2KAXA 2QACA 3EVUA 1Y1XA 4MEWA 1D1OA 3LCPC 2P71A 4FQTA 1ORGA 2WCBA 2QEOA 5ER5A 1FF1A 3BQ3A 4WQ3A 2BCBA 3OX6A 4GAOA 2LV7A 3PSRA 2H2KA 1IQ5A 4DRWA 4MBEA 1A4PA 1CLMA 1LXFC 1XK4A 2F3YA 1QS7A 2WNDA 5G08A 1CB1A 1S5GY 1Y1AA 3NGVA 4JKTA 2MA2A 2KGRA 2CT9A 1K94A 2MHHA 1NSHA 2KLDA 1RJVA 4OZDA 1CFFA 1C7WA 1RWYA 3VRNA 1BMOA 2P70A 4JWQA 1A2XA 1LA0A 5EL2A 1AVSA 1BG1A 5I2QA 1JFJA 2JNXA 1SKTA 3A8RA 2H8VA 3BFHA 2BNXA 2H61A 1XFXO 1DJYA 2K60A 5D3OA 2KAYA 2JC2A 2KFFA 3O6BA 3WHTB 3D76A 1KFUS 3BUWB 2OTGC 1CM1A 1KQMC 5CSNA 2BE4A 1GQMA 1KSOA 2ERBA 4CFQA 2JT3A 3AAJA 3FE6A 2EC6C 4ORCB 4Q04A 1YURA 2LP3A 3PM8A 1F54A 1SL8A 4YGAA 4HSZA 3TS5C 2LMUA 1MR8A 4MZJA 1S3PA 2NLNA 2QEVA 4PALA 2OTGB 3SG3A 1DJHA 1KQMB 1TNWA 3S0FA 1GM0A 1TIZA 1V1GA 2KYCA 3BOWA 1PALA 4DUQA 3CTNA 2EC6B 1OOGA 2JOJA 4M2PA 4M2QA 2DOQA 2JT0A 3OX5A 5TNCA 3TS5B 1DJZA 1CMFA 5AANA 1AJ5A 1TWOA 1SPYA 1YR5A 4YGCB 3D0YB 2JRFA 1CFDA 1YX7A 1C3ZA 1DEKA 2Q91A 1C07A 1JWDA 3TDUA 3S0BA 2P6BB 3PALA 5K89A 1Y6WA 3HCMA 5I2OA 5D69A 1YUSA 1K2HA 1BLQA 1ALWA 2AAOA 2LVJA 1Z2CB 2O5GA 2ISDA 3VRPA 3KHEA 2L2EA 4ICBA 4ZCUA 2LC5A 5DKNA 4HRHA 3RM1A 3VRRA 4CIDA 5KU1A 1QXPA 3I5HC 1K93D 2CBLA 2WCKA 2COLB 2LHLA 1F71A 1DGUA 1OQPA 1KSMA 2L0PA 1EH2A 1LVCD 5JOLA 2HF5A 1DF0A 4WQ2A 1F4QA 1FI6A 3I5HB 1SMGA 3I5FC 1GGZA 5AERA 2MLEC 3DD4A 1L2OC 3GK2A 2M3WA 2BBNA
chains in the Genus database with same CATH topology
1SW8A 1B7TY 1FW4A 1JFKA 1TRFA 1WRZA 3DVKA 4GNKB 2I7AA 2MJWB 1M45A 3JTDC 1B4CA 1PRWA 1IJ6A 3KF9A 3O2PA 1U5IA 1CNPA 1YTZC 2I2RE 1L2OB 1IQ3A 5PALA 4M2OA 2KAVA 2LUXA 1KFXS 2LLSA 2LLUA 1DJXA 1G8IA 1K95A 1TN4A 3FWCA 3JTDB 4I5NB 1J7QA 1WY9A 1ODBA 1WDCC 1RTP1 1TNPA 2PMYA 4XYNA 1CMGA 1AUIB 4PE7A 2NCPA 4MZLA 2JXLA 3CWGA 1QIVA 4OCIA 3DF0A 1DT7B 1KCYA 4NDBA 1JUOA 4CPVA 2GGZA 2KFGA 2FCDA 4USLA 3GK4X 2M8UA 4NDDA 1WDCB 1WRLA 1BU3A 4L9MA 1KK7Y 1OZSA 4AQIA 3CGAA 4P5OE 5HKWA 4XJKA 4ORBB 3NXAA 2BECA 1TNXA 2L50A 4N5XA 5HLOA 1ZFSA 3SG4A 3SJSA 3QRXA 1NX1A 4HRGA 3IQQA 1BOCA 1CM4A 2FJUB 1BR1B 3BUOB 1SR6C 4YBHB 5HKZA 1UP5A 1KK8C 2D8NA 3ZNIA 1BT6A 2CXJA 1NPQA 3KPXA 1UHJA 1KFXL 1NIWA 1FBVA 1M46A 4P2YB 1G33A 1QX7A 2KBMA 1RK9A 5F6TA 1KK7Z 3F45A 1LINA 1TCFA 1BR4B 1SR6B 1M39A 2LMVA 1XFZO 3EVRA 4TNCA 1GGWA 1FI5A 2HPSA 1JSAA 1KK8B 1G4YR 1YVHA 2R2IA 2JTTA 2OPOA 3BOWB 3VROA 1QLKA 2KGBC 1IG5A 1XFYO 2K2AA 5AXIA 1OSAA 4R1EA 2Q4UA 1QLSA 2VRGA 2WCEA 4GGFA 4U8DA 1FPWA 2KOTA 2L51A 3I5GC 2Y1NA 3O78A 2KHNA 1K9UA 1XFWO 2K7OA 2SASA 3OP0A 1BJFA 1XFUO 2LNKA 1RECA 1S5GZ 5CSFA 2OS8C 2JQ6A 3AAKA 1OMDA 1HQVA 3I5GB 4YGEB 1HT9A 1UUSA 1Y1UA 2LUCA 2KYFA 3LLEA 3TZ1A 4HREE 1EXRA 3VGOA 5BPJA 1H4BA 2ZN8A 4QJ5B 1UWOA 4IL1A 3PN7C 1CDPA 4GPLB 2ZRSA 3NSOA 4MLWA 2OS8B 2JNFA 1YVLA 3ICBA 1A03A 2JWWA 1PSRA 1GJYA 2F2PA 1S6IA 1UHNA 1UURA 2WOSA 4A4CA 2L98A 3PN7B 1LA3A 3LK0A 3RLZA 3OB1B 1TTXA 5B8IB 3O4YA 2M29A 2FCEA 4FTGA 4YGBB 2ZNDA 2LHIA 1H8BA 1CLBA 5JJGA 1IJ5A 2WC8A 3IF7A 1IRJA 1R6PA 1SCMC 2AUCA 2CNPA 1J7OA 2G9BA 1QATA 1BODA 1J55A 3CLNA 2KFHA 1NX2A 1SBJA 1ZACA 4PHKA 2I18A 5HKYA 4PDZA 4YI9A 1CLLA 1MWNA 3WNXB 2M7LA 2MLFC 1YUTA 1SCMB 2L5XB 1QX5B 2M9GA 3OB2B 1B9AA 1YRUB 1A75B 3K21A 1XA5A 4I5LB 3TDIA 2O60A 1SYMA 1NP8A 2ZNEA 1RROA 4PE0A 4MN0A 1J7RA 1F70A 2ZRTA 1SL7A 1IH0A 2KI6D 3FWBA 3D10A 1QV0A 2BCAA 3D0YA 2QPTA 4PE4A 2MAZA 3DVEA 2M0RA 3E3RA 4NDCA 4DIRA 4F0ZB 3GK1A 4GFTA 3OHMB 2PALA 3SG5A 5IBWA 4I5KA 5KSZA 4ETOA 4WRIA 1UHKA 1PSBA 2PVBA 3LK1A 1XK4C 2KI6C 3C1VA 3EVVA 2IS9A 2LMTA 2BKHB 1YUUA 3SG6A 1EG3A 3EK4A 1CDLA 2K7BA 1QASA 1ZUZA 1B7TZ 5DKQA 1M31A 2KNEA 2GGMA 1A29A 3WXAA 2HQ8A 4BY4A 5HLVA 2H61C 5FYXA 4GUKA 1QIWA 5AFPA 4CLNA 2F2OA 3CS1A 1B47A 1QVIY 2CCMA 3PFVA 2M97A 1J1EA 2LVKA 5I2LA 4PE1A 2LVIA 1NX0A 3SG2A 3H4SE 3KEVA 5AEQA 4OKHA 1R2UA 1DMOA 4PHNA 4QJ4B 3IQOA 4NQGA 2BL0C 2TN4A 1NWDA 1PULA 2WCFA 3I5FC 1B8RA 1AHRA 2F3ZA 4A4BA 1PK0D 2E6WA 4D1EA 1KQVA 4OR9B 1V1FA 5J3XA 1SCVA 2LM5A 1NCYA 1N65A 1E8AA 4MRYA 5CSIA 2MBXA 2ZFDA 1CFPA 1DJWA 4MVFA 3CR4X 4OVNF 2BL0B 2FOTA 2HQWA 3EK8A 2A4JA 2KDHA 3I5FB 1MHOA 1MXLC 2JZIA 1NCXA 1EG4A 1QV1A 4QJ3B 3GOFA 1Q80A 1BF5A 1QVIZ 1TNQA 2K0JA 1B8CA 3AKBA 3EKJA 5DKRA 2K61A 4E68A 1NYAA 1WLMA 1J7PA 2KI4C 2M49B 1YRTB 4C0JA 3CR2A 1CFCA 4PHMA 4YGDB 1PVBA 2EHBA 3JVTC 1N2DA 1K90D 2Y4QA 1DJIA 4PCWA 1W7JB 2KI4B 3PATA 5CPVA 1IWQA 3BUNB 5ER4X 2EGDA 4OV2A 2NXQA 4N1FA 3DVMA 1WLZA 2KQ6A 1K9PA 1M63B 1OOJA 1DVIA 2I94A 4ZCVA 1DTLA 3JVTB 3EK7A 1S6CA 1DGVA 1SNLA 4I5JA 2V53A 3CZTX 2HETA 3KO0A 1DF0B 1CKKA 1VRKA 1QJTA 2L4HA 4YI8A 1CDMA 1QX2A 2NCOA 2ZN9A 4PHJA 1SL9A 4BY5A 2GV5A 3BUMB 1K96A 1S1EA 2SCPA 4AQJA 3A4UB 2JT8A 1B8LA 2M1UA 2JU0A 1ALVA 2Y1MA 1U5IB 1CDNA 3SG7A 2LANA 4C0LA 1SY9A 1AK8A 2LCPA 2MRDA 4JPZB 3PLFB 1IKUA 1AP4A 4AOMA 3I5IC 1B1GA 1F4OA 1LKJA 5D7FA 5GQQC 3LL8B 2Y5IA 3BUXB 4MSPA 1C7VA 1JF2A 1K9KA 4FQOA 3VRQA 5I8NA 1TCOB 1OZOA 1S6JA 2BCXA 1XVJA 2CTNA 3DF0B 3I5IB 2WORA 1L7ZA 1F8HA 3M0WA 1WRKA 2LLTA 2M7NA 4C0KA 2B1UA 1J1DA 2LP2A 1NUBA 2LVVA 2BKIB 2KQYA 1S26D 1TOPA 1KFUL 4XJKB 5KTYA 1OMVA 2JTZA 3SIAA 1SK6D 1EJ3A 4JQ0D 2F8PA 2L4IA 3MSEB 1UHHA 1N0YA 2JULA 3NSKA 2K7DA 1AJ4A 2JPTA 1NX3A 4MRXA 3TUYC 2LAPA 1KWOC 5CSJA 1K8UA 2NZ0A 3AKAA 1MUXA 2RGIA 3EKHA 1OMRA 3BYAA 3NSIA 1MF8B 2K2FA 3TUYB 2PASA 1JF0A 4ORAB 1KWOB 1ZOTB 1MXEA 1XO5A 1JBAA 2BBMA 2KSPA 1PVAA 1XYDA 2K7CA 3HX4A 1XFVO 1ZMZA 2K8MB 3CR5X 4N1GA 4DS7A 4GGNA 1A75A 3NSLA 2E30A 3TDZA 4GGFC 1JC2A 3WHUB 1W7IB 1EL4A 2ZKMX 4UPGA 2BE6A 4DCKA 1QTXA 3SIBA 3DVJA 3FIAA 2LE9B 1S36A 1SRAA 1IGVA 1Y0VH 4MZKA 3BXKA 1F55A 4GBAA 4CFRA 3FS7A 5HYDA 1RFJA 1X02A 1YX8A 4YRUA 2F33A 2G2BA 2PSRA 2PRUA 2JXCA 1UHIA 2AMIA 1MQ1A 2M1KB 1CTRA 1DJGA 1OE9B 2KBIA 3ZWHA 1NCZA 2KAXA 2QACA 3EVUA 1Y1XA 4MEWA 1D1OA 3LCPC 2WCBA 5ER5A 1FF1A 3BQ3A 4WQ3A 2BCBA 3OX6A 4GAOA 2LV7A 3PSRA 2H2KA 1IQ5A 4DRWA 4MBEA 1A4PA 1CLMA 1LXFC 1XK4A 2F3YA 1QS7A 2WNDA 5G08A 1CB1A 1S5GY 1Y1AA 2MA2A 2KGRA 2CT9A 1K94A 2MHHA 1NSHA 1RJVA 1CFFA 1C7WA 1RWYA 3VRNA 1BMOA 4JWQA 1A2XA 1LA0A 1AVSA 1BG1A 5I2QA 1JFJA 2JNXA 1SKTA 3A8RA 2H61A 1XFXO 1DJYA 2KAYA 2JC2A 2KFFA 3O6BA 3WHTB 1KFUS 3BUWB 2OTGC 1CM1A 1KQMC 5CSNA 2BE4A 1GQMA 1KSOA 4CFQA 2JT3A 3AAJA 2EC6C 4ORCB 4Q04A 1YURA 2LP3A 3PM8A 1F54A 1SL8A 4YGAA 4HSZA 3TS5C 2LMUA 1MR8A 4MZJA 1S3PA 2NLNA 4PALA 2OTGB 3SG3A 1DJHA 1KQMB 1TNWA 1TIZA 1V1GA 2KYCA 3BOWA 1PALA 4DUQA 3CTNA 2EC6B 2JOJA 4M2PA 4M2QA 2DOQA 2JT0A 3OX5A 5TNCA 3TS5B 1DJZA 1CMFA 5AANA 1AJ5A 1SPYA 1YR5A 4YGCB 3D0YB 2JRFA 1CFDA 1YX7A 2Q91A 1JWDA 1C07A 3TDUA 2P6BB 3PALA 5K89A 1Y6WA 3HCMA 5I2OA 5D69A 1YUSA 1K2HA 1BLQA 1ALWA 2AAOA 2LVJA 2O5GA 2ISDA 3VRPA 3KHEA 2L2EA 4ICBA 4ZCUA 2LC5A 5DKNA 4HRHA 3RM1A 3VRRA 4CIDA 5KU1A 1QXPA 3I5HC 1K93D 2CBLA 2COLB 2LHLA 1F71A 1DGUA 1OQPA 1KSMA 2L0PA 1EH2A 1LVCD 5JOLA 2HF5A 1DF0A 4WQ2A 1F4QA 1FI6A 3I5HB 1SMGA 5AERA 1GGZA 2MLEC 3DD4A 1L2OC 3GK2A 2M3WA 2BBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW8 A;  1B7T Y;  1FW4 A;  1JFK A;  1TRF A;  1WRZ A;  3DVK A;  4GNK B;  2I7A A;  2MJW B;  1M45 A;  3JTD C;  1B4C A;  1PRW A;  1IJ6 A;  3KF9 A;  3O2P A;  1U5I A;  1CNP A;  1YTZ C;  2I2R E;  1L2O B;  1IQ3 A;  5PAL A;  4M2O A;  2KAV A;  2LUX A;  1KFX S;  2LLS A;  2LLU A;  1DJX A;  1G8I A;  1K95 A;  1TN4 A;  3FWC A;  3JTD B;  4I5N B;  1J7Q A;  1WY9 A;  1ODB A;  1WDC C;  1RTP 1;  1TNP A;  2PMY A;  4XYN A;  1CMG A;  1AUI B;  4PE7 A;  2NCP A;  4MZL A;  2JXL A;  3CWG A;  1QIV A;  4OCI A;  3DF0 A;  1DT7 B;  1KCY A;  4NDB A;  1JUO A;  4CPV A;  2GGZ A;  2KFG A;  2FCD A;  4USL A;  3GK4 X;  2M8U A;  4NDD A;  1WDC B;  1WRL A;  1BU3 A;  4L9M A;  1KK7 Y;  1OZS A;  4AQI A;  3CGA A;  4P5O E;  5HKW A;  4XJK A;  4ORB B;  3NXA A;  2BEC A;  1TNX A;  2L50 A;  4N5X A;  5HLO A;  1ZFS A;  3SG4 A;  3SJS A;  3QRX A;  1NX1 A;  4HRG A;  3IQQ A;  1BOC A;  1CM4 A;  2FJU B;  1BR1 B;  3BUO B;  1SR6 C;  4YBH B;  5HKZ A;  1UP5 A;  1KK8 C;  2D8N A;  3ZNI A;  1BT6 A;  2CXJ A;  1NPQ A;  3KPX A;  1UHJ A;  1KFX L;  1NIW A;  1FBV A;  1M46 A;  4P2Y B;  1G33 A;  1QX7 A;  2KBM A;  1RK9 A;  5F6T A;  1KK7 Z;  3F45 A;  1LIN A;  1TCF A;  1BR4 B;  1SR6 B;  1M39 A;  2LMV A;  1XFZ O;  3EVR A;  4TNC A;  1GGW A;  1FI5 A;  2HPS A;  1JSA A;  1KK8 B;  1G4Y R;  1YVH A;  2R2I A;  2JTT A;  2OPO A;  3BOW B;  3VRO A;  1QLK A;  2KGB C;  1IG5 A;  1XFY O;  2K2A A;  5AXI A;  1OSA A;  4R1E A;  2Q4U A;  1QLS A;  2VRG A;  2WCE A;  4GGF A;  4U8D A;  1FPW A;  2KOT A;  2L51 A;  3I5G C;  2Y1N A;  3O78 A;  2KHN A;  1K9U A;  1XFW O;  2K7O A;  2SAS A;  3OP0 A;  1BJF A;  1XFU O;  2LNK A;  1REC A;  1S5G Z;  5CSF A;  2OS8 C;  2JQ6 A;  3AAK A;  1OMD A;  1HQV A;  3I5G B;  4YGE B;  1HT9 A;  1UUS A;  1Y1U A;  2LUC A;  2KYF A;  3LLE A;  3TZ1 A;  4HRE E;  1EXR A;  3VGO A;  5BPJ A;  1H4B A;  2ZN8 A;  4QJ5 B;  1UWO A;  4IL1 A;  3PN7 C;  1CDP A;  4GPL B;  2ZRS A;  3NSO A;  4MLW A;  2OS8 B;  2JNF A;  1YVL A;  3ICB A;  1A03 A;  2JWW A;  1PSR A;  1GJY A;  2F2P A;  1S6I A;  1UHN A;  1UUR A;  2WOS A;  4A4C A;  2L98 A;  3PN7 B;  1LA3 A;  3LK0 A;  3RLZ A;  3OB1 B;  1TTX A;  5B8I B;  3O4Y A;  2M29 A;  2FCE A;  4FTG A;  4YGB B;  2ZND A;  2LHI A;  1H8B A;  1CLB A;  5JJG A;  1IJ5 A;  2WC8 A;  3IF7 A;  1IRJ A;  1R6P A;  1SCM C;  2AUC A;  2CNP A;  1J7O A;  2G9B A;  1QAT A;  1BOD A;  1J55 A;  3CLN A;  2KFH A;  1NX2 A;  1SBJ A;  1ZAC A;  4PHK A;  2I18 A;  5HKY A;  4PDZ A;  4YI9 A;  1CLL A;  1MWN A;  3WNX B;  2M7L A;  2MLF C;  1YUT A;  1SCM B;  2L5X B;  1QX5 B;  2M9G A;  3OB2 B;  1B9A A;  1YRU B;  1A75 B;  3K21 A;  1XA5 A;  4I5L B;  3TDI A;  2O60 A;  1SYM A;  1NP8 A;  2ZNE A;  1RRO A;  4PE0 A;  4MN0 A;  1J7R A;  1F70 A;  2ZRT A;  1SL7 A;  1IH0 A;  2KI6 D;  3FWB A;  3D10 A;  1QV0 A;  2BCA A;  3D0Y A;  2QPT A;  4PE4 A;  2MAZ A;  3DVE A;  2M0R A;  3E3R A;  4NDC A;  4DIR A;  4F0Z B;  3GK1 A;  4GFT A;  3OHM B;  2PAL A;  3SG5 A;  5IBW A;  4I5K A;  5KSZ A;  4ETO A;  4WRI A;  1UHK A;  1PSB A;  2PVB A;  3LK1 A;  1XK4 C;  2KI6 C;  3C1V A;  3EVV A;  2IS9 A;  2LMT A;  2BKH B;  1YUU A;  3SG6 A;  1EG3 A;  3EK4 A;  1CDL A;  2K7B A;  1QAS A;  1ZUZ A;  1B7T Z;  5DKQ A;  1M31 A;  2KNE A;  2GGM A;  1A29 A;  3WXA A;  2HQ8 A;  4BY4 A;  5HLV A;  2H61 C;  5FYX A;  4GUK A;  1QIW A;  5AFP A;  4CLN A;  2F2O A;  3CS1 A;  1B47 A;  1QVI Y;  2CCM A;  3PFV A;  2M97 A;  1J1E A;  2LVK A;  5I2L A;  4PE1 A;  2LVI A;  1NX0 A;  3SG2 A;  3H4S E;  3KEV A;  5AEQ A;  4OKH A;  1R2U A;  1DMO A;  4PHN A;  4QJ4 B;  3IQO A;  4NQG A;  2BL0 C;  2TN4 A;  1NWD A;  1PUL A;  2WCF A;  3I5F C;  1B8R A;  1AHR A;  2F3Z A;  4A4B A;  1PK0 D;  2E6W A;  4D1E A;  1KQV A;  4OR9 B;  1V1F A;  5J3X A;  1SCV A;  2LM5 A;  1NCY A;  1N65 A;  1E8A A;  4MRY A;  5CSI A;  2MBX A;  2ZFD A;  1CFP A;  1DJW A;  4MVF A;  3CR4 X;  4OVN F;  2BL0 B;  2FOT A;  2HQW A;  3EK8 A;  2A4J A;  2KDH A;  3I5F B;  1MHO A;  1MXL C;  2JZI A;  1NCX A;  1EG4 A;  1QV1 A;  4QJ3 B;  3GOF A;  1Q80 A;  1BF5 A;  1QVI Z;  1TNQ A;  2K0J A;  1B8C A;  3AKB A;  3EKJ A;  5DKR A;  2K61 A;  4E68 A;  1NYA A;  1WLM A;  1J7P A;  2KI4 C;  2M49 B;  1YRT B;  4C0J A;  3CR2 A;  1CFC A;  4PHM A;  4YGD B;  1PVB A;  2EHB A;  3JVT C;  1N2D A;  1K90 D;  2Y4Q A;  1DJI A;  4PCW A;  1W7J B;  2KI4 B;  3PAT A;  5CPV A;  1IWQ A;  3BUN B;  5ER4 X;  2EGD A;  4OV2 A;  2NXQ A;  4N1F A;  3DVM A;  1WLZ A;  2KQ6 A;  1K9P A;  1M63 B;  1OOJ A;  1DVI A;  2I94 A;  4ZCV A;  1DTL A;  3JVT B;  3EK7 A;  1S6C A;  1DGV A;  1SNL A;  4I5J A;  2V53 A;  3CZT X;  2HET A;  3KO0 A;  1DF0 B;  1CKK A;  1VRK A;  1QJT A;  2L4H A;  4YI8 A;  1CDM A;  1QX2 A;  2NCO A;  2ZN9 A;  4PHJ A;  1SL9 A;  4BY5 A;  2GV5 A;  3BUM B;  1K96 A;  1S1E A;  2SCP A;  4AQJ A;  3A4U B;  2JT8 A;  1B8L A;  2M1U A;  2JU0 A;  1ALV A;  2Y1M A;  1U5I B;  1CDN A;  3SG7 A;  2LAN A;  4C0L A;  1SY9 A;  1AK8 A;  2LCP A;  2MRD A;  4JPZ B;  3PLF B;  1IKU A;  1AP4 A;  4AOM A;  3I5I C;  1B1G A;  1F4O A;  1LKJ A;  5D7F A;  5GQQ C;  3LL8 B;  2Y5I A;  3BUX B;  4MSP A;  1C7V A;  1JF2 A;  1K9K A;  4FQO A;  3VRQ A;  5I8N A;  1TCO B;  1OZO A;  1S6J A;  2BCX A;  1XVJ A;  2CTN A;  3DF0 B;  3I5I B;  2WOR A;  1L7Z A;  1F8H A;  3M0W A;  1WRK A;  2LLT A;  2M7N A;  4C0K A;  2B1U A;  1J1D A;  2LP2 A;  1NUB A;  2LVV A;  2BKI B;  2KQY A;  1S26 D;  1TOP A;  1KFU L;  4XJK B;  5KTY A;  1OMV A;  2JTZ A;  3SIA A;  1SK6 D;  1EJ3 A;  4JQ0 D;  2F8P A;  2L4I A;  3MSE B;  1UHH A;  1N0Y A;  2JUL A;  3NSK A;  2K7D A;  1AJ4 A;  2JPT A;  1NX3 A;  4MRX A;  3TUY C;  2LAP A;  1KWO C;  5CSJ A;  1K8U A;  2NZ0 A;  3AKA A;  1MUX A;  2RGI A;  3EKH A;  1OMR A;  3BYA A;  3NSI A;  1MF8 B;  2K2F A;  3TUY B;  2PAS A;  1JF0 A;  4ORA B;  1KWO B;  1ZOT B;  1MXE A;  1XO5 A;  1JBA A;  2BBM A;  2KSP A;  1PVA A;  1XYD A;  2K7C A;  3HX4 A;  1XFV O;  1ZMZ A;  2K8M B;  3CR5 X;  4N1G A;  4DS7 A;  4GGN A;  1A75 A;  3NSL A;  2E30 A;  3TDZ A;  4GGF C;  1JC2 A;  3WHU B;  1W7I B;  1EL4 A;  2ZKM X;  4UPG A;  2BE6 A;  4DCK A;  1QTX A;  3SIB A;  3DVJ A;  3FIA A;  2LE9 B;  1S36 A;  1SRA A;  1IGV A;  1Y0V H;  4MZK A;  3BXK A;  1F55 A;  4GBA A;  4CFR A;  3FS7 A;  5HYD A;  1RFJ A;  1X02 A;  1YX8 A;  4YRU A;  2F33 A;  2G2B A;  2PSR A;  2PRU A;  2JXC A;  1UHI A;  2AMI A;  1MQ1 A;  2M1K B;  1CTR A;  1DJG A;  1OE9 B;  2KBI A;  3ZWH A;  1NCZ A;  2KAX A;  2QAC A;  3EVU A;  1Y1X A;  4MEW A;  1D1O A;  3LCP C;  2WCB A;  5ER5 A;  1FF1 A;  3BQ3 A;  4WQ3 A;  2BCB A;  3OX6 A;  4GAO A;  2LV7 A;  3PSR A;  2H2K A;  1IQ5 A;  4DRW A;  4MBE A;  1A4P A;  1CLM A;  1LXF C;  1XK4 A;  2F3Y A;  1QS7 A;  2WND A;  5G08 A;  1CB1 A;  1S5G Y;  1Y1A A;  2MA2 A;  2KGR A;  2CT9 A;  1K94 A;  2MHH A;  1NSH A;  1RJV A;  1CFF A;  1C7W A;  1RWY A;  3VRN A;  1BMO A;  4JWQ A;  1A2X A;  1LA0 A;  1AVS A;  1BG1 A;  5I2Q A;  1JFJ A;  2JNX A;  1SKT A;  3A8R A;  2H61 A;  1XFX O;  1DJY A;  2KAY A;  2JC2 A;  2KFF A;  3O6B A;  3WHT B;  1KFU S;  3BUW B;  2OTG C;  1CM1 A;  1KQM C;  5CSN A;  2BE4 A;  1GQM A;  1KSO A;  4CFQ A;  2JT3 A;  3AAJ A;  2EC6 C;  4ORC B;  4Q04 A;  1YUR A;  2LP3 A;  3PM8 A;  1F54 A;  1SL8 A;  4YGA A;  4HSZ A;  3TS5 C;  2LMU A;  1MR8 A;  4MZJ A;  1S3P A;  2NLN A;  4PAL A;  2OTG B;  3SG3 A;  1DJH A;  1KQM B;  1TNW A;  1TIZ A;  1V1G A;  2KYC A;  3BOW A;  1PAL A;  4DUQ A;  3CTN A;  2EC6 B;  2JOJ A;  4M2P A;  4M2Q A;  2DOQ A;  2JT0 A;  3OX5 A;  5TNC A;  3TS5 B;  1DJZ A;  1CMF A;  5AAN A;  1AJ5 A;  1SPY A;  1YR5 A;  4YGC B;  3D0Y B;  2JRF A;  1CFD A;  1YX7 A;  2Q91 A;  1JWD A;  1C07 A;  3TDU A;  2P6B B;  3PAL A;  5K89 A;  1Y6W A;  3HCM A;  5I2O A;  5D69 A;  1YUS A;  1K2H A;  1BLQ A;  1ALW A;  2AAO A;  2LVJ A;  2O5G A;  2ISD A;  3VRP A;  3KHE A;  2L2E A;  4ICB A;  4ZCU A;  2LC5 A;  5DKN A;  4HRH A;  3RM1 A;  3VRR A;  4CID A;  5KU1 A;  1QXP A;  3I5H C;  1K93 D;  2CBL A;  2COL B;  2LHL A;  1F71 A;  1DGU A;  1OQP A;  1KSM A;  2L0P A;  1EH2 A;  1LVC D;  5JOL A;  2HF5 A;  1DF0 A;  4WQ2 A;  1F4Q A;  1FI6 A;  3I5H B;  1SMG A;  5AER A;  1GGZ A;  2MLE C;  3DD4 A;  1L2O C;  3GK2 A;  2M3W A;  2BBN A; 
#chains in the Genus database with same CATH topology
 1SW8 A;  3L4A A;  1B7T Y;  1FW4 A;  1JFK A;  1TRF A;  1WRZ A;  3DVK A;  3OGN A;  3S0A A;  4GNK B;  2I7A A;  2MJW B;  2YGU A;  1M45 A;  3JTD C;  1B4C A;  1PRW A;  1IJ6 A;  3KF9 A;  3O2P A;  1U5I A;  3V2L A;  1CNP A;  1YTZ C;  2I2R E;  1L2O B;  1IQ3 A;  5PAL A;  5FI2 A;  4M2O A;  2KAV A;  2LUX A;  1KFX S;  2LLS A;  2LLU A;  3PJI A;  1DJX A;  1G8I A;  1K95 A;  1TN4 A;  3FWC A;  3JTD B;  4I5N B;  1J7Q A;  1WY9 A;  3D73 A;  1ODB A;  1WDC C;  2QDI A;  1RTP 1;  1TNP A;  2PMY A;  4XYN A;  1CMG A;  1AUI B;  4PE7 A;  3BFA A;  2QEB A;  2NCP A;  4MZL A;  2JXL A;  3CWG A;  1QIV A;  4OCI A;  3DF0 A;  1DT7 B;  1KCY A;  3D77 A;  4NDB A;  3CZ0 A;  1JUO A;  4CPV A;  2GGZ A;  2KFG A;  2FCD A;  4USL A;  3GK4 X;  2M8U A;  4NDD A;  1WDC B;  1WRL A;  1BU3 A;  4L9M A;  1KK7 Y;  1OZS A;  4AQI A;  3CGA A;  1IIO A;  4P5O E;  3S0G A;  5HKW A;  4XJK A;  4ORB B;  3NXA A;  2BEC A;  1TNX A;  2L50 A;  4N5X A;  5HLO A;  1ZFS A;  3SG4 A;  3SJS A;  1TUJ A;  3QRX A;  2L2C A;  1NX1 A;  4HRG A;  3FE9 A;  2JPO A;  3IQQ A;  1BOC A;  1CM4 A;  2FJU B;  1BR1 B;  3BUO B;  1SR6 C;  4YBH B;  5HKZ A;  1UP5 A;  1KK8 C;  2D8N A;  1OOH A;  3ZNI A;  1BT6 A;  2CXJ A;  1NPQ A;  3KPX A;  1SSE B;  1KFX L;  1UHJ A;  3N7H A;  3IVT A;  1NIW A;  1FBV A;  1M46 A;  4P2Y B;  1G33 A;  1QX7 A;  2KBM A;  1RK9 A;  5F6T A;  1KK7 Z;  3F45 A;  1LIN A;  3UNW A;  1TCF A;  3L47 A;  3R1V A;  1BR4 B;  1SR6 B;  1M39 A;  2LMV A;  1XFZ O;  3EVR A;  2WCM A;  4TNC A;  1FI5 A;  1GGW A;  2HPS A;  1JSA A;  1KK8 B;  1G4Y R;  1YVH A;  2R2I A;  2JTT A;  2OPO A;  3BOW B;  3VRO A;  3PM2 A;  3QME A;  4F7F A;  1QLK A;  2KGB C;  1IG5 A;  1XFY O;  2K2A A;  5AXI A;  1OSA A;  4R1E A;  2Q4U A;  1QLS A;  2VRG A;  2WCE A;  2WCJ A;  4GGF A;  4U8D A;  1P28 A;  1FPW A;  2KOT A;  2L51 A;  3I5G C;  2Y1N A;  3O78 A;  2KHN A;  3R1P A;  1K9U A;  1XFW O;  2K7O A;  2SAS A;  3OP0 A;  1BJF A;  1XFU O;  3CDN A;  2LNK A;  1REC A;  1S5G Z;  5CSF A;  2OS8 C;  2JQ6 A;  3AAK A;  1OMD A;  1HQV A;  3I5G B;  4YGE B;  1HT9 A;  1UUS A;  1Y1U A;  2LUC A;  2KYF A;  3LLE A;  3TZ1 A;  4HRE E;  1EXR A;  3VGO A;  5BPJ A;  1H4B A;  2ZN8 A;  4QJ5 B;  1UWO A;  4IL1 A;  3PN7 C;  3CZ2 A;  1CDP A;  4GPL B;  2ZRS A;  3NSO A;  4MLW A;  2OS8 B;  2JNF A;  1YVL A;  3ICB A;  1LS8 A;  1A03 A;  2JWW A;  1PSR A;  1GJY A;  2F2P A;  1S6I A;  1UHN A;  3CAB A;  1UUR A;  2WOS A;  5DIC A;  4A4C A;  2L98 A;  3PN7 B;  1LA3 A;  3LK0 A;  5FI6 A;  3RLZ A;  3OB1 B;  1TTX A;  5B8I B;  5HL1 A;  4PT1 A;  3O4Y A;  2M29 A;  2FCE A;  3NHT A;  4FTG A;  4YGB B;  3L4L A;  2ZND A;  2LHI A;  1H8B A;  1CLB A;  5JJG A;  1IJ5 A;  2WC8 A;  3IF7 A;  1IRJ A;  1R6P A;  1SCM C;  2AUC A;  2CNP A;  1J7O A;  3BJH A;  2G9B A;  1QAT A;  1BOD A;  1J55 A;  3CLN A;  2KFH A;  1NX2 A;  1SBJ A;  1TUZ A;  1ZAC A;  4PHK A;  2I18 A;  5HKY A;  4PDZ A;  4YI9 A;  1CLL A;  1MWN A;  3D78 A;  3WNX B;  2M7L A;  2MLF C;  1YUT A;  1SCM B;  2L5X B;  1QX5 B;  2M9G A;  3OB2 B;  1B9A A;  1YRU B;  1A75 B;  3K21 A;  1XA5 A;  4I5L B;  3TDI A;  2O60 A;  1SYM A;  1NP8 A;  2ZNE A;  1XFR A;  1RRO A;  4PE0 A;  4MN0 A;  1J7R A;  1F70 A;  2ZRT A;  1SL7 A;  3R1O A;  2KI6 D;  2WC6 A;  3FWB A;  1IH0 A;  3O4X A;  3D10 A;  1QV0 A;  2BCA A;  3D0Y A;  2QPT A;  3DXL A;  4PE4 A;  2MAZ A;  3DVE A;  2M0R A;  3E3R A;  4NDC A;  3VB1 A;  4DIR A;  4F0Z B;  3GK1 A;  4GFT A;  3OHM B;  4INW A;  2PAL A;  3SG5 A;  1QWV A;  5IBW A;  4I5K A;  5KSZ A;  3D75 A;  4ETO A;  4WRI A;  1UHK A;  1PSB A;  2PVB A;  3LK1 A;  1XK4 C;  4INX A;  2KI6 C;  3C1V A;  3DYE A;  3EVV A;  2IS9 A;  3B88 A;  2LMT A;  2BKH B;  1W9Z A;  1YUU A;  3SG6 A;  1EG3 A;  3EK4 A;  1CDL A;  2K7B A;  1QAS A;  1ZUZ A;  1B7T Z;  5DKQ A;  1M31 A;  2KNE A;  2GGM A;  1A29 A;  3WXA A;  2HQ8 A;  4BY4 A;  4KYN A;  5HLV A;  2H61 C;  3K1E A;  5FYX A;  4GUK A;  5FI7 A;  1QIW A;  5AFP A;  4CLN A;  2F2O A;  3CS1 A;  1B47 A;  1QVI Y;  2CCM A;  2FJY A;  3CYZ A;  2L5Y A;  3PFV A;  2M97 A;  1T14 A;  1J1E A;  2LVK A;  5I2L A;  4PE1 A;  3DY9 A;  2LVI A;  1NX0 A;  3SG2 A;  3H4S E;  3SS4 A;  3KEV A;  5AEQ A;  4OKH A;  1R2U A;  1DMO A;  4PHN A;  4QJ4 B;  3IQO A;  4NQG A;  2BL0 C;  2TN4 A;  1NWD A;  1PUL A;  2WCF A;  3B7A A;  1B8R A;  1AHR A;  2F3Z A;  2WCH A;  1PK0 D;  2E6W A;  2GTE A;  4D1E A;  1KQV A;  3UO9 A;  4OR9 B;  1V1F A;  5J3X A;  1SCV A;  2LM5 A;  1NCY A;  1N65 A;  1E8A A;  4MRY A;  5CSI A;  2MBX A;  2ZFD A;  1CFP A;  1DJW A;  4MVF A;  3CR4 X;  4OVN F;  2BL0 B;  2FOT A;  2HQW A;  3EK8 A;  2A4J A;  2KDH A;  1OW4 A;  3I5F B;  1MHO A;  1MXL C;  2JZI A;  1NCX A;  4A4B A;  3B6X A;  3RZS A;  1EG4 A;  1QV1 A;  4QJ3 B;  3GOF A;  1Q80 A;  2KPH A;  1BF5 A;  1QVI Z;  3B86 A;  1TNQ A;  2K0J A;  1B8C A;  3AKB A;  3EKJ A;  4JD9 A;  2K61 A;  5DKR A;  4E68 A;  1NYA A;  1WLM A;  1J7P A;  2KI4 C;  2M49 B;  1YRT B;  4C0J A;  3CR2 A;  1CFC A;  4PHM A;  4YGD B;  1PVB A;  2EHB A;  3OBV A;  3JVT C;  1N2D A;  1K90 D;  2Y4Q A;  1DJI A;  4PCW A;  1W7J B;  2KI4 B;  3PAT A;  5CPV A;  1IWQ A;  3BUN B;  5ER4 X;  2EGD A;  4OV2 A;  2PQL A;  2NXQ A;  4N1F A;  3DVM A;  1WLZ A;  2KQ6 A;  3FE8 A;  1K9P A;  1M63 B;  1OOJ A;  1DVI A;  3CZ1 A;  2I94 A;  4ZCV A;  1DTL A;  3JVT B;  3EK7 A;  1S6C A;  1DGV A;  1SNL A;  4I5J A;  2V53 A;  3CZT X;  2HET A;  3KO0 A;  1DF0 B;  1CKK A;  1VRK A;  1QJT A;  2L4H A;  4YI8 A;  3Q8I A;  1CDM A;  1QX2 A;  2NCO A;  2ZN9 A;  4PHJ A;  1SL9 A;  4BY5 A;  2GV5 A;  3BUM B;  1K96 A;  1S1E A;  2SCP A;  4AQJ A;  3S0D A;  3A4U B;  2JT8 A;  1B8L A;  2M1U A;  2JU0 A;  1ALV A;  2Y1M A;  1U5I B;  1CDN A;  3SG7 A;  2LAN A;  4C0L A;  1SY9 A;  1AK8 A;  2LCP A;  2MRD A;  4JPZ B;  3PLF B;  1IKU A;  3BFB A;  1AP4 A;  4AOM A;  3I5I C;  1B1G A;  1F4O A;  1LKJ A;  5D7F A;  5GQQ C;  3LL8 B;  2Y5I A;  3BUX B;  4MSP A;  5I94 A;  3SS5 A;  1C7V A;  1JF2 A;  1K9K A;  4FQO A;  3VRQ A;  5I8N A;  1OOF A;  1OZO A;  1TCO B;  4IJ7 A;  1S6J A;  2BCX A;  1XVJ A;  2CTN A;  3DF0 B;  2KLE A;  1C3Y A;  3I5I B;  2WOR A;  1L7Z A;  1F8H A;  3D74 A;  3M0W A;  1WRK A;  2LLT A;  2M7N A;  4C0K A;  2B1U A;  1J1D A;  2LP2 A;  1NUB A;  2LVV A;  2BKI B;  2KQY A;  1S26 D;  1TOP A;  1KFU L;  4XJK B;  5KTY A;  1OMV A;  2JTZ A;  3SIA A;  1SK6 D;  1EJ3 A;  4JQ0 D;  2F8P A;  2L4I A;  3MSE B;  1UHH A;  1N0Y A;  2QEH A;  2JUL A;  3NSK A;  2K7D A;  3R72 A;  1AJ4 A;  2JPT A;  1NX3 A;  4MRX A;  3DZT A;  3TUY C;  2LAP A;  1KWO C;  5CSJ A;  1K8U A;  3NHI A;  2NZ0 A;  3EG5 B;  3AKA A;  1MUX A;  2RGI A;  3EKH A;  1Z4H A;  1OMR A;  3SS3 A;  3BYA A;  2BAP A;  3NSI A;  1MF8 B;  2PYQ A;  2K2F A;  3TUY B;  2PAS A;  1JF0 A;  4ORA B;  1KWO B;  1ZOT B;  1MXE A;  1XO5 A;  1JBA A;  2BBM A;  2KSP A;  1PVA A;  1XYD A;  2K7C A;  3HX4 A;  1XFV O;  1ZMZ A;  2K8M B;  3CR5 X;  4N1G A;  4DS7 A;  4GGN A;  1A75 A;  3NSL A;  2E30 A;  3S0E A;  3TDZ A;  4GGF C;  1JC2 A;  3WHU B;  1W7I B;  1EL4 A;  2WC5 A;  2ZKM X;  4UPG A;  2BE6 A;  4DCK A;  1QTX A;  3SIB A;  3DVJ A;  3B87 A;  3FIA A;  1OOI X;  2LE9 B;  1S36 A;  1SRA A;  1IGV A;  1Y0V H;  4MZK A;  2WCL A;  3BXK A;  1F55 A;  4GBA A;  4CFR A;  3FS7 A;  5HYD A;  1RFJ A;  1X02 A;  1YX8 A;  1DC1 A;  4YRU A;  2F33 A;  2G2B A;  2PSR A;  2PRU A;  1DQE A;  2JXC A;  1UHI A;  2AMI A;  1MQ1 A;  2M1K B;  1CTR A;  1DJG A;  1OE9 B;  2KBI A;  1DEL A;  3ZWH A;  1NCZ A;  2KAX A;  2QAC A;  3EVU A;  1Y1X A;  4MEW A;  1D1O A;  3LCP C;  2P71 A;  4FQT A;  1ORG A;  2WCB A;  2QEO A;  5ER5 A;  1FF1 A;  3BQ3 A;  4WQ3 A;  2BCB A;  3OX6 A;  4GAO A;  2LV7 A;  3PSR A;  2H2K A;  1IQ5 A;  4DRW A;  4MBE A;  1A4P A;  1CLM A;  1LXF C;  1XK4 A;  2F3Y A;  1QS7 A;  2WND A;  5G08 A;  1CB1 A;  1S5G Y;  1Y1A A;  3NGV A;  4JKT A;  2MA2 A;  2KGR A;  2CT9 A;  1K94 A;  2MHH A;  1NSH A;  2KLD A;  1RJV A;  4OZD A;  1CFF A;  1C7W A;  1RWY A;  3VRN A;  1BMO A;  2P70 A;  4JWQ A;  1A2X A;  1LA0 A;  5EL2 A;  1AVS A;  1BG1 A;  5I2Q A;  1JFJ A;  2JNX A;  1SKT A;  3A8R A;  2H8V A;  3BFH A;  2BNX A;  2H61 A;  1XFX O;  1DJY A;  2K60 A;  5D3O A;  2KAY A;  2JC2 A;  2KFF A;  3O6B A;  3WHT B;  3D76 A;  1KFU S;  3BUW B;  2OTG C;  1CM1 A;  1KQM C;  5CSN A;  2BE4 A;  1GQM A;  1KSO A;  2ERB A;  4CFQ A;  2JT3 A;  3AAJ A;  3FE6 A;  2EC6 C;  4ORC B;  4Q04 A;  1YUR A;  2LP3 A;  3PM8 A;  1F54 A;  1SL8 A;  4YGA A;  4HSZ A;  3TS5 C;  2LMU A;  1MR8 A;  4MZJ A;  1S3P A;  2NLN A;  2QEV A;  4PAL A;  2OTG B;  3SG3 A;  1DJH A;  1KQM B;  1TNW A;  3S0F A;  1GM0 A;  1TIZ A;  1V1G A;  2KYC A;  3BOW A;  1PAL A;  4DUQ A;  3CTN A;  2EC6 B;  1OOG A;  2JOJ A;  4M2P A;  4M2Q A;  2DOQ A;  2JT0 A;  3OX5 A;  5TNC A;  3TS5 B;  1DJZ A;  1CMF A;  5AAN A;  1AJ5 A;  1TWO A;  1SPY A;  1YR5 A;  4YGC B;  3D0Y B;  2JRF A;  1CFD A;  1YX7 A;  1C3Z A;  1DEK A;  2Q91 A;  1C07 A;  1JWD A;  3TDU A;  3S0B A;  2P6B B;  3PAL A;  5K89 A;  1Y6W A;  3HCM A;  5I2O A;  5D69 A;  1YUS A;  1K2H A;  1BLQ A;  1ALW A;  2AAO A;  2LVJ A;  1Z2C B;  2O5G A;  2ISD A;  3VRP A;  3KHE A;  2L2E A;  4ICB A;  4ZCU A;  2LC5 A;  5DKN A;  4HRH A;  3RM1 A;  3VRR A;  4CID A;  5KU1 A;  1QXP A;  3I5H C;  1K93 D;  2CBL A;  2WCK A;  2COL B;  2LHL A;  1F71 A;  1DGU A;  1OQP A;  1KSM A;  2L0P A;  1EH2 A;  1LVC D;  5JOL A;  2HF5 A;  1DF0 A;  4WQ2 A;  1F4Q A;  1FI6 A;  3I5H B;  1SMG A;  3I5F C;  1GGZ A;  5AER A;  2MLE C;  3DD4 A;  1L2O C;  3GK2 A;  2M3W A;  2BBN A; 
#chains in the Genus database with same CATH homology
 1SW8 A;  1B7T Y;  1FW4 A;  1JFK A;  1TRF A;  1WRZ A;  3DVK A;  4GNK B;  2I7A A;  2MJW B;  1M45 A;  3JTD C;  1B4C A;  1PRW A;  1IJ6 A;  3KF9 A;  3O2P A;  1U5I A;  1CNP A;  1YTZ C;  2I2R E;  1L2O B;  1IQ3 A;  5PAL A;  4M2O A;  2KAV A;  2LUX A;  1KFX S;  2LLS A;  2LLU A;  1DJX A;  1G8I A;  1K95 A;  1TN4 A;  3FWC A;  3JTD B;  4I5N B;  1J7Q A;  1WY9 A;  1ODB A;  1WDC C;  1RTP 1;  1TNP A;  2PMY A;  4XYN A;  1CMG A;  1AUI B;  4PE7 A;  2NCP A;  4MZL A;  2JXL A;  3CWG A;  1QIV A;  4OCI A;  3DF0 A;  1DT7 B;  1KCY A;  4NDB A;  1JUO A;  4CPV A;  2GGZ A;  2KFG A;  2FCD A;  4USL A;  3GK4 X;  2M8U A;  4NDD A;  1WDC B;  1WRL A;  1BU3 A;  4L9M A;  1KK7 Y;  1OZS A;  4AQI A;  3CGA A;  4P5O E;  5HKW A;  4XJK A;  4ORB B;  3NXA A;  2BEC A;  1TNX A;  2L50 A;  4N5X A;  5HLO A;  1ZFS A;  3SG4 A;  3SJS A;  3QRX A;  1NX1 A;  4HRG A;  3IQQ A;  1BOC A;  1CM4 A;  2FJU B;  1BR1 B;  3BUO B;  1SR6 C;  4YBH B;  5HKZ A;  1UP5 A;  1KK8 C;  2D8N A;  3ZNI A;  1BT6 A;  2CXJ A;  1NPQ A;  3KPX A;  1UHJ A;  1KFX L;  1NIW A;  1FBV A;  1M46 A;  4P2Y B;  1G33 A;  1QX7 A;  2KBM A;  1RK9 A;  5F6T A;  1KK7 Z;  3F45 A;  1LIN A;  1TCF A;  1BR4 B;  1SR6 B;  1M39 A;  2LMV A;  1XFZ O;  3EVR A;  4TNC A;  1GGW A;  1FI5 A;  2HPS A;  1JSA A;  1KK8 B;  1G4Y R;  1YVH A;  2R2I A;  2JTT A;  2OPO A;  3BOW B;  3VRO A;  1QLK A;  2KGB C;  1IG5 A;  1XFY O;  2K2A A;  5AXI A;  1OSA A;  4R1E A;  2Q4U A;  1QLS A;  2VRG A;  2WCE A;  4GGF A;  4U8D A;  1FPW A;  2KOT A;  2L51 A;  3I5G C;  2Y1N A;  3O78 A;  2KHN A;  1K9U A;  1XFW O;  2K7O A;  2SAS A;  3OP0 A;  1BJF A;  1XFU O;  2LNK A;  1REC A;  1S5G Z;  5CSF A;  2OS8 C;  2JQ6 A;  3AAK A;  1OMD A;  1HQV A;  3I5G B;  4YGE B;  1HT9 A;  1UUS A;  1Y1U A;  2LUC A;  2KYF A;  3LLE A;  3TZ1 A;  4HRE E;  1EXR A;  3VGO A;  5BPJ A;  1H4B A;  2ZN8 A;  4QJ5 B;  1UWO A;  4IL1 A;  3PN7 C;  1CDP A;  4GPL B;  2ZRS A;  3NSO A;  4MLW A;  2OS8 B;  2JNF A;  1YVL A;  3ICB A;  1A03 A;  2JWW A;  1PSR A;  1GJY A;  2F2P A;  1S6I A;  1UHN A;  1UUR A;  2WOS A;  4A4C A;  2L98 A;  3PN7 B;  1LA3 A;  3LK0 A;  3RLZ A;  3OB1 B;  1TTX A;  5B8I B;  3O4Y A;  2M29 A;  2FCE A;  4FTG A;  4YGB B;  2ZND A;  2LHI A;  1H8B A;  1CLB A;  5JJG A;  1IJ5 A;  2WC8 A;  3IF7 A;  1IRJ A;  1R6P A;  1SCM C;  2AUC A;  2CNP A;  1J7O A;  2G9B A;  1QAT A;  1BOD A;  1J55 A;  3CLN A;  2KFH A;  1NX2 A;  1SBJ A;  1ZAC A;  4PHK A;  2I18 A;  5HKY A;  4PDZ A;  4YI9 A;  1CLL A;  1MWN A;  3WNX B;  2M7L A;  2MLF C;  1YUT A;  1SCM B;  2L5X B;  1QX5 B;  2M9G A;  3OB2 B;  1B9A A;  1YRU B;  1A75 B;  3K21 A;  1XA5 A;  4I5L B;  3TDI A;  2O60 A;  1SYM A;  1NP8 A;  2ZNE A;  1RRO A;  4PE0 A;  4MN0 A;  1J7R A;  1F70 A;  2ZRT A;  1SL7 A;  1IH0 A;  2KI6 D;  3FWB A;  3D10 A;  1QV0 A;  2BCA A;  3D0Y A;  2QPT A;  4PE4 A;  2MAZ A;  3DVE A;  2M0R A;  3E3R A;  4NDC A;  4DIR A;  4F0Z B;  3GK1 A;  4GFT A;  3OHM B;  2PAL A;  3SG5 A;  5IBW A;  4I5K A;  5KSZ A;  4ETO A;  4WRI A;  1UHK A;  1PSB A;  2PVB A;  3LK1 A;  1XK4 C;  2KI6 C;  3C1V A;  3EVV A;  2IS9 A;  2LMT A;  2BKH B;  1YUU A;  3SG6 A;  1EG3 A;  3EK4 A;  1CDL A;  2K7B A;  1QAS A;  1ZUZ A;  1B7T Z;  5DKQ A;  1M31 A;  2KNE A;  2GGM A;  1A29 A;  3WXA A;  2HQ8 A;  4BY4 A;  5HLV A;  2H61 C;  5FYX A;  4GUK A;  1QIW A;  5AFP A;  4CLN A;  2F2O A;  3CS1 A;  1B47 A;  1QVI Y;  2CCM A;  3PFV A;  2M97 A;  1J1E A;  2LVK A;  5I2L A;  4PE1 A;  2LVI A;  1NX0 A;  3SG2 A;  3H4S E;  3KEV A;  5AEQ A;  4OKH A;  1R2U A;  1DMO A;  4PHN A;  4QJ4 B;  3IQO A;  4NQG A;  2BL0 C;  2TN4 A;  1NWD A;  1PUL A;  2WCF A;  3I5F C;  1B8R A;  1AHR A;  2F3Z A;  4A4B A;  1PK0 D;  2E6W A;  4D1E A;  1KQV A;  4OR9 B;  1V1F A;  5J3X A;  1SCV A;  2LM5 A;  1NCY A;  1N65 A;  1E8A A;  4MRY A;  5CSI A;  2MBX A;  2ZFD A;  1CFP A;  1DJW A;  4MVF A;  3CR4 X;  4OVN F;  2BL0 B;  2FOT A;  2HQW A;  3EK8 A;  2A4J A;  2KDH A;  3I5F B;  1MHO A;  1MXL C;  2JZI A;  1NCX A;  1EG4 A;  1QV1 A;  4QJ3 B;  3GOF A;  1Q80 A;  1BF5 A;  1QVI Z;  1TNQ A;  2K0J A;  1B8C A;  3AKB A;  3EKJ A;  5DKR A;  2K61 A;  4E68 A;  1NYA A;  1WLM A;  1J7P A;  2KI4 C;  2M49 B;  1YRT B;  4C0J A;  3CR2 A;  1CFC A;  4PHM A;  4YGD B;  1PVB A;  2EHB A;  3JVT C;  1N2D A;  1K90 D;  2Y4Q A;  1DJI A;  4PCW A;  1W7J B;  2KI4 B;  3PAT A;  5CPV A;  1IWQ A;  3BUN B;  5ER4 X;  2EGD A;  4OV2 A;  2NXQ A;  4N1F A;  3DVM A;  1WLZ A;  2KQ6 A;  1K9P A;  1M63 B;  1OOJ A;  1DVI A;  2I94 A;  4ZCV A;  1DTL A;  3JVT B;  3EK7 A;  1S6C A;  1DGV A;  1SNL A;  4I5J A;  2V53 A;  3CZT X;  2HET A;  3KO0 A;  1DF0 B;  1CKK A;  1VRK A;  1QJT A;  2L4H A;  4YI8 A;  1CDM A;  1QX2 A;  2NCO A;  2ZN9 A;  4PHJ A;  1SL9 A;  4BY5 A;  2GV5 A;  3BUM B;  1K96 A;  1S1E A;  2SCP A;  4AQJ A;  3A4U B;  2JT8 A;  1B8L A;  2M1U A;  2JU0 A;  1ALV A;  2Y1M A;  1U5I B;  1CDN A;  3SG7 A;  2LAN A;  4C0L A;  1SY9 A;  1AK8 A;  2LCP A;  2MRD A;  4JPZ B;  3PLF B;  1IKU A;  1AP4 A;  4AOM A;  3I5I C;  1B1G A;  1F4O A;  1LKJ A;  5D7F A;  5GQQ C;  3LL8 B;  2Y5I A;  3BUX B;  4MSP A;  1C7V A;  1JF2 A;  1K9K A;  4FQO A;  3VRQ A;  5I8N A;  1TCO B;  1OZO A;  1S6J A;  2BCX A;  1XVJ A;  2CTN A;  3DF0 B;  3I5I B;  2WOR A;  1L7Z A;  1F8H A;  3M0W A;  1WRK A;  2LLT A;  2M7N A;  4C0K A;  2B1U A;  1J1D A;  2LP2 A;  1NUB A;  2LVV A;  2BKI B;  2KQY A;  1S26 D;  1TOP A;  1KFU L;  4XJK B;  5KTY A;  1OMV A;  2JTZ A;  3SIA A;  1SK6 D;  1EJ3 A;  4JQ0 D;  2F8P A;  2L4I A;  3MSE B;  1UHH A;  1N0Y A;  2JUL A;  3NSK A;  2K7D A;  1AJ4 A;  2JPT A;  1NX3 A;  4MRX A;  3TUY C;  2LAP A;  1KWO C;  5CSJ A;  1K8U A;  2NZ0 A;  3AKA A;  1MUX A;  2RGI A;  3EKH A;  1OMR A;  3BYA A;  3NSI A;  1MF8 B;  2K2F A;  3TUY B;  2PAS A;  1JF0 A;  4ORA B;  1KWO B;  1ZOT B;  1MXE A;  1XO5 A;  1JBA A;  2BBM A;  2KSP A;  1PVA A;  1XYD A;  2K7C A;  3HX4 A;  1XFV O;  1ZMZ A;  2K8M B;  3CR5 X;  4N1G A;  4DS7 A;  4GGN A;  1A75 A;  3NSL A;  2E30 A;  3TDZ A;  4GGF C;  1JC2 A;  3WHU B;  1W7I B;  1EL4 A;  2ZKM X;  4UPG A;  2BE6 A;  4DCK A;  1QTX A;  3SIB A;  3DVJ A;  3FIA A;  2LE9 B;  1S36 A;  1SRA A;  1IGV A;  1Y0V H;  4MZK A;  3BXK A;  1F55 A;  4GBA A;  4CFR A;  3FS7 A;  5HYD A;  1RFJ A;  1X02 A;  1YX8 A;  4YRU A;  2F33 A;  2G2B A;  2PSR A;  2PRU A;  2JXC A;  1UHI A;  2AMI A;  1MQ1 A;  2M1K B;  1CTR A;  1DJG A;  1OE9 B;  2KBI A;  3ZWH A;  1NCZ A;  2KAX A;  2QAC A;  3EVU A;  1Y1X A;  4MEW A;  1D1O A;  3LCP C;  2WCB A;  5ER5 A;  1FF1 A;  3BQ3 A;  4WQ3 A;  2BCB A;  3OX6 A;  4GAO A;  2LV7 A;  3PSR A;  2H2K A;  1IQ5 A;  4DRW A;  4MBE A;  1A4P A;  1CLM A;  1LXF C;  1XK4 A;  2F3Y A;  1QS7 A;  2WND A;  5G08 A;  1CB1 A;  1S5G Y;  1Y1A A;  2MA2 A;  2KGR A;  2CT9 A;  1K94 A;  2MHH A;  1NSH A;  1RJV A;  1CFF A;  1C7W A;  1RWY A;  3VRN A;  1BMO A;  4JWQ A;  1A2X A;  1LA0 A;  1AVS A;  1BG1 A;  5I2Q A;  1JFJ A;  2JNX A;  1SKT A;  3A8R A;  2H61 A;  1XFX O;  1DJY A;  2KAY A;  2JC2 A;  2KFF A;  3O6B A;  3WHT B;  1KFU S;  3BUW B;  2OTG C;  1CM1 A;  1KQM C;  5CSN A;  2BE4 A;  1GQM A;  1KSO A;  4CFQ A;  2JT3 A;  3AAJ A;  2EC6 C;  4ORC B;  4Q04 A;  1YUR A;  2LP3 A;  3PM8 A;  1F54 A;  1SL8 A;  4YGA A;  4HSZ A;  3TS5 C;  2LMU A;  1MR8 A;  4MZJ A;  1S3P A;  2NLN A;  4PAL A;  2OTG B;  3SG3 A;  1DJH A;  1KQM B;  1TNW A;  1TIZ A;  1V1G A;  2KYC A;  3BOW A;  1PAL A;  4DUQ A;  3CTN A;  2EC6 B;  2JOJ A;  4M2P A;  4M2Q A;  2DOQ A;  2JT0 A;  3OX5 A;  5TNC A;  3TS5 B;  1DJZ A;  1CMF A;  5AAN A;  1AJ5 A;  1SPY A;  1YR5 A;  4YGC B;  3D0Y B;  2JRF A;  1CFD A;  1YX7 A;  2Q91 A;  1JWD A;  1C07 A;  3TDU A;  2P6B B;  3PAL A;  5K89 A;  1Y6W A;  3HCM A;  5I2O A;  5D69 A;  1YUS A;  1K2H A;  1BLQ A;  1ALW A;  2AAO A;  2LVJ A;  2O5G A;  2ISD A;  3VRP A;  3KHE A;  2L2E A;  4ICB A;  4ZCU A;  2LC5 A;  5DKN A;  4HRH A;  3RM1 A;  3VRR A;  4CID A;  5KU1 A;  1QXP A;  3I5H C;  1K93 D;  2CBL A;  2COL B;  2LHL A;  1F71 A;  1DGU A;  1OQP A;  1KSM A;  2L0P A;  1EH2 A;  1LVC D;  5JOL A;  2HF5 A;  1DF0 A;  4WQ2 A;  1F4Q A;  1FI6 A;  3I5H B;  1SMG A;  5AER A;  1GGZ A;  2MLE C;  3DD4 A;  1L2O C;  3GK2 A;  2M3W A;  2BBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...