2E30A

Solution structure of the cytoplasmic region of na+/h+ exchanger 1 complexed with essential cofactor calcineurin b homologous protein 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
195
structure length
195
Chain Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding protein p22
publication title Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/transport protein
total genus 45
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2006-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2e30A01
4PHNA 3AAKA 1C7WA 1SR6B 4NDDA 4GGFA 1HQVA 1MUXA 2KBIA 1M63B 4PDZA 3FS7A 3CZTX 3TZ1A 1DF0A 1J7PA 3TUYC 4MZKA 4WQ3A 1SYMA 2M0RA 3A4UB 3GK4X 1IRJA 1MXLC 3K21A 4HSZA 4PHKA 4YRUA 2LMUA 2OTGB 4MEWA 3PN7C 1FW4A 3IQQA 2LAPA 1M39A 3E3RA 1DT7B 1XVJA 1BG1A 2HETA 2LLTA 3GOFA 2KAYA 3CGAA 2LM5A 1IH0A 1YX7A 1J7RA 1N2DA 1UUSA 1LA3A 1X02A 1NSHA 1RFJA 2LE9B 1D1OA 2LC5A 2H61C 3OB1B 2KI4B 1Y1XA 2M8UA 2QPTA 3BUNB 1WY9A 3FWBA 4PE1A 4MRYA 4XYNA 1XYDA 2BKIB 4YI8A 2D8NA 5ER4X 3QRXA 5AEQA 1F71A 1QS7A 1QV1A 3DD4A 3PFVA 3PALA 2KI6C 1SR6C 2K8MB 1UHNA 1NUBA 2AMIA 2JXCA 2LVIA 3I5IB 2AAOA 3GK2A 3SJSA 1F70A 2L4IA 2M97A 1NX2A 4CIDA 1QIVA 1LINA 5IBWA 2EC6B 1TIZA 2BE6A 2ZN8A 1RTP1 2JRFA 1JF2A 1Y6WA 4ICBA 1BF5A 2JNFA 1S36A 4PE0A 4R1EA 5I2OA 1A4PA 3DVEA 4AQIA 3EK4A 1GGZA 4ORBB 1MXEA 4XJKB 4PCWA 1OZSA 1L2OB 2BBMA 5DKNA 3EKHA 2F2PA 2K2AA 1CLMA 1QX5B 4NDCA 2L4HA 1YVHA 2KI4C 5D7FA 5HLVA 1KFXS 3LK1A 1CNPA 1NX3A 1A29A 1DJXA 5I2LA 1SPYA 3ICBA 4MZJA 3BOWB 2KFFA 3KEVA 3VRQA 3CR5X 3M0WA 1XO5A 3KPXA 4A4CA 4DUQA 1OMRA 1YR5A 3I5IC 1BLQA 3D0YA 2LP3A 1TNWA 1B4CA 1SK6D 1R6PA 3CTNA 4MVFA 2EC6C 4OV2A 1EG4A 1ALWA 2KNEA 1YVLA 2LUXA 1QJTA 1C07A 1IGVA 4NQGA 1JF0A 4WQ2A 3KO0A 2I2RE 3I5FB 1UURA 2PSRA 1QIWA 2LHLA 4YGAA 2Y4QA 1U5IB 5I8NA 1ODBA 3ZNIA 4Q04A 4CFQA 1KWOB 2MLEC 1SCMB 1B7TY 2K61A 1WLZA 2KFHA 3PATA 1BODA 1YURA 1IWQA 3DVKA 1BOCA 2G2BA 5JJGA 2F33A 2L98A 4P2YB 1NCZA 2K7DA 1NCYA 2MA2A 2KDHA 2LLUA 4M2QA 3PM8A 2KYCA 5CSNA 2JOJA 1K9KA 1N0YA 1YUSA 2HQWA 1NWDA 1J1DA 3FIAA 1W7IB 3WXAA 4N5XA 1EJ3A 1S6JA 3O78A 1OOJA 1Y1AA 2R2IA 1YUTA 3BXKA 4P5OE 1MWNA 1XFZO 1G4YR 4YBHB 3TDIA 3LCPC 1BU3A 2KAVA 1XK4C 1IQ5A 3I5FC 5G08A 1EL4A 2PALA 2QACA 1AUIB 1B9AA 4AOMA 5HYDA 4CPVA 1IKUA 2L5XB 3JVTB 5HKZA 1HT9A 1PK0D 1PULA 1CTRA 1IJ6A 1KWOC 1OE9B 1SNLA 1SCMC 2CCMA 2NCPA 1XFWO 2ZRSA 1BMOA 4DIRA 2KQYA 2JTTA 2LHIA 3SIBA 2OPOA 2M7NA 4GAOA 1EXRA 2B1UA 4C0JA 1IG5A 4YGCB 1A75A 4MRXA 2ZNEA 3TS5B 4N1GA 1K93D 2ZRTA 2Y5IA 1QVIY 1SCVA 5PALA 1DF0B 1K2HA 5DKQA 3WHUB 2JU0A 2ZNDA 1V1FA 2WORA 5K89A 1TOPA 4I5KA 3NSIA 2BE4A 2KBMA 4JQ0D 1W7JB 1J7QA 1B7TZ 3TDZA 3WNXB 4DS7A 2KFGA 3IF7A 2GGMA 3JVTC 4PHJA 3KF9A 1JWDA 5D69A 1EG3A 2WCBA 1SY9A 1JC2A 1SL8A 2FCEA 1CFCA 1ZUZA 2I94A 4CFRA 3VGOA 1PSBA 2OS8C 3JTDC 1Y1UA 2K0JA 1CLBA 1ZFSA 4DCKA 1A03A 2WCEA 2WCFA 1KQVA 3VRNA 1SRAA 3EKJA 3LL8B 1Q80A 4YI9A 1NX1A 2MAZA 2GV5A 3CLNA 1H8BA 2LCPA 4XJKA 3MSEB 1QLKA 4HRGA 3TS5C 3EVVA 1K96A 2JQ6A 4GGFC 1MR8A 2KGRA 3NSOA 1WDCC 5KSZA 1QX2A 1CM4A 2CT9A 1K8UA 5FYXA 3KHEA 2NLNA 3CS1A 3IQOA 4QJ3B 3SG2A 1PVBA 1MF8B 1QXPA 4C0KA 1QATA 2M49B 1CMFA 1RWYA 1R2UA 1OSAA 4PHMA 1H4BA 1TNPA 4CLNA 2EHBA 4ORAB 2M3WA 1SMGA 3DF0B 4WRIA 2SASA 1KK7Y 1WRZA 1WLMA 2LMVA 1QASA 2HF5A 4MSPA 1K9UA 3O2PA 2MBXA 1C7VA 2M1UA 5KTYA 1GJYA 1S6IA 1NP8A 1TNXA 1QVIZ 2K7CA 1KSOA 5JOLA 2DOQA 3CR4X 1DTLA 3PLFB 1AJ4A 3GK1A 1RK9A 2BCAA 3HX4A 3OHMB 2ZKMX 4JWQA 2JPTA 4MZLA 1JSAA 2V53A 3D0YB 1S3PA 2K7OA 3SG5A 2AUCA 2RGIA 1JFKA 4YGBB 1CFFA 1IQ3A 2WNDA 5AXIA 3I5HB 4OVNF 2LVKA 1MHOA 1UHKA 3RLZA 1IJ5A 1NCXA 1M45A 1VRKA 1K94A 1RECA 1XA5A 2M29A 2O5GA 3EK8A 4YGEB 1CKKA 1EH2A 2PVBA 1JUOA 3EVUA 2JT0A 3VRPA 1K9PA 1GQMA 2M7LA 3OX5A 1J55A 2JWWA 2PRUA 2KSPA 1RJVA 5KU1A 1AP4A 1S1EA 4JPZB 2LUCA 4MLWA 1A2XA 1G8IA 5B8IB 1ZACA 2BECA 1CB1A 1TN4A 4U8DA 4YGDB 2H61A 4QJ4B 1BJFA 3BQ3A 2GGZA 1KQMB 3TDUA 1ALVA 1M31A 4D1EA 3F45A 5TNCA 4GGNA 4UPGA 1QLSA 3BUWB 1UHJA 1DJGA 1DJWA 2JT8A 1F4OA 1OMVA 3OX6A 2LVJA 4GBAA 4MBEA 1WRKA 2K7BA 1CFDA 4OR9B 1JBAA 1AHRA 1FI5A 2FJUB 2KYFA 1CDMA 1DJHA 2I7AA 2BKHB 1UHIA 2O60A 1DMOA 3LK0A 5ER5A 2M1KB 3I5HC 1TCFA 2JC2A 2JT3A 2OS8B 3JTDB 2BL0B 1DGUA 1YRUB 2CTNA 1QTXA 1J1EA 1KK7Z 1KK8B 5HKWA 1BR4B 1BT6A 1B8RA 2CXJA 5J3XA 1YX8A 1UWOA 2JTZA 1MQ1A 5CSIA 4A4BA 5F6TA 3SG3A 1WDCB 3WHTB 1XFXO 3BYAA 1J7OA 1SL7A 4I5LB 1CDPA 1DJZA 5AERA 1DJYA 1KQMC 1SBJA 2JZIA 3EVRA 4QJ5B 1FBVA 1OZOA 1V1GA 2L51A 2M9GA 3AKAA 1UHHA 4NDBA 4I5NB 2FCDA 2F3ZA 2Y1NA 1A75B 5CSJA 1OMDA 4N1FA 3O4YA 3PSRA 3D10A 4BY5A 4C0LA 4OKHA 1FI6A 4ZCVA 4ORCB 1ZOTB 2E30A 3FWCA 2JULA 2LANA 3VROA 1PALA 1B47A 5CSFA 3H4SE 1S5GY 1KFUL 2H2KA 3BUMB 1M46A 4E68A 3DVJA 2I18A 2VRGA 2BL0C 4DRWA 1YTZC 1NIWA 3SG7A 1F55A 1TRFA 1YUUA 3OB2B 1BR1B 2TN4A 1KK8C 4OCIA 1PSRA 2ZFDA 4PE7A 3HCMA 5HLOA 2EGDA 1SW8A 2KI6D 1XFYO 3O6BA 1YRTB 2IS9A 2F3YA 3NXAA 2PMYA 1UP5A 2ZN9A 1WRLA 2PASA 1G33A 3RM1A 4AQJA 1JFJA 2L0PA 4GFTA 2NXQA 4M2PA 1E8AA 2E6WA 1FF1A 2KOTA 3BOWA 3CWGA 2OTGC 2LMTA 2MHHA 3BUXB 2Q4UA 2CBLA 1FPWA 3SG4A 1RROA 2HPSA 2FOTA 3VRRA 3I5GB 3ZWHA 1CMGA 4USLA 3DF0A 1CDNA 3SIAA 1QV0A 4IL1A 5AFPA 1TCOB 3CR2A 2G9BA 1B1GA 1K90D 2COLB 3A8RA 1XFVO 1CLLA 1NPQA 1SL9A 1XK4A 4I5JA 2LP2A 2WOSA 2P6BB 1AVSA 4L9MA 3EK7A 4HREE 1U5IA 2BCXA 4GPLB 5CPVA 1Y0VH 3AAJA 3OP0A 1LVCD 2JXLA 1S26D 2A4JA 1DGVA 1CFPA 3DVMA 3BUOB 2F8PA 3C1VA 1F4QA 1GGWA 1PVAA 2K2FA 1CM1A 4GUKA 1KSMA 2JNXA 2WC8A 4PALA 3SG6A 1NX0A 1F8HA 1LA0A 2HQ8A 1S5GZ 2CNPA 1L2OC 4PE4A 3I5GC 2L50A 3NSKA 1CDLA 4HRHA 1AK8A 2LV7A 2MRDA 1S6CA 1F54A 1DJIA 1KCYA 4ZCUA 2BBNA 3AKBA 3LLEA 3TUYB 2MLFC 1AJ5A 1DVIA 1NYAA 1LXFC 2Q91A 4M2OA 1KFUS 1SKTA 2SCPA 4ETOA 1B8CA 2ISDA 3PN7B 5BPJA 4BY4A 2NZ0A 2KQ6A 4GNKB 1TNQA 1QX7A 1TTXA 2KAXA 2MJWB 5GQQC 4F0ZB 1K95A 1KFXL 5AANA 2BCBA 2LLSA 2NCOA 2Y1MA 1B8LA 5DKRA 4TNCA 5HKYA 4FQOA 4MN0A 3NSLA 1PRWA 1XFUO 2L2EA 4FTGA 1OQPA 2F2OA 2KHNA 5I2QA 2LNKA 2KGBC 2LVVA 1L7ZA 1LKJA 1ZMZA 1N65A
chains in the Genus database with same CATH superfamily
4PHNA 2BNXA 3AAKA 1C7WA 1SR6B 4NDDA 4GGFA 1HQVA 1MUXA 2KBIA 1M63B 4PDZA 3FS7A 3CZTX 4JD9A 3TZ1A 1DF0A 2WC5A 1J7PA 2WC6A 3TUYC 4MZKA 4WQ3A 1SYMA 2M0RA 3A4UB 3GK4X 1IRJA 1MXLC 3K21A 4HSZA 4PHKA 4YRUA 2LMUA 2OTGB 4MEWA 3PN7C 1FW4A 3IQQA 2LAPA 2WCJA 1M39A 3E3RA 1DT7B 1XVJA 1BG1A 2HETA 2LLTA 3GOFA 1P28A 2KAYA 3CGAA 2LM5A 1IH0A 3D73A 1YX7A 1J7RA 1N2DA 1UUSA 1LA3A 1X02A 1NSHA 1RFJA 2LE9B 1D1OA 2LC5A 2H61C 3OB1B 2KI4B 1Y1XA 2M8UA 2QPTA 3BUNB 1WY9A 2BAPA 3FWBA 4PE1A 4MRYA 4XYNA 1XYDA 2BKIB 4YI8A 2D8NA 5ER4X 3QRXA 5AEQA 1F71A 3R1VA 1QS7A 1QV1A 3DD4A 3PFVA 3PALA 1OW4A 2KI6C 3BJHA 1SR6C 2JPOA 1UHNA 2K8MB 1NUBA 2AMIA 2JXCA 2LVIA 3I5IB 2AAOA 3GK2A 3SJSA 1F70A 2L4IA 2M97A 1NX2A 4CIDA 1QIVA 1LINA 5IBWA 2EC6B 1TIZA 2BE6A 2ZN8A 1RTP1 2JRFA 1JF2A 1Y6WA 4ICBA 1BF5A 2JNFA 1S36A 4PE0A 3NHTA 3CZ0A 1A4PA 3DVEA 4R1EA 3EK4A 1GGZA 3R1OA 4AQIA 5I2OA 4ORBB 1MXEA 4XJKB 1DQEA 4PCWA 3B6XA 1OZSA 1L2OB 2BBMA 5DKNA 3EKHA 2F2PA 2K2AA 1CLMA 1QX5B 4NDCA 3IVTA 2WCMA 2L4HA 1YVHA 2KI4C 5D7FA 5HLVA 1KFXS 3LK1A 1CNPA 1NX3A 1A29A 1DJXA 5I2LA 1SPYA 1GM0A 3ICBA 4MZJA 3BOWB 3DXLA 2KFFA 3KEVA 3VRQA 3CR5X 3M0WA 1XO5A 3KPXA 4A4CA 4DUQA 3CDNA 1OMRA 1YR5A 3S0AA 3I5IC 1BLQA 3B7AA 3D0YA 2LP3A 1TNWA 1B4CA 1SK6D 1R6PA 3CTNA 3CABA 4MVFA 3B88A 2EC6C 4OV2A 1EG4A 3N7HA 1ALWA 2KNEA 1YVLA 2LUXA 1QJTA 5EL2A 1IGVA 1C07A 4NQGA 1JF0A 4WQ2A 3KO0A 2I2RE 3I5FB 1TUJA 1UURA 2PSRA 1QIWA 2LHLA 4YGAA 2Y4QA 1U5IB 5I8NA 1ODBA 3D77A 3ZNIA 4Q04A 4CFQA 1DC1A 1KWOB 2MLEC 4F7FA 1SCMB 2GTEA 1B7TY 2K61A 1WLZA 2KFHA 3PATA 1BODA 1YURA 3SS4A 1IWQA 3DVKA 1BOCA 2G2BA 5JJGA 2F33A 2L98A 4P2YB 1NCZA 2K7DA 1NCYA 2MA2A 2KDHA 2LLUA 4M2QA 3PM8A 2KYCA 5CSNA 2JOJA 1K9KA 1N0YA 1YUSA 2HQWA 1NWDA 1J1DA 3FIAA 1W7IB 1XFRA 3WXAA 4N5XA 1EJ3A 5HL1A 1S6JA 3O78A 1OOJA 1Y1AA 2R2IA 1YUTA 2QEBA 3BXKA 4P5OE 1MWNA 1XFZO 1G4YR 4YBHB 2WCLA 3TDIA 3LCPC 1BU3A 2ERBA 2KAVA 1XK4C 1IQ5A 3I5FC 3PM2A 5G08A 1EL4A 2PALA 2QACA 1AUIB 1B9AA 4AOMA 5HYDA 4CPVA 1IKUA 2L5XB 3JVTB 5HKZA 3PJIA 1W9ZA 1HT9A 1PK0D 1PULA 1CTRA 1IJ6A 1KWOC 1OE9B 1SNLA 1SCMC 2CCMA 2NCPA 3OGNA 1XFWO 2ZRSA 1BMOA 5FI2A 1TUZA 4DIRA 2KQYA 2JTTA 2LHIA 3SIBA 2OPOA 2M7NA 4GAOA 1EXRA 3VB1A 2B1UA 4C0JA 1IG5A 4YGCB 3S0FA 1A75A 4MRXA 2ZNEA 3TS5B 4N1GA 1K93D 2ZRTA 2Y5IA 1QVIY 2QDIA 3DZTA 1SCVA 3D76A 5PALA 1DF0B 3D74A 1K2HA 5DKQA 3WHUB 2JU0A 2ZNDA 1CKKA 1V1FA 3K1EA 2WORA 3L4LA 5K89A 1TOPA 4I5KA 3NSIA 2BE4A 2KBMA 4JQ0D 1DEKA 1W7JB 3B87A 1J7QA 1B7TZ 3TDZA 3WNXB 4DS7A 2KFGA 3IF7A 2GGMA 3JVTC 4PHJA 3KF9A 2P70A 5D69A 1JWDA 1EG3A 2WCBA 1SY9A 1JC2A 1SL8A 2FCEA 1CFCA 1ZUZA 2I94A 1TWOA 4CFRA 3VGOA 1PSBA 2L2CA 2OS8C 3JTDC 1Y1UA 2K0JA 1CLBA 1ZFSA 4DCKA 1A03A 2WCEA 2WCFA 1KQVA 3VRNA 1SRAA 5FI6A 3EKJA 3LL8B 1Q80A 4YI9A 3CYZA 1NX1A 2MAZA 2GV5A 3CLNA 2K60A 2LCPA 4XJKA 3MSEB 1QLKA 4HRGA 3TS5C 1H8BA 3EVVA 1K96A 2JQ6A 4GGFC 1MR8A 2KGRA 3NSOA 1WDCC 2QEHA 5KSZA 1QX2A 1CM4A 2CT9A 1K8UA 5FYXA 3KHEA 2NLNA 3CZ1A 3CS1A 3IQOA 4QJ3B 3L4AA 2KLDA 3SG2A 1PVBA 1MF8B 1SSEB 1QXPA 4C0KA 1ORGA 1QATA 2M49B 1CMFA 1RWYA 1OOHA 1R2UA 1OSAA 4PHMA 1H4BA 3UO9A 1TNPA 4CLNA 2EHBA 1Z2CB 4ORAB 2M3WA 1SMGA 3DF0B 4WRIA 2SASA 1KK7Y 1WRZA 1WLMA 3FE6A 2LMVA 1QASA 2HF5A 4MSPA 3D75A 1K9UA 3O2PA 2MBXA 1C7VA 2M1UA 5KTYA 1GJYA 1S6IA 1T14A 1NP8A 1TNXA 1QVIZ 2K7CA 1KSOA 1OOFA 2DOQA 3CR4X 1DTLA 3R72A 5JOLA 3PLFB 1AJ4A 3GK1A 2H8VA 1RK9A 2BCAA 3HX4A 3OHMB 2ZKMX 4JWQA 2JPTA 4MZLA 2WCHA 5I94A 1JSAA 2V53A 3D0YB 1S3PA 2K7OA 3SG5A 2AUCA 2RGIA 1JFKA 4YGBB 1CFFA 1IQ3A 2WNDA 5AXIA 3I5HB 1C3YA 4IJ7A 4OVNF 2LVKA 1MHOA 1UHKA 3RLZA 1IJ5A 1NCXA 1M45A 1DELA 1K94A 1RECA 1VRKA 1XA5A 2M29A 2O5GA 3EK8A 4YGEB 1EH2A 2PVBA 1JUOA 3EVUA 2JT0A 3VRPA 1K9PA 1GQMA 3BFAA 2M7LA 3OX5A 1J55A 2JWWA 2PRUA 2KSPA 1RJVA 5KU1A 1AP4A 1S1EA 4JPZB 2LUCA 4MLWA 1A2XA 1G8IA 5B8IB 1ZACA 2BECA 1CB1A 1TN4A 4U8DA 4YGDB 2H61A 4QJ4B 1BJFA 3BQ3A 2GGZA 1KQMB 3TDUA 1ALVA 1M31A 4D1EA 3F45A 5TNCA 4GGNA 4UPGA 1QLSA 3BUWB 1UHJA 1DJGA 1DJWA 2JT8A 1F4OA 1OMVA 3OX6A 2LVJA 4GBAA 4MBEA 1WRKA 2K7BA 1CFDA 4OR9B 1JBAA 4OZDA 1AHRA 3FE8A 1FI5A 2FJUB 2KYFA 3BFHA 1CDMA 1DJHA 2I7AA 2BKHB 1UHIA 2O60A 1DMOA 3LK0A 5ER5A 2M1KB 3I5HC 4INWA 1TCFA 2JC2A 2JT3A 2OS8B 3JTDB 2BL0B 1DGUA 1YRUB 2CTNA 1QTXA 3BFBA 1J1EA 1KK7Z 1OOIX 1LS8A 1OOGA 4KYNA 1KK8B 5HKWA 1BR4B 1BT6A 1B8RA 2CXJA 5J3XA 1YX8A 1UWOA 2JTZA 1MQ1A 5CSIA 4A4BA 5F6TA 2PQLA 1WDCB 4FQTA 1XFXO 3SG3A 3WHTB 3BYAA 1J7OA 1SL7A 4I5LB 1CDPA 1DJZA 5AERA 1DJYA 1KQMC 1SBJA 2JZIA 3EVRA 3RZSA 4QJ5B 1FBVA 1OZOA 1V1GA 2L51A 2M9GA 2QEOA 3AKAA 1UHHA 4NDBA 3D78A 2FCDA 2F3ZA 2Y1NA 4I5NB 1A75B 5CSJA 1OMDA 4N1FA 3O4YA 3PSRA 3D10A 4BY5A 4C0LA 4OKHA 1FI6A 4ZCVA 4ORCB 1ZOTB 2E30A 3V2LA 3FWCA 2JULA 2LANA 3VROA 1PALA 1B47A 5CSFA 3H4SE 1S5GY 1KFUL 2H2KA 3BUMB 1M46A 4E68A 3DVJA 2I18A 2PYQA 2BL0C 2VRGA 4DRWA 3Q8IA 1YTZC 1NIWA 3SG7A 1F55A 1TRFA 1YUUA 3OB2B 1BR1B 2TN4A 1KK8C 4OCIA 1IIOA 1PSRA 2ZFDA 4PE7A 3HCMA 5HLOA 2EGDA 1SW8A 3S0EA 2KI6D 1XFYO 3O6BA 1YRTB 5FI7A 2IS9A 2F3YA 3NXAA 2PMYA 1UP5A 2ZN9A 1WRLA 2PASA 1G33A 3RM1A 2QEVA 4AQJA 1JFJA 3SS5A 2L0PA 4GFTA 2NXQA 4M2PA 1E8AA 2E6WA 4PT1A 1FF1A 1Z4HA 2KOTA 3BOWA 3CWGA 2OTGC 2LMTA 2MHHA 3BUXB 3S0DA 2Q4UA 2CBLA 3SS3A 3SG4A 1FPWA 1RROA 2HPSA 2FOTA 2YGUA 3OBVA 3VRRA 3I5GB 3ZWHA 1CMGA 4USLA 2L5YA 3DF0A 1CDNA 2P71A 3SIAA 1QV0A 4IL1A 5AFPA 1TCOB 2KLEA 3CR2A 2G9BA 1B1GA 3R1PA 1K90D 3FE9A 2COLB 3A8RA 1QWVA 1XFVO 1CLLA 1NPQA 1SL9A 1XK4A 4I5JA 2LP2A 3CZ2A 2WOSA 2P6BB 3DYEA 1AVSA 4L9MA 3EK7A 4INXA 4HREE 1U5IA 2BCXA 4GPLB 5CPVA 1Y0VH 2KPHA 3AAJA 3OP0A 1LVCD 2JXLA 1S26D 5DICA 2A4JA 3O4XA 1DGVA 1CFPA 3DVMA 3BUOB 2F8PA 3L47A 3C1VA 1F4QA 1GGWA 1PVAA 2K2FA 1CM1A 4GUKA 1KSMA 2JNXA 2WC8A 4PALA 3SG6A 1NX0A 1F8HA 1LA0A 2HQ8A 1S5GZ 2CNPA 1L2OC 4PE4A 5D3OA 3I5GC 2L50A 3NSKA 1CDLA 2FJYA 4HRHA 1AK8A 2LV7A 2MRDA 1S6CA 1F54A 1DJIA 1KCYA 4ZCUA 2BBNA 3AKBA 3LLEA 3TUYB 2MLFC 1AJ5A 1DVIA 1NYAA 1LXFC 2Q91A 4M2OA 3QMEA 1KFUS 1SKTA 3S0BA 2SCPA 4ETOA 1B8CA 2ISDA 3B86A 3PN7B 5BPJA 4BY4A 2NZ0A 2KQ6A 4GNKB 1TNQA 1QX7A 1TTXA 2KAXA 2MJWB 5GQQC 4F0ZB 1K95A 1KFXL 5AANA 2WCKA 2BCBA 2LLSA 2NCOA 2Y1MA 1B8LA 3NHIA 5DKRA 3NGVA 3EG5B 4TNCA 3S0GA 4JKTA 5HKYA 4FQOA 4MN0A 3NSLA 1PRWA 1C3ZA 1XFUO 2L2EA 4FTGA 1OQPA 2F2OA 2KHNA 3UNWA 5I2QA 2LNKA 2KGBC 2LVVA 3DY9A 1L7ZA 1LKJA 1ZMZA 1N65A
chains in the Genus database with same CATH topology
4PHNA 3AAKA 1C7WA 1SR6B 4NDDA 4GGFA 1HQVA 1MUXA 2KBIA 1M63B 4PDZA 3FS7A 3CZTX 3TZ1A 1DF0A 1J7PA 3TUYC 4MZKA 4WQ3A 1SYMA 2M0RA 3A4UB 3GK4X 1IRJA 1MXLC 3K21A 4HSZA 4PHKA 4YRUA 2LMUA 2OTGB 4MEWA 3PN7C 1FW4A 3IQQA 2LAPA 1M39A 3E3RA 1DT7B 1XVJA 1BG1A 2HETA 2LLTA 3GOFA 2KAYA 3CGAA 2LM5A 1IH0A 1YX7A 1J7RA 1N2DA 1UUSA 1LA3A 1X02A 1NSHA 1RFJA 2LE9B 1D1OA 2LC5A 2H61C 3OB1B 2KI4B 1Y1XA 2M8UA 2QPTA 3BUNB 1WY9A 3FWBA 4PE1A 4MRYA 4XYNA 1XYDA 2BKIB 4YI8A 2D8NA 5ER4X 3QRXA 5AEQA 1F71A 1QS7A 1QV1A 3DD4A 3PFVA 3PALA 2KI6C 1SR6C 2K8MB 1UHNA 1NUBA 2AMIA 2JXCA 2LVIA 3I5IB 2AAOA 3GK2A 3SJSA 1F70A 2L4IA 2M97A 1NX2A 4CIDA 1QIVA 1LINA 5IBWA 2EC6B 1TIZA 2BE6A 2ZN8A 1RTP1 2JRFA 1JF2A 1Y6WA 4ICBA 1BF5A 2JNFA 1S36A 4PE0A 4R1EA 5I2OA 1A4PA 3DVEA 4AQIA 3EK4A 1GGZA 4ORBB 1MXEA 4XJKB 4PCWA 1OZSA 1L2OB 2BBMA 5DKNA 3EKHA 2F2PA 2K2AA 1CLMA 1QX5B 4NDCA 2L4HA 1YVHA 2KI4C 5D7FA 5HLVA 1KFXS 3LK1A 1CNPA 1NX3A 1A29A 1DJXA 5I2LA 1SPYA 3ICBA 4MZJA 3BOWB 2KFFA 3KEVA 3VRQA 3CR5X 3M0WA 1XO5A 3KPXA 4A4CA 4DUQA 1OMRA 1YR5A 3I5IC 1BLQA 3D0YA 2LP3A 1TNWA 1B4CA 1SK6D 1R6PA 3CTNA 4MVFA 2EC6C 4OV2A 1EG4A 1ALWA 2KNEA 1YVLA 2LUXA 1QJTA 1C07A 1IGVA 4NQGA 1JF0A 4WQ2A 3KO0A 2I2RE 3I5FB 1UURA 2PSRA 1QIWA 2LHLA 4YGAA 2Y4QA 1U5IB 5I8NA 1ODBA 3ZNIA 4Q04A 4CFQA 1KWOB 2MLEC 1SCMB 1B7TY 2K61A 1WLZA 2KFHA 3PATA 1BODA 1YURA 1IWQA 3DVKA 1BOCA 2G2BA 5JJGA 2F33A 2L98A 4P2YB 1NCZA 2K7DA 1NCYA 2MA2A 2KDHA 2LLUA 4M2QA 3PM8A 2KYCA 5CSNA 2JOJA 1K9KA 1N0YA 1YUSA 2HQWA 1NWDA 1J1DA 3FIAA 1W7IB 3WXAA 4N5XA 1EJ3A 1S6JA 3O78A 1OOJA 1Y1AA 2R2IA 1YUTA 3BXKA 4P5OE 1MWNA 1XFZO 1G4YR 4YBHB 3TDIA 3LCPC 1BU3A 2KAVA 1XK4C 1IQ5A 3I5FC 5G08A 1EL4A 2PALA 2QACA 1AUIB 1B9AA 4AOMA 5HYDA 4CPVA 1IKUA 2L5XB 3JVTB 5HKZA 1HT9A 1PK0D 1PULA 1CTRA 1IJ6A 1KWOC 1OE9B 1SNLA 1SCMC 2CCMA 2NCPA 1XFWO 2ZRSA 1BMOA 4DIRA 2KQYA 2JTTA 2LHIA 3SIBA 2OPOA 2M7NA 4GAOA 1EXRA 2B1UA 4C0JA 1IG5A 4YGCB 1A75A 4MRXA 2ZNEA 3TS5B 4N1GA 1K93D 2ZRTA 2Y5IA 1QVIY 1SCVA 5PALA 1DF0B 1K2HA 5DKQA 3WHUB 2JU0A 2ZNDA 1V1FA 2WORA 5K89A 1TOPA 4I5KA 3NSIA 2BE4A 2KBMA 4JQ0D 1W7JB 1J7QA 1B7TZ 3TDZA 3WNXB 4DS7A 2KFGA 3IF7A 2GGMA 3JVTC 4PHJA 3KF9A 1JWDA 5D69A 1EG3A 2WCBA 1SY9A 1JC2A 1SL8A 2FCEA 1CFCA 1ZUZA 2I94A 4CFRA 3VGOA 1PSBA 2OS8C 3JTDC 1Y1UA 2K0JA 1CLBA 1ZFSA 4DCKA 1A03A 2WCEA 2WCFA 1KQVA 3VRNA 1SRAA 3EKJA 3LL8B 1Q80A 4YI9A 1NX1A 2MAZA 2GV5A 3CLNA 1H8BA 2LCPA 4XJKA 3MSEB 1QLKA 4HRGA 3TS5C 3EVVA 1K96A 2JQ6A 4GGFC 1MR8A 2KGRA 3NSOA 1WDCC 5KSZA 1QX2A 1CM4A 2CT9A 1K8UA 5FYXA 3KHEA 2NLNA 3CS1A 3IQOA 4QJ3B 3SG2A 1PVBA 1MF8B 1QXPA 4C0KA 1QATA 2M49B 1CMFA 1RWYA 1R2UA 1OSAA 4PHMA 1H4BA 1TNPA 4CLNA 2EHBA 4ORAB 2M3WA 1SMGA 3DF0B 4WRIA 2SASA 1KK7Y 1WRZA 1WLMA 2LMVA 1QASA 2HF5A 4MSPA 1K9UA 3O2PA 2MBXA 1C7VA 2M1UA 5KTYA 1GJYA 1S6IA 1NP8A 1TNXA 1QVIZ 2K7CA 1KSOA 5JOLA 2DOQA 3CR4X 1DTLA 3PLFB 1AJ4A 3GK1A 1RK9A 2BCAA 3HX4A 3OHMB 2ZKMX 4JWQA 2JPTA 4MZLA 1JSAA 2V53A 3D0YB 1S3PA 2K7OA 3SG5A 2AUCA 2RGIA 1JFKA 4YGBB 1CFFA 1IQ3A 2WNDA 5AXIA 3I5HB 4OVNF 2LVKA 1MHOA 1UHKA 3RLZA 1IJ5A 1NCXA 1M45A 1VRKA 1K94A 1RECA 1XA5A 2M29A 2O5GA 3EK8A 4YGEB 1CKKA 1EH2A 2PVBA 1JUOA 3EVUA 2JT0A 3VRPA 1K9PA 1GQMA 2M7LA 3OX5A 1J55A 2JWWA 2PRUA 2KSPA 1RJVA 5KU1A 1AP4A 1S1EA 4JPZB 2LUCA 4MLWA 1A2XA 1G8IA 5B8IB 1ZACA 2BECA 1CB1A 1TN4A 4U8DA 4YGDB 2H61A 4QJ4B 1BJFA 3BQ3A 2GGZA 1KQMB 3TDUA 1ALVA 1M31A 4D1EA 3F45A 5TNCA 4GGNA 4UPGA 1QLSA 3BUWB 1UHJA 1DJGA 1DJWA 2JT8A 1F4OA 1OMVA 3OX6A 2LVJA 4GBAA 4MBEA 1WRKA 2K7BA 1CFDA 4OR9B 1JBAA 1AHRA 1FI5A 2FJUB 2KYFA 1CDMA 1DJHA 2I7AA 2BKHB 1UHIA 2O60A 1DMOA 3LK0A 5ER5A 2M1KB 3I5HC 1TCFA 2JC2A 2JT3A 2OS8B 3JTDB 2BL0B 1DGUA 1YRUB 2CTNA 1QTXA 1J1EA 1KK7Z 1KK8B 5HKWA 1BR4B 1BT6A 1B8RA 2CXJA 5J3XA 1YX8A 1UWOA 2JTZA 1MQ1A 5CSIA 4A4BA 5F6TA 3SG3A 1WDCB 3WHTB 1XFXO 3BYAA 1J7OA 1SL7A 4I5LB 1CDPA 1DJZA 5AERA 1DJYA 1KQMC 1SBJA 2JZIA 3EVRA 4QJ5B 1FBVA 1OZOA 1V1GA 2L51A 2M9GA 3AKAA 1UHHA 4NDBA 4I5NB 2FCDA 2F3ZA 2Y1NA 1A75B 5CSJA 1OMDA 4N1FA 3O4YA 3PSRA 3D10A 4BY5A 4C0LA 4OKHA 1FI6A 4ZCVA 4ORCB 1ZOTB 2E30A 3FWCA 2JULA 2LANA 3VROA 1PALA 1B47A 5CSFA 3H4SE 1S5GY 1KFUL 2H2KA 3BUMB 1M46A 4E68A 3DVJA 2I18A 2VRGA 2BL0C 4DRWA 1YTZC 1NIWA 3SG7A 1F55A 1TRFA 1YUUA 3OB2B 1BR1B 2TN4A 1KK8C 4OCIA 1PSRA 2ZFDA 4PE7A 3HCMA 5HLOA 2EGDA 1SW8A 2KI6D 1XFYO 3O6BA 1YRTB 2IS9A 2F3YA 3NXAA 2PMYA 1UP5A 2ZN9A 1WRLA 2PASA 1G33A 3RM1A 4AQJA 1JFJA 2L0PA 4GFTA 2NXQA 4M2PA 1E8AA 2E6WA 1FF1A 2KOTA 3BOWA 3CWGA 2OTGC 2LMTA 2MHHA 3BUXB 2Q4UA 2CBLA 1FPWA 3SG4A 1RROA 2HPSA 2FOTA 3VRRA 3I5GB 3ZWHA 1CMGA 4USLA 3DF0A 1CDNA 3SIAA 1QV0A 4IL1A 5AFPA 1TCOB 3CR2A 2G9BA 1B1GA 1K90D 2COLB 3A8RA 1XFVO 1CLLA 1NPQA 1SL9A 1XK4A 4I5JA 2LP2A 2WOSA 2P6BB 1AVSA 4L9MA 3EK7A 4HREE 1U5IA 2BCXA 4GPLB 5CPVA 1Y0VH 3AAJA 3OP0A 1LVCD 2JXLA 1S26D 2A4JA 1DGVA 1CFPA 3DVMA 3BUOB 2F8PA 3C1VA 1F4QA 1GGWA 1PVAA 2K2FA 1CM1A 4GUKA 1KSMA 2JNXA 2WC8A 4PALA 3SG6A 1NX0A 1F8HA 1LA0A 2HQ8A 1S5GZ 2CNPA 1L2OC 4PE4A 3I5GC 2L50A 3NSKA 1CDLA 4HRHA 1AK8A 2LV7A 2MRDA 1S6CA 1F54A 1DJIA 1KCYA 4ZCUA 2BBNA 3AKBA 3LLEA 3TUYB 2MLFC 1AJ5A 1DVIA 1NYAA 1LXFC 2Q91A 4M2OA 1KFUS 1SKTA 2SCPA 4ETOA 1B8CA 2ISDA 3PN7B 5BPJA 4BY4A 2NZ0A 2KQ6A 4GNKB 1TNQA 1QX7A 1TTXA 2KAXA 2MJWB 5GQQC 4F0ZB 1K95A 1KFXL 5AANA 2BCBA 2LLSA 2NCOA 2Y1MA 1B8LA 5DKRA 4TNCA 5HKYA 4FQOA 4MN0A 3NSLA 1PRWA 1XFUO 2L2EA 4FTGA 1OQPA 2F2OA 2KHNA 5I2QA 2LNKA 2KGBC 2LVVA 1L7ZA 1LKJA 1ZMZA 1N65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHN A;  3AAK A;  1C7W A;  1SR6 B;  4NDD A;  4GGF A;  1HQV A;  1MUX A;  2KBI A;  1M63 B;  4PDZ A;  3FS7 A;  3CZT X;  3TZ1 A;  1DF0 A;  1J7P A;  3TUY C;  4MZK A;  4WQ3 A;  1SYM A;  2M0R A;  3A4U B;  3GK4 X;  1IRJ A;  1MXL C;  3K21 A;  4HSZ A;  4PHK A;  4YRU A;  2LMU A;  2OTG B;  4MEW A;  3PN7 C;  1FW4 A;  3IQQ A;  2LAP A;  1M39 A;  3E3R A;  1DT7 B;  1XVJ A;  1BG1 A;  2HET A;  2LLT A;  3GOF A;  2KAY A;  3CGA A;  2LM5 A;  1IH0 A;  1YX7 A;  1J7R A;  1N2D A;  1UUS A;  1LA3 A;  1X02 A;  1NSH A;  1RFJ A;  2LE9 B;  1D1O A;  2LC5 A;  2H61 C;  3OB1 B;  2KI4 B;  1Y1X A;  2M8U A;  2QPT A;  3BUN B;  1WY9 A;  3FWB A;  4PE1 A;  4MRY A;  4XYN A;  1XYD A;  2BKI B;  4YI8 A;  2D8N A;  5ER4 X;  3QRX A;  5AEQ A;  1F71 A;  1QS7 A;  1QV1 A;  3DD4 A;  3PFV A;  3PAL A;  2KI6 C;  1SR6 C;  2K8M B;  1UHN A;  1NUB A;  2AMI A;  2JXC A;  2LVI A;  3I5I B;  2AAO A;  3GK2 A;  3SJS A;  1F70 A;  2L4I A;  2M97 A;  1NX2 A;  4CID A;  1QIV A;  1LIN A;  5IBW A;  2EC6 B;  1TIZ A;  2BE6 A;  2ZN8 A;  1RTP 1;  2JRF A;  1JF2 A;  1Y6W A;  4ICB A;  1BF5 A;  2JNF A;  1S36 A;  4PE0 A;  4R1E A;  5I2O A;  1A4P A;  3DVE A;  4AQI A;  3EK4 A;  1GGZ A;  4ORB B;  1MXE A;  4XJK B;  4PCW A;  1OZS A;  1L2O B;  2BBM A;  5DKN A;  3EKH A;  2F2P A;  2K2A A;  1CLM A;  1QX5 B;  4NDC A;  2L4H A;  1YVH A;  2KI4 C;  5D7F A;  5HLV A;  1KFX S;  3LK1 A;  1CNP A;  1NX3 A;  1A29 A;  1DJX A;  5I2L A;  1SPY A;  3ICB A;  4MZJ A;  3BOW B;  2KFF A;  3KEV A;  3VRQ A;  3CR5 X;  3M0W A;  1XO5 A;  3KPX A;  4A4C A;  4DUQ A;  1OMR A;  1YR5 A;  3I5I C;  1BLQ A;  3D0Y A;  2LP3 A;  1TNW A;  1B4C A;  1SK6 D;  1R6P A;  3CTN A;  4MVF A;  2EC6 C;  4OV2 A;  1EG4 A;  1ALW A;  2KNE A;  1YVL A;  2LUX A;  1QJT A;  1C07 A;  1IGV A;  4NQG A;  1JF0 A;  4WQ2 A;  3KO0 A;  2I2R E;  3I5F B;  1UUR A;  2PSR A;  1QIW A;  2LHL A;  4YGA A;  2Y4Q A;  1U5I B;  5I8N A;  1ODB A;  3ZNI A;  4Q04 A;  4CFQ A;  1KWO B;  2MLE C;  1SCM B;  1B7T Y;  2K61 A;  1WLZ A;  2KFH A;  3PAT A;  1BOD A;  1YUR A;  1IWQ A;  3DVK A;  1BOC A;  2G2B A;  5JJG A;  2F33 A;  2L98 A;  4P2Y B;  1NCZ A;  2K7D A;  1NCY A;  2MA2 A;  2KDH A;  2LLU A;  4M2Q A;  3PM8 A;  2KYC A;  5CSN A;  2JOJ A;  1K9K A;  1N0Y A;  1YUS A;  2HQW A;  1NWD A;  1J1D A;  3FIA A;  1W7I B;  3WXA A;  4N5X A;  1EJ3 A;  1S6J A;  3O78 A;  1OOJ A;  1Y1A A;  2R2I A;  1YUT A;  3BXK A;  4P5O E;  1MWN A;  1XFZ O;  1G4Y R;  4YBH B;  3TDI A;  3LCP C;  1BU3 A;  2KAV A;  1XK4 C;  1IQ5 A;  3I5F C;  5G08 A;  1EL4 A;  2PAL A;  2QAC A;  1AUI B;  1B9A A;  4AOM A;  5HYD A;  4CPV A;  1IKU A;  2L5X B;  3JVT B;  5HKZ A;  1HT9 A;  1PK0 D;  1PUL A;  1CTR A;  1IJ6 A;  1KWO C;  1OE9 B;  1SNL A;  1SCM C;  2CCM A;  2NCP A;  1XFW O;  2ZRS A;  1BMO A;  4DIR A;  2KQY A;  2JTT A;  2LHI A;  3SIB A;  2OPO A;  2M7N A;  4GAO A;  1EXR A;  2B1U A;  4C0J A;  1IG5 A;  4YGC B;  1A75 A;  4MRX A;  2ZNE A;  3TS5 B;  4N1G A;  1K93 D;  2ZRT A;  2Y5I A;  1QVI Y;  1SCV A;  5PAL A;  1DF0 B;  1K2H A;  5DKQ A;  3WHU B;  2JU0 A;  2ZND A;  1V1F A;  2WOR A;  5K89 A;  1TOP A;  4I5K A;  3NSI A;  2BE4 A;  2KBM A;  4JQ0 D;  1W7J B;  1J7Q A;  1B7T Z;  3TDZ A;  3WNX B;  4DS7 A;  2KFG A;  3IF7 A;  2GGM A;  3JVT C;  4PHJ A;  3KF9 A;  1JWD A;  5D69 A;  1EG3 A;  2WCB A;  1SY9 A;  1JC2 A;  1SL8 A;  2FCE A;  1CFC A;  1ZUZ A;  2I94 A;  4CFR A;  3VGO A;  1PSB A;  2OS8 C;  3JTD C;  1Y1U A;  2K0J A;  1CLB A;  1ZFS A;  4DCK A;  1A03 A;  2WCE A;  2WCF A;  1KQV A;  3VRN A;  1SRA A;  3EKJ A;  3LL8 B;  1Q80 A;  4YI9 A;  1NX1 A;  2MAZ A;  2GV5 A;  3CLN A;  1H8B A;  2LCP A;  4XJK A;  3MSE B;  1QLK A;  4HRG A;  3TS5 C;  3EVV A;  1K96 A;  2JQ6 A;  4GGF C;  1MR8 A;  2KGR A;  3NSO A;  1WDC C;  5KSZ A;  1QX2 A;  1CM4 A;  2CT9 A;  1K8U A;  5FYX A;  3KHE A;  2NLN A;  3CS1 A;  3IQO A;  4QJ3 B;  3SG2 A;  1PVB A;  1MF8 B;  1QXP A;  4C0K A;  1QAT A;  2M49 B;  1CMF A;  1RWY A;  1R2U A;  1OSA A;  4PHM A;  1H4B A;  1TNP A;  4CLN A;  2EHB A;  4ORA B;  2M3W A;  1SMG A;  3DF0 B;  4WRI A;  2SAS A;  1KK7 Y;  1WRZ A;  1WLM A;  2LMV A;  1QAS A;  2HF5 A;  4MSP A;  1K9U A;  3O2P A;  2MBX A;  1C7V A;  2M1U A;  5KTY A;  1GJY A;  1S6I A;  1NP8 A;  1TNX A;  1QVI Z;  2K7C A;  1KSO A;  5JOL A;  2DOQ A;  3CR4 X;  1DTL A;  3PLF B;  1AJ4 A;  3GK1 A;  1RK9 A;  2BCA A;  3HX4 A;  3OHM B;  2ZKM X;  4JWQ A;  2JPT A;  4MZL A;  1JSA A;  2V53 A;  3D0Y B;  1S3P A;  2K7O A;  3SG5 A;  2AUC A;  2RGI A;  1JFK A;  4YGB B;  1CFF A;  1IQ3 A;  2WND A;  5AXI A;  3I5H B;  4OVN F;  2LVK A;  1MHO A;  1UHK A;  3RLZ A;  1IJ5 A;  1NCX A;  1M45 A;  1VRK A;  1K94 A;  1REC A;  1XA5 A;  2M29 A;  2O5G A;  3EK8 A;  4YGE B;  1CKK A;  1EH2 A;  2PVB A;  1JUO A;  3EVU A;  2JT0 A;  3VRP A;  1K9P A;  1GQM A;  2M7L A;  3OX5 A;  1J55 A;  2JWW A;  2PRU A;  2KSP A;  1RJV A;  5KU1 A;  1AP4 A;  1S1E A;  4JPZ B;  2LUC A;  4MLW A;  1A2X A;  1G8I A;  5B8I B;  1ZAC A;  2BEC A;  1CB1 A;  1TN4 A;  4U8D A;  4YGD B;  2H61 A;  4QJ4 B;  1BJF A;  3BQ3 A;  2GGZ A;  1KQM B;  3TDU A;  1ALV A;  1M31 A;  4D1E A;  3F45 A;  5TNC A;  4GGN A;  4UPG A;  1QLS A;  3BUW B;  1UHJ A;  1DJG A;  1DJW A;  2JT8 A;  1F4O A;  1OMV A;  3OX6 A;  2LVJ A;  4GBA A;  4MBE A;  1WRK A;  2K7B A;  1CFD A;  4OR9 B;  1JBA A;  1AHR A;  1FI5 A;  2FJU B;  2KYF A;  1CDM A;  1DJH A;  2I7A A;  2BKH B;  1UHI A;  2O60 A;  1DMO A;  3LK0 A;  5ER5 A;  2M1K B;  3I5H C;  1TCF A;  2JC2 A;  2JT3 A;  2OS8 B;  3JTD B;  2BL0 B;  1DGU A;  1YRU B;  2CTN A;  1QTX A;  1J1E A;  1KK7 Z;  1KK8 B;  5HKW A;  1BR4 B;  1BT6 A;  1B8R A;  2CXJ A;  5J3X A;  1YX8 A;  1UWO A;  2JTZ A;  1MQ1 A;  5CSI A;  4A4B A;  5F6T A;  3SG3 A;  1WDC B;  3WHT B;  1XFX O;  3BYA A;  1J7O A;  1SL7 A;  4I5L B;  1CDP A;  1DJZ A;  5AER A;  1DJY A;  1KQM C;  1SBJ A;  2JZI A;  3EVR A;  4QJ5 B;  1FBV A;  1OZO A;  1V1G A;  2L51 A;  2M9G A;  3AKA A;  1UHH A;  4NDB A;  4I5N B;  2FCD A;  2F3Z A;  2Y1N A;  1A75 B;  5CSJ A;  1OMD A;  4N1F A;  3O4Y A;  3PSR A;  3D10 A;  4BY5 A;  4C0L A;  4OKH A;  1FI6 A;  4ZCV A;  4ORC B;  1ZOT B;  2E30 A;  3FWC A;  2JUL A;  2LAN A;  3VRO A;  1PAL A;  1B47 A;  5CSF A;  3H4S E;  1S5G Y;  1KFU L;  2H2K A;  3BUM B;  1M46 A;  4E68 A;  3DVJ A;  2I18 A;  2VRG A;  2BL0 C;  4DRW A;  1YTZ C;  1NIW A;  3SG7 A;  1F55 A;  1TRF A;  1YUU A;  3OB2 B;  1BR1 B;  2TN4 A;  1KK8 C;  4OCI A;  1PSR A;  2ZFD A;  4PE7 A;  3HCM A;  5HLO A;  2EGD A;  1SW8 A;  2KI6 D;  1XFY O;  3O6B A;  1YRT B;  2IS9 A;  2F3Y A;  3NXA A;  2PMY A;  1UP5 A;  2ZN9 A;  1WRL A;  2PAS A;  1G33 A;  3RM1 A;  4AQJ A;  1JFJ A;  2L0P A;  4GFT A;  2NXQ A;  4M2P A;  1E8A A;  2E6W A;  1FF1 A;  2KOT A;  3BOW A;  3CWG A;  2OTG C;  2LMT A;  2MHH A;  3BUX B;  2Q4U A;  2CBL A;  1FPW A;  3SG4 A;  1RRO A;  2HPS A;  2FOT A;  3VRR A;  3I5G B;  3ZWH A;  1CMG A;  4USL A;  3DF0 A;  1CDN A;  3SIA A;  1QV0 A;  4IL1 A;  5AFP A;  1TCO B;  3CR2 A;  2G9B A;  1B1G A;  1K90 D;  2COL B;  3A8R A;  1XFV O;  1CLL A;  1NPQ A;  1SL9 A;  1XK4 A;  4I5J A;  2LP2 A;  2WOS A;  2P6B B;  1AVS A;  4L9M A;  3EK7 A;  4HRE E;  1U5I A;  2BCX A;  4GPL B;  5CPV A;  1Y0V H;  3AAJ A;  3OP0 A;  1LVC D;  2JXL A;  1S26 D;  2A4J A;  1DGV A;  1CFP A;  3DVM A;  3BUO B;  2F8P A;  3C1V A;  1F4Q A;  1GGW A;  1PVA A;  2K2F A;  1CM1 A;  4GUK A;  1KSM A;  2JNX A;  2WC8 A;  4PAL A;  3SG6 A;  1NX0 A;  1F8H A;  1LA0 A;  2HQ8 A;  1S5G Z;  2CNP A;  1L2O C;  4PE4 A;  3I5G C;  2L50 A;  3NSK A;  1CDL A;  4HRH A;  1AK8 A;  2LV7 A;  2MRD A;  1S6C A;  1F54 A;  1DJI A;  1KCY A;  4ZCU A;  2BBN A;  3AKB A;  3LLE A;  3TUY B;  2MLF C;  1AJ5 A;  1DVI A;  1NYA A;  1LXF C;  2Q91 A;  4M2O A;  1KFU S;  1SKT A;  2SCP A;  4ETO A;  1B8C A;  2ISD A;  3PN7 B;  5BPJ A;  4BY4 A;  2NZ0 A;  2KQ6 A;  4GNK B;  1TNQ A;  1QX7 A;  1TTX A;  2KAX A;  2MJW B;  5GQQ C;  4F0Z B;  1K95 A;  1KFX L;  5AAN A;  2BCB A;  2LLS A;  2NCO A;  2Y1M A;  1B8L A;  5DKR A;  4TNC A;  5HKY A;  4FQO A;  4MN0 A;  3NSL A;  1PRW A;  1XFU O;  2L2E A;  4FTG A;  1OQP A;  2F2O A;  2KHN A;  5I2Q A;  2LNK A;  2KGB C;  2LVV A;  1L7Z A;  1LKJ A;  1ZMZ A;  1N65 A; 
#chains in the Genus database with same CATH topology
 4PHN A;  2BNX A;  3AAK A;  1C7W A;  1SR6 B;  4NDD A;  4GGF A;  1HQV A;  1MUX A;  2KBI A;  1M63 B;  4PDZ A;  3FS7 A;  3CZT X;  4JD9 A;  3TZ1 A;  1DF0 A;  2WC5 A;  1J7P A;  2WC6 A;  3TUY C;  4MZK A;  4WQ3 A;  1SYM A;  2M0R A;  3A4U B;  3GK4 X;  1IRJ A;  1MXL C;  3K21 A;  4HSZ A;  4PHK A;  4YRU A;  2LMU A;  2OTG B;  4MEW A;  3PN7 C;  1FW4 A;  3IQQ A;  2LAP A;  2WCJ A;  1M39 A;  3E3R A;  1DT7 B;  1XVJ A;  1BG1 A;  2HET A;  2LLT A;  3GOF A;  1P28 A;  2KAY A;  3CGA A;  2LM5 A;  1IH0 A;  3D73 A;  1YX7 A;  1J7R A;  1N2D A;  1UUS A;  1LA3 A;  1X02 A;  1NSH A;  1RFJ A;  2LE9 B;  1D1O A;  2LC5 A;  2H61 C;  3OB1 B;  2KI4 B;  1Y1X A;  2M8U A;  2QPT A;  3BUN B;  1WY9 A;  2BAP A;  3FWB A;  4PE1 A;  4MRY A;  4XYN A;  1XYD A;  2BKI B;  4YI8 A;  2D8N A;  5ER4 X;  3QRX A;  5AEQ A;  1F71 A;  3R1V A;  1QS7 A;  1QV1 A;  3DD4 A;  3PFV A;  3PAL A;  1OW4 A;  2KI6 C;  3BJH A;  1SR6 C;  2JPO A;  1UHN A;  2K8M B;  1NUB A;  2AMI A;  2JXC A;  2LVI A;  3I5I B;  2AAO A;  3GK2 A;  3SJS A;  1F70 A;  2L4I A;  2M97 A;  1NX2 A;  4CID A;  1QIV A;  1LIN A;  5IBW A;  2EC6 B;  1TIZ A;  2BE6 A;  2ZN8 A;  1RTP 1;  2JRF A;  1JF2 A;  1Y6W A;  4ICB A;  1BF5 A;  2JNF A;  1S36 A;  4PE0 A;  3NHT A;  3CZ0 A;  1A4P A;  3DVE A;  4R1E A;  3EK4 A;  1GGZ A;  3R1O A;  4AQI A;  5I2O A;  4ORB B;  1MXE A;  4XJK B;  1DQE A;  4PCW A;  3B6X A;  1OZS A;  1L2O B;  2BBM A;  5DKN A;  3EKH A;  2F2P A;  2K2A A;  1CLM A;  1QX5 B;  4NDC A;  3IVT A;  2WCM A;  2L4H A;  1YVH A;  2KI4 C;  5D7F A;  5HLV A;  1KFX S;  3LK1 A;  1CNP A;  1NX3 A;  1A29 A;  1DJX A;  5I2L A;  1SPY A;  1GM0 A;  3ICB A;  4MZJ A;  3BOW B;  3DXL A;  2KFF A;  3KEV A;  3VRQ A;  3CR5 X;  3M0W A;  1XO5 A;  3KPX A;  4A4C A;  4DUQ A;  3CDN A;  1OMR A;  1YR5 A;  3S0A A;  3I5I C;  1BLQ A;  3B7A A;  3D0Y A;  2LP3 A;  1TNW A;  1B4C A;  1SK6 D;  1R6P A;  3CTN A;  3CAB A;  4MVF A;  3B88 A;  2EC6 C;  4OV2 A;  1EG4 A;  3N7H A;  1ALW A;  2KNE A;  1YVL A;  2LUX A;  1QJT A;  5EL2 A;  1IGV A;  1C07 A;  4NQG A;  1JF0 A;  4WQ2 A;  3KO0 A;  2I2R E;  3I5F B;  1TUJ A;  1UUR A;  2PSR A;  1QIW A;  2LHL A;  4YGA A;  2Y4Q A;  1U5I B;  5I8N A;  1ODB A;  3D77 A;  3ZNI A;  4Q04 A;  4CFQ A;  1DC1 A;  1KWO B;  2MLE C;  4F7F A;  1SCM B;  2GTE A;  1B7T Y;  2K61 A;  1WLZ A;  2KFH A;  3PAT A;  1BOD A;  1YUR A;  3SS4 A;  1IWQ A;  3DVK A;  1BOC A;  2G2B A;  5JJG A;  2F33 A;  2L98 A;  4P2Y B;  1NCZ A;  2K7D A;  1NCY A;  2MA2 A;  2KDH A;  2LLU A;  4M2Q A;  3PM8 A;  2KYC A;  5CSN A;  2JOJ A;  1K9K A;  1N0Y A;  1YUS A;  2HQW A;  1NWD A;  1J1D A;  3FIA A;  1W7I B;  1XFR A;  3WXA A;  4N5X A;  1EJ3 A;  5HL1 A;  1S6J A;  3O78 A;  1OOJ A;  1Y1A A;  2R2I A;  1YUT A;  2QEB A;  3BXK A;  4P5O E;  1MWN A;  1XFZ O;  1G4Y R;  4YBH B;  2WCL A;  3TDI A;  3LCP C;  1BU3 A;  2ERB A;  2KAV A;  1XK4 C;  1IQ5 A;  3I5F C;  3PM2 A;  5G08 A;  1EL4 A;  2PAL A;  2QAC A;  1AUI B;  1B9A A;  4AOM A;  5HYD A;  4CPV A;  1IKU A;  2L5X B;  3JVT B;  5HKZ A;  3PJI A;  1W9Z A;  1HT9 A;  1PK0 D;  1PUL A;  1CTR A;  1IJ6 A;  1KWO C;  1OE9 B;  1SNL A;  1SCM C;  2CCM A;  2NCP A;  3OGN A;  1XFW O;  2ZRS A;  1BMO A;  5FI2 A;  1TUZ A;  4DIR A;  2KQY A;  2JTT A;  2LHI A;  3SIB A;  2OPO A;  2M7N A;  4GAO A;  1EXR A;  3VB1 A;  2B1U A;  4C0J A;  1IG5 A;  4YGC B;  3S0F A;  1A75 A;  4MRX A;  2ZNE A;  3TS5 B;  4N1G A;  1K93 D;  2ZRT A;  2Y5I A;  1QVI Y;  2QDI A;  3DZT A;  1SCV A;  3D76 A;  5PAL A;  1DF0 B;  3D74 A;  1K2H A;  5DKQ A;  3WHU B;  2JU0 A;  2ZND A;  1CKK A;  1V1F A;  3K1E A;  2WOR A;  3L4L A;  5K89 A;  1TOP A;  4I5K A;  3NSI A;  2BE4 A;  2KBM A;  4JQ0 D;  1DEK A;  1W7J B;  3B87 A;  1J7Q A;  1B7T Z;  3TDZ A;  3WNX B;  4DS7 A;  2KFG A;  3IF7 A;  2GGM A;  3JVT C;  4PHJ A;  3KF9 A;  2P70 A;  5D69 A;  1JWD A;  1EG3 A;  2WCB A;  1SY9 A;  1JC2 A;  1SL8 A;  2FCE A;  1CFC A;  1ZUZ A;  2I94 A;  1TWO A;  4CFR A;  3VGO A;  1PSB A;  2L2C A;  2OS8 C;  3JTD C;  1Y1U A;  2K0J A;  1CLB A;  1ZFS A;  4DCK A;  1A03 A;  2WCE A;  2WCF A;  1KQV A;  3VRN A;  1SRA A;  5FI6 A;  3EKJ A;  3LL8 B;  1Q80 A;  4YI9 A;  3CYZ A;  1NX1 A;  2MAZ A;  2GV5 A;  3CLN A;  2K60 A;  2LCP A;  4XJK A;  3MSE B;  1QLK A;  4HRG A;  3TS5 C;  1H8B A;  3EVV A;  1K96 A;  2JQ6 A;  4GGF C;  1MR8 A;  2KGR A;  3NSO A;  1WDC C;  2QEH A;  5KSZ A;  1QX2 A;  1CM4 A;  2CT9 A;  1K8U A;  5FYX A;  3KHE A;  2NLN A;  3CZ1 A;  3CS1 A;  3IQO A;  4QJ3 B;  3L4A A;  2KLD A;  3SG2 A;  1PVB A;  1MF8 B;  1SSE B;  1QXP A;  4C0K A;  1ORG A;  1QAT A;  2M49 B;  1CMF A;  1RWY A;  1OOH A;  1R2U A;  1OSA A;  4PHM A;  1H4B A;  3UO9 A;  1TNP A;  4CLN A;  2EHB A;  1Z2C B;  4ORA B;  2M3W A;  1SMG A;  3DF0 B;  4WRI A;  2SAS A;  1KK7 Y;  1WRZ A;  1WLM A;  3FE6 A;  2LMV A;  1QAS A;  2HF5 A;  4MSP A;  3D75 A;  1K9U A;  3O2P A;  2MBX A;  1C7V A;  2M1U A;  5KTY A;  1GJY A;  1S6I A;  1T14 A;  1NP8 A;  1TNX A;  1QVI Z;  2K7C A;  1KSO A;  1OOF A;  2DOQ A;  3CR4 X;  1DTL A;  3R72 A;  5JOL A;  3PLF B;  1AJ4 A;  3GK1 A;  2H8V A;  1RK9 A;  2BCA A;  3HX4 A;  3OHM B;  2ZKM X;  4JWQ A;  2JPT A;  4MZL A;  2WCH A;  5I94 A;  1JSA A;  2V53 A;  3D0Y B;  1S3P A;  2K7O A;  3SG5 A;  2AUC A;  2RGI A;  1JFK A;  4YGB B;  1CFF A;  1IQ3 A;  2WND A;  5AXI A;  3I5H B;  1C3Y A;  4IJ7 A;  4OVN F;  2LVK A;  1MHO A;  1UHK A;  3RLZ A;  1IJ5 A;  1NCX A;  1M45 A;  1DEL A;  1K94 A;  1REC A;  1VRK A;  1XA5 A;  2M29 A;  2O5G A;  3EK8 A;  4YGE B;  1EH2 A;  2PVB A;  1JUO A;  3EVU A;  2JT0 A;  3VRP A;  1K9P A;  1GQM A;  3BFA A;  2M7L A;  3OX5 A;  1J55 A;  2JWW A;  2PRU A;  2KSP A;  1RJV A;  5KU1 A;  1AP4 A;  1S1E A;  4JPZ B;  2LUC A;  4MLW A;  1A2X A;  1G8I A;  5B8I B;  1ZAC A;  2BEC A;  1CB1 A;  1TN4 A;  4U8D A;  4YGD B;  2H61 A;  4QJ4 B;  1BJF A;  3BQ3 A;  2GGZ A;  1KQM B;  3TDU A;  1ALV A;  1M31 A;  4D1E A;  3F45 A;  5TNC A;  4GGN A;  4UPG A;  1QLS A;  3BUW B;  1UHJ A;  1DJG A;  1DJW A;  2JT8 A;  1F4O A;  1OMV A;  3OX6 A;  2LVJ A;  4GBA A;  4MBE A;  1WRK A;  2K7B A;  1CFD A;  4OR9 B;  1JBA A;  4OZD A;  1AHR A;  3FE8 A;  1FI5 A;  2FJU B;  2KYF A;  3BFH A;  1CDM A;  1DJH A;  2I7A A;  2BKH B;  1UHI A;  2O60 A;  1DMO A;  3LK0 A;  5ER5 A;  2M1K B;  3I5H C;  4INW A;  1TCF A;  2JC2 A;  2JT3 A;  2OS8 B;  3JTD B;  2BL0 B;  1DGU A;  1YRU B;  2CTN A;  1QTX A;  3BFB A;  1J1E A;  1KK7 Z;  1OOI X;  1LS8 A;  1OOG A;  4KYN A;  1KK8 B;  5HKW A;  1BR4 B;  1BT6 A;  1B8R A;  2CXJ A;  5J3X A;  1YX8 A;  1UWO A;  2JTZ A;  1MQ1 A;  5CSI A;  4A4B A;  5F6T A;  2PQL A;  1WDC B;  4FQT A;  1XFX O;  3SG3 A;  3WHT B;  3BYA A;  1J7O A;  1SL7 A;  4I5L B;  1CDP A;  1DJZ A;  5AER A;  1DJY A;  1KQM C;  1SBJ A;  2JZI A;  3EVR A;  3RZS A;  4QJ5 B;  1FBV A;  1OZO A;  1V1G A;  2L51 A;  2M9G A;  2QEO A;  3AKA A;  1UHH A;  4NDB A;  3D78 A;  2FCD A;  2F3Z A;  2Y1N A;  4I5N B;  1A75 B;  5CSJ A;  1OMD A;  4N1F A;  3O4Y A;  3PSR A;  3D10 A;  4BY5 A;  4C0L A;  4OKH A;  1FI6 A;  4ZCV A;  4ORC B;  1ZOT B;  2E30 A;  3V2L A;  3FWC A;  2JUL A;  2LAN A;  3VRO A;  1PAL A;  1B47 A;  5CSF A;  3H4S E;  1S5G Y;  1KFU L;  2H2K A;  3BUM B;  1M46 A;  4E68 A;  3DVJ A;  2I18 A;  2PYQ A;  2BL0 C;  2VRG A;  4DRW A;  3Q8I A;  1YTZ C;  1NIW A;  3SG7 A;  1F55 A;  1TRF A;  1YUU A;  3OB2 B;  1BR1 B;  2TN4 A;  1KK8 C;  4OCI A;  1IIO A;  1PSR A;  2ZFD A;  4PE7 A;  3HCM A;  5HLO A;  2EGD A;  1SW8 A;  3S0E A;  2KI6 D;  1XFY O;  3O6B A;  1YRT B;  5FI7 A;  2IS9 A;  2F3Y A;  3NXA A;  2PMY A;  1UP5 A;  2ZN9 A;  1WRL A;  2PAS A;  1G33 A;  3RM1 A;  2QEV A;  4AQJ A;  1JFJ A;  3SS5 A;  2L0P A;  4GFT A;  2NXQ A;  4M2P A;  1E8A A;  2E6W A;  4PT1 A;  1FF1 A;  1Z4H A;  2KOT A;  3BOW A;  3CWG A;  2OTG C;  2LMT A;  2MHH A;  3BUX B;  3S0D A;  2Q4U A;  2CBL A;  3SS3 A;  3SG4 A;  1FPW A;  1RRO A;  2HPS A;  2FOT A;  2YGU A;  3OBV A;  3VRR A;  3I5G B;  3ZWH A;  1CMG A;  4USL A;  2L5Y A;  3DF0 A;  1CDN A;  2P71 A;  3SIA A;  1QV0 A;  4IL1 A;  5AFP A;  1TCO B;  2KLE A;  3CR2 A;  2G9B A;  1B1G A;  3R1P A;  1K90 D;  3FE9 A;  2COL B;  3A8R A;  1QWV A;  1XFV O;  1CLL A;  1NPQ A;  1SL9 A;  1XK4 A;  4I5J A;  2LP2 A;  3CZ2 A;  2WOS A;  2P6B B;  3DYE A;  1AVS A;  4L9M A;  3EK7 A;  4INX A;  4HRE E;  1U5I A;  2BCX A;  4GPL B;  5CPV A;  1Y0V H;  2KPH A;  3AAJ A;  3OP0 A;  1LVC D;  2JXL A;  1S26 D;  5DIC A;  2A4J A;  3O4X A;  1DGV A;  1CFP A;  3DVM A;  3BUO B;  2F8P A;  3L47 A;  3C1V A;  1F4Q A;  1GGW A;  1PVA A;  2K2F A;  1CM1 A;  4GUK A;  1KSM A;  2JNX A;  2WC8 A;  4PAL A;  3SG6 A;  1NX0 A;  1F8H A;  1LA0 A;  2HQ8 A;  1S5G Z;  2CNP A;  1L2O C;  4PE4 A;  5D3O A;  3I5G C;  2L50 A;  3NSK A;  1CDL A;  2FJY A;  4HRH A;  1AK8 A;  2LV7 A;  2MRD A;  1S6C A;  1F54 A;  1DJI A;  1KCY A;  4ZCU A;  2BBN A;  3AKB A;  3LLE A;  3TUY B;  2MLF C;  1AJ5 A;  1DVI A;  1NYA A;  1LXF C;  2Q91 A;  4M2O A;  3QME A;  1KFU S;  1SKT A;  3S0B A;  2SCP A;  4ETO A;  1B8C A;  2ISD A;  3B86 A;  3PN7 B;  5BPJ A;  4BY4 A;  2NZ0 A;  2KQ6 A;  4GNK B;  1TNQ A;  1QX7 A;  1TTX A;  2KAX A;  2MJW B;  5GQQ C;  4F0Z B;  1K95 A;  1KFX L;  5AAN A;  2WCK A;  2BCB A;  2LLS A;  2NCO A;  2Y1M A;  1B8L A;  3NHI A;  5DKR A;  3NGV A;  3EG5 B;  4TNC A;  3S0G A;  4JKT A;  5HKY A;  4FQO A;  4MN0 A;  3NSL A;  1PRW A;  1C3Z A;  1XFU O;  2L2E A;  4FTG A;  1OQP A;  2F2O A;  2KHN A;  3UNW A;  5I2Q A;  2LNK A;  2KGB C;  2LVV A;  3DY9 A;  1L7Z A;  1LKJ A;  1ZMZ A;  1N65 A; 
#chains in the Genus database with same CATH homology
 4PHN A;  3AAK A;  1C7W A;  1SR6 B;  4NDD A;  4GGF A;  1HQV A;  1MUX A;  2KBI A;  1M63 B;  4PDZ A;  3FS7 A;  3CZT X;  3TZ1 A;  1DF0 A;  1J7P A;  3TUY C;  4MZK A;  4WQ3 A;  1SYM A;  2M0R A;  3A4U B;  3GK4 X;  1IRJ A;  1MXL C;  3K21 A;  4HSZ A;  4PHK A;  4YRU A;  2LMU A;  2OTG B;  4MEW A;  3PN7 C;  1FW4 A;  3IQQ A;  2LAP A;  1M39 A;  3E3R A;  1DT7 B;  1XVJ A;  1BG1 A;  2HET A;  2LLT A;  3GOF A;  2KAY A;  3CGA A;  2LM5 A;  1IH0 A;  1YX7 A;  1J7R A;  1N2D A;  1UUS A;  1LA3 A;  1X02 A;  1NSH A;  1RFJ A;  2LE9 B;  1D1O A;  2LC5 A;  2H61 C;  3OB1 B;  2KI4 B;  1Y1X A;  2M8U A;  2QPT A;  3BUN B;  1WY9 A;  3FWB A;  4PE1 A;  4MRY A;  4XYN A;  1XYD A;  2BKI B;  4YI8 A;  2D8N A;  5ER4 X;  3QRX A;  5AEQ A;  1F71 A;  1QS7 A;  1QV1 A;  3DD4 A;  3PFV A;  3PAL A;  2KI6 C;  1SR6 C;  2K8M B;  1UHN A;  1NUB A;  2AMI A;  2JXC A;  2LVI A;  3I5I B;  2AAO A;  3GK2 A;  3SJS A;  1F70 A;  2L4I A;  2M97 A;  1NX2 A;  4CID A;  1QIV A;  1LIN A;  5IBW A;  2EC6 B;  1TIZ A;  2BE6 A;  2ZN8 A;  1RTP 1;  2JRF A;  1JF2 A;  1Y6W A;  4ICB A;  1BF5 A;  2JNF A;  1S36 A;  4PE0 A;  4R1E A;  5I2O A;  1A4P A;  3DVE A;  4AQI A;  3EK4 A;  1GGZ A;  4ORB B;  1MXE A;  4XJK B;  4PCW A;  1OZS A;  1L2O B;  2BBM A;  5DKN A;  3EKH A;  2F2P A;  2K2A A;  1CLM A;  1QX5 B;  4NDC A;  2L4H A;  1YVH A;  2KI4 C;  5D7F A;  5HLV A;  1KFX S;  3LK1 A;  1CNP A;  1NX3 A;  1A29 A;  1DJX A;  5I2L A;  1SPY A;  3ICB A;  4MZJ A;  3BOW B;  2KFF A;  3KEV A;  3VRQ A;  3CR5 X;  3M0W A;  1XO5 A;  3KPX A;  4A4C A;  4DUQ A;  1OMR A;  1YR5 A;  3I5I C;  1BLQ A;  3D0Y A;  2LP3 A;  1TNW A;  1B4C A;  1SK6 D;  1R6P A;  3CTN A;  4MVF A;  2EC6 C;  4OV2 A;  1EG4 A;  1ALW A;  2KNE A;  1YVL A;  2LUX A;  1QJT A;  1C07 A;  1IGV A;  4NQG A;  1JF0 A;  4WQ2 A;  3KO0 A;  2I2R E;  3I5F B;  1UUR A;  2PSR A;  1QIW A;  2LHL A;  4YGA A;  2Y4Q A;  1U5I B;  5I8N A;  1ODB A;  3ZNI A;  4Q04 A;  4CFQ A;  1KWO B;  2MLE C;  1SCM B;  1B7T Y;  2K61 A;  1WLZ A;  2KFH A;  3PAT A;  1BOD A;  1YUR A;  1IWQ A;  3DVK A;  1BOC A;  2G2B A;  5JJG A;  2F33 A;  2L98 A;  4P2Y B;  1NCZ A;  2K7D A;  1NCY A;  2MA2 A;  2KDH A;  2LLU A;  4M2Q A;  3PM8 A;  2KYC A;  5CSN A;  2JOJ A;  1K9K A;  1N0Y A;  1YUS A;  2HQW A;  1NWD A;  1J1D A;  3FIA A;  1W7I B;  3WXA A;  4N5X A;  1EJ3 A;  1S6J A;  3O78 A;  1OOJ A;  1Y1A A;  2R2I A;  1YUT A;  3BXK A;  4P5O E;  1MWN A;  1XFZ O;  1G4Y R;  4YBH B;  3TDI A;  3LCP C;  1BU3 A;  2KAV A;  1XK4 C;  1IQ5 A;  3I5F C;  5G08 A;  1EL4 A;  2PAL A;  2QAC A;  1AUI B;  1B9A A;  4AOM A;  5HYD A;  4CPV A;  1IKU A;  2L5X B;  3JVT B;  5HKZ A;  1HT9 A;  1PK0 D;  1PUL A;  1CTR A;  1IJ6 A;  1KWO C;  1OE9 B;  1SNL A;  1SCM C;  2CCM A;  2NCP A;  1XFW O;  2ZRS A;  1BMO A;  4DIR A;  2KQY A;  2JTT A;  2LHI A;  3SIB A;  2OPO A;  2M7N A;  4GAO A;  1EXR A;  2B1U A;  4C0J A;  1IG5 A;  4YGC B;  1A75 A;  4MRX A;  2ZNE A;  3TS5 B;  4N1G A;  1K93 D;  2ZRT A;  2Y5I A;  1QVI Y;  1SCV A;  5PAL A;  1DF0 B;  1K2H A;  5DKQ A;  3WHU B;  2JU0 A;  2ZND A;  1V1F A;  2WOR A;  5K89 A;  1TOP A;  4I5K A;  3NSI A;  2BE4 A;  2KBM A;  4JQ0 D;  1W7J B;  1J7Q A;  1B7T Z;  3TDZ A;  3WNX B;  4DS7 A;  2KFG A;  3IF7 A;  2GGM A;  3JVT C;  4PHJ A;  3KF9 A;  1JWD A;  5D69 A;  1EG3 A;  2WCB A;  1SY9 A;  1JC2 A;  1SL8 A;  2FCE A;  1CFC A;  1ZUZ A;  2I94 A;  4CFR A;  3VGO A;  1PSB A;  2OS8 C;  3JTD C;  1Y1U A;  2K0J A;  1CLB A;  1ZFS A;  4DCK A;  1A03 A;  2WCE A;  2WCF A;  1KQV A;  3VRN A;  1SRA A;  3EKJ A;  3LL8 B;  1Q80 A;  4YI9 A;  1NX1 A;  2MAZ A;  2GV5 A;  3CLN A;  1H8B A;  2LCP A;  4XJK A;  3MSE B;  1QLK A;  4HRG A;  3TS5 C;  3EVV A;  1K96 A;  2JQ6 A;  4GGF C;  1MR8 A;  2KGR A;  3NSO A;  1WDC C;  5KSZ A;  1QX2 A;  1CM4 A;  2CT9 A;  1K8U A;  5FYX A;  3KHE A;  2NLN A;  3CS1 A;  3IQO A;  4QJ3 B;  3SG2 A;  1PVB A;  1MF8 B;  1QXP A;  4C0K A;  1QAT A;  2M49 B;  1CMF A;  1RWY A;  1R2U A;  1OSA A;  4PHM A;  1H4B A;  1TNP A;  4CLN A;  2EHB A;  4ORA B;  2M3W A;  1SMG A;  3DF0 B;  4WRI A;  2SAS A;  1KK7 Y;  1WRZ A;  1WLM A;  2LMV A;  1QAS A;  2HF5 A;  4MSP A;  1K9U A;  3O2P A;  2MBX A;  1C7V A;  2M1U A;  5KTY A;  1GJY A;  1S6I A;  1NP8 A;  1TNX A;  1QVI Z;  2K7C A;  1KSO A;  5JOL A;  2DOQ A;  3CR4 X;  1DTL A;  3PLF B;  1AJ4 A;  3GK1 A;  1RK9 A;  2BCA A;  3HX4 A;  3OHM B;  2ZKM X;  4JWQ A;  2JPT A;  4MZL A;  1JSA A;  2V53 A;  3D0Y B;  1S3P A;  2K7O A;  3SG5 A;  2AUC A;  2RGI A;  1JFK A;  4YGB B;  1CFF A;  1IQ3 A;  2WND A;  5AXI A;  3I5H B;  4OVN F;  2LVK A;  1MHO A;  1UHK A;  3RLZ A;  1IJ5 A;  1NCX A;  1M45 A;  1VRK A;  1K94 A;  1REC A;  1XA5 A;  2M29 A;  2O5G A;  3EK8 A;  4YGE B;  1CKK A;  1EH2 A;  2PVB A;  1JUO A;  3EVU A;  2JT0 A;  3VRP A;  1K9P A;  1GQM A;  2M7L A;  3OX5 A;  1J55 A;  2JWW A;  2PRU A;  2KSP A;  1RJV A;  5KU1 A;  1AP4 A;  1S1E A;  4JPZ B;  2LUC A;  4MLW A;  1A2X A;  1G8I A;  5B8I B;  1ZAC A;  2BEC A;  1CB1 A;  1TN4 A;  4U8D A;  4YGD B;  2H61 A;  4QJ4 B;  1BJF A;  3BQ3 A;  2GGZ A;  1KQM B;  3TDU A;  1ALV A;  1M31 A;  4D1E A;  3F45 A;  5TNC A;  4GGN A;  4UPG A;  1QLS A;  3BUW B;  1UHJ A;  1DJG A;  1DJW A;  2JT8 A;  1F4O A;  1OMV A;  3OX6 A;  2LVJ A;  4GBA A;  4MBE A;  1WRK A;  2K7B A;  1CFD A;  4OR9 B;  1JBA A;  1AHR A;  1FI5 A;  2FJU B;  2KYF A;  1CDM A;  1DJH A;  2I7A A;  2BKH B;  1UHI A;  2O60 A;  1DMO A;  3LK0 A;  5ER5 A;  2M1K B;  3I5H C;  1TCF A;  2JC2 A;  2JT3 A;  2OS8 B;  3JTD B;  2BL0 B;  1DGU A;  1YRU B;  2CTN A;  1QTX A;  1J1E A;  1KK7 Z;  1KK8 B;  5HKW A;  1BR4 B;  1BT6 A;  1B8R A;  2CXJ A;  5J3X A;  1YX8 A;  1UWO A;  2JTZ A;  1MQ1 A;  5CSI A;  4A4B A;  5F6T A;  3SG3 A;  1WDC B;  3WHT B;  1XFX O;  3BYA A;  1J7O A;  1SL7 A;  4I5L B;  1CDP A;  1DJZ A;  5AER A;  1DJY A;  1KQM C;  1SBJ A;  2JZI A;  3EVR A;  4QJ5 B;  1FBV A;  1OZO A;  1V1G A;  2L51 A;  2M9G A;  3AKA A;  1UHH A;  4NDB A;  4I5N B;  2FCD A;  2F3Z A;  2Y1N A;  1A75 B;  5CSJ A;  1OMD A;  4N1F A;  3O4Y A;  3PSR A;  3D10 A;  4BY5 A;  4C0L A;  4OKH A;  1FI6 A;  4ZCV A;  4ORC B;  1ZOT B;  2E30 A;  3FWC A;  2JUL A;  2LAN A;  3VRO A;  1PAL A;  1B47 A;  5CSF A;  3H4S E;  1S5G Y;  1KFU L;  2H2K A;  3BUM B;  1M46 A;  4E68 A;  3DVJ A;  2I18 A;  2VRG A;  2BL0 C;  4DRW A;  1YTZ C;  1NIW A;  3SG7 A;  1F55 A;  1TRF A;  1YUU A;  3OB2 B;  1BR1 B;  2TN4 A;  1KK8 C;  4OCI A;  1PSR A;  2ZFD A;  4PE7 A;  3HCM A;  5HLO A;  2EGD A;  1SW8 A;  2KI6 D;  1XFY O;  3O6B A;  1YRT B;  2IS9 A;  2F3Y A;  3NXA A;  2PMY A;  1UP5 A;  2ZN9 A;  1WRL A;  2PAS A;  1G33 A;  3RM1 A;  4AQJ A;  1JFJ A;  2L0P A;  4GFT A;  2NXQ A;  4M2P A;  1E8A A;  2E6W A;  1FF1 A;  2KOT A;  3BOW A;  3CWG A;  2OTG C;  2LMT A;  2MHH A;  3BUX B;  2Q4U A;  2CBL A;  1FPW A;  3SG4 A;  1RRO A;  2HPS A;  2FOT A;  3VRR A;  3I5G B;  3ZWH A;  1CMG A;  4USL A;  3DF0 A;  1CDN A;  3SIA A;  1QV0 A;  4IL1 A;  5AFP A;  1TCO B;  3CR2 A;  2G9B A;  1B1G A;  1K90 D;  2COL B;  3A8R A;  1XFV O;  1CLL A;  1NPQ A;  1SL9 A;  1XK4 A;  4I5J A;  2LP2 A;  2WOS A;  2P6B B;  1AVS A;  4L9M A;  3EK7 A;  4HRE E;  1U5I A;  2BCX A;  4GPL B;  5CPV A;  1Y0V H;  3AAJ A;  3OP0 A;  1LVC D;  2JXL A;  1S26 D;  2A4J A;  1DGV A;  1CFP A;  3DVM A;  3BUO B;  2F8P A;  3C1V A;  1F4Q A;  1GGW A;  1PVA A;  2K2F A;  1CM1 A;  4GUK A;  1KSM A;  2JNX A;  2WC8 A;  4PAL A;  3SG6 A;  1NX0 A;  1F8H A;  1LA0 A;  2HQ8 A;  1S5G Z;  2CNP A;  1L2O C;  4PE4 A;  3I5G C;  2L50 A;  3NSK A;  1CDL A;  4HRH A;  1AK8 A;  2LV7 A;  2MRD A;  1S6C A;  1F54 A;  1DJI A;  1KCY A;  4ZCU A;  2BBN A;  3AKB A;  3LLE A;  3TUY B;  2MLF C;  1AJ5 A;  1DVI A;  1NYA A;  1LXF C;  2Q91 A;  4M2O A;  1KFU S;  1SKT A;  2SCP A;  4ETO A;  1B8C A;  2ISD A;  3PN7 B;  5BPJ A;  4BY4 A;  2NZ0 A;  2KQ6 A;  4GNK B;  1TNQ A;  1QX7 A;  1TTX A;  2KAX A;  2MJW B;  5GQQ C;  4F0Z B;  1K95 A;  1KFX L;  5AAN A;  2BCB A;  2LLS A;  2NCO A;  2Y1M A;  1B8L A;  5DKR A;  4TNC A;  5HKY A;  4FQO A;  4MN0 A;  3NSL A;  1PRW A;  1XFU O;  2L2E A;  4FTG A;  1OQP A;  2F2O A;  2KHN A;  5I2Q A;  2LNK A;  2KGB C;  2LVV A;  1L7Z A;  1LKJ A;  1ZMZ A;  1N65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...