1U5IB

Crystal structure analysis of rat m-calpain mutant lys10 thr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
NESEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain 2, large [catalytic] subunit precursor
publication title Activation of calpain by Ca2+: roles of the large subunit N-terminal and domain III-IV linker peptides
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1u5iB00
1JUOA 4GGFA 1DJXA 2KAVA 4ETOA 2KI4B 4PHKA 1F70A 1J7OA 1J7PA 3A8RA 4Q04A 1DF0A 2F33A 2LMTA 5AFPA 1SYMA 4GBAA 2CNPA 1A4PA 1S36A 1UURA 1J1EA 2LLTA 3VGOA 3ZNIA 4CIDA 1G33A 3C1VA 1TCFA 2HQ8A 3AAJA 3VRQA 1DF0B 2LHLA 1MF8B 1OSAA 2ZFDA 1D1OA 3CS1A 4YGAA 4E68A 3NSKA 2CXJA 1DJGA 1CNPA 1QTXA 1KFXL 1QASA 3KHEA 2JZIA 1K94A 3O4YA 2FJUB 2KBMA 2EHBA 2KDHA 3CR2A 1S6JA 2NLNA 5J3XA 4USLA 2K0JA 2K7OA 4AOMA 4M2QA 2F8PA 2BE6A 3I5HB 2H2KA 3O6BA 2KNEA 1XA5A 5KTYA 3JTDB 1BLQA 1NSHA 3PLFB 3VROA 2HQWA 1CKKA 1RK9A 1JFKA 1Y6WA 2LLSA 1S1EA 1SCMC 4DUQA 2CBLA 4DRWA 1QS7A 3A4UB 4AQJA 3TUYC 2OS8C 1B47A 1XK4A 2F3ZA 1SNLA 3SG4A 2BBNA 2PALA 3PM8A 2LC5A 2M7NA 1LA0A 3TDZA 2KOTA 1K9PA 1B7TY 3BOWA 4D1EA 1NX0A 2BL0C 1XFXO 2KQ6A 1B9AA 2LUCA 2EC6C 4GNKB 4HRGA 1EH2A 3WNXB 3SG5A 1OMRA 1UHKA 2NCPA 4MZLA 3FWBA 2OPOA 3BOWB 3RM1A 1KWOC 1QX5B 1E8AA 1S26D 1YVHA 1J1DA 2PRUA 1SL8A 1CDPA 4PHMA 4YGDB 1N65A 2A4JA 3BUNB 2LCPA 1ZUZA 1TN4A 2B1UA 2KHNA 4JQ0D 2L0PA 4NDBA 3EK8A 1EG4A 4ORBB 1AK8A 1DTLA 2JT8A 3KO0A 4PE0A 1L7ZA 1XFYO 1J55A 4P5OE 3EKHA 1AP4A 2Y1MA 1EJ3A 3PN7B 1M63B 4XJKA 1NYAA 3RLZA 1WY9A 2WCEA 1F54A 1TNXA 3NSOA 5CSFA 5HKWA 1V1GA 1SK6D 4A4CA 1DJYA 1S6CA 1ALVA 1XYDA 4XJKB 2LE9B 2O60A 2L98A 3TS5C 2KSPA 2JC2A 1FW4A 1K9UA 3O2PA 3BQ3A 1AVSA 4ORAB 4CFRA 1PSRA 2KI4C 1OZSA 1L2OB 5PALA 1B8RA 4L9MA 1KFUL 4OV2A 1QXPA 3HCMA 1KFXS 1NUBA 2E6WA 4QJ3B 4GGFC 3FWCA 1UHIA 3NSLA 1NIWA 2JNXA 4ORCB 3EVRA 3BYAA 1UP5A 3LK1A 1IRJA 2F2OA 2GGMA 1YRUB 2WNDA 1QV0A 1FI6A 4HRHA 1BOCA 4YRUA 2CCMA 1M45A 1ZOTB 1HT9A 2KI6C 2LVKA 5AERA 1OOJA 3EK7A 4YGBB 4CLNA 4ICBA 3CR4X 1DMOA 1TNQA 2KFGA 2FCDA 5HYDA 2JNFA 3CWGA 2KYCA 4DIRA 1BJFA 3D10A 2MHHA 2HF5A 3EVUA 2M0RA 1H4BA 2BKIB 2NZ0A 3CZTX 4IL1A 1Y0VH 3DVJA 5I2OA 2F3YA 1B1GA 3I5HC 4DCKA 1XO5A 2Q4UA 3CGAA 1S3PA 2M3WA 4MEWA 1BMOA 3JTDC 2LMVA 1ZACA 3OB1B 1KK8B 2JXCA 4YI8A 5I8NA 5IBWA 1GGWA 2L4HA 4UPGA 2WORA 1KCYA 4OCIA 1MXEA 2L5XB 5DKQA 1UHHA 1K96A 1B8LA 4OVNF 1FPWA 3ZWHA 1YRTB 3SG6A 1CTRA 1LA3A 2D8NA 2KYFA 1W7JB 1NCXA 1GQMA 1XFZO 1PVAA 1PVBA 1DGUA 2KFHA 3WHUB 2EGDA 1PSBA 3BUMB 1WRLA 1NX1A 1VRKA 5B8IB 2KAYA 3I5FB 1XK4C 2JTZA 3BUWB 3I5IB 1SY9A 1TOPA 4I5JA 2JT3A 3TDUA 4OR9B 1DJIA 2JWWA 1KSMA 1K93D 2F2PA 2IS9A 2ZRTA 1KQVA 1H8BA 2WCFA 4ZCVA 4M2PA 1NX3A 2M9GA 1MQ1A 1A03A 3K21A 4MVFA 1YUSA 1M39A 3PSRA 1IKUA 1N0YA 3F45A 3OP0A 3SIBA 1C07A 3LL8B 1JC2A 1KK7Z 1AUIB 2L51A 3SG2A 1NX2A 1S5GZ 1K2HA 2Y4QA 1JF0A 1B8CA 2M7LA 3MSEB 1SPYA 5GQQC 2KI6D 5HKZA 1C7VA 2LVVA 1TNWA 5I2LA 5BPJA 2PASA 1IJ6A 5DKRA 1LKJA 2LVIA 3SIAA 4CFQA 1K9KA 2I2RE 3PN7C 3OHMB 3CLNA 4JPZB 5KSZA 2LANA 2LV7A 2M97A 4I5NB 4I5LB 2K7BA 2CT9A 1Y1UA 3KF9A 1B7TZ 1KFUS 2JXLA 4P2YB 5D69A 3SG3A 1IG5A 1XFUO 2R2IA 1RJVA 3AKBA 4MRYA 3WXAA 1CM4A 3ICBA 2L4IA 1F71A 4GPLB 1IGVA 1DVIA 1L2OC 1CLBA 5CSIA 1DJHA 1KQMB 3DVKA 2K7CA 3KPXA 3NSIA 3CR5X 5JOLA 5AEQA 1QIVA 4BY5A 1Y1AA 1OZOA 5HKYA 5F6TA 1XFVO 5CPVA 1B4CA 1SR6B 1FBVA 2M1KB 2E30A 1RWYA 3OX5A 2BKHB 4PALA 2BCBA 1JWDA 1YURA 2AUCA 2PSRA 5ER5A 1QX7A 2BCAA 1NP8A 4MZJA 2K8MB 4C0JA 1QVIZ 4WQ2A 1G4YR 3KEVA 4AQIA 2ISDA 1HQVA 4PE4A 1RROA 2ZNEA 1YX7A 1F4QA 2H61A 1CDLA 3EVVA 4PDZA 3PATA 3SJSA 4CPVA 1WDCB 3OX6A 2Y5IA 4DS7A 4PHNA 3NXAA 3GOFA 1IWQA 3BUOB 2JPTA 1LINA 2MBXA 1M31A 1KK8C 1QLKA 1NCYA 5I2QA 2BE4A 1MR8A 4F0ZB 3I5GB 2NXQA 2JRFA 1DT7B 4GUKA 3LCPC 1TCOB 2I7AA 2O5GA 5HLOA 2G2BA 4BY4A 3LLEA 1OMDA 2LM5A 3VRNA 1OE9B 3I5IC 3I5FC 2OTGB 1KSOA 2JULA 2K2FA 2KGBC 1LVCD 4PE1A 1DGVA 2WC8A 2KGRA 2HPSA 2K2AA 1A29A 1F55A 3DD4A 1TRFA 1CLMA 1F4OA 1DJWA 2KFFA 4M2OA 2AAOA 1F8HA 1BT6A 1QATA 2PMYA 5D7FA 3JVTB 1SL7A 1R6PA 1SCVA 4WQ3A 1A75A 1WRKA 1QX2A 3PFVA 1QIWA 2K7DA 2GV5A 2LAPA 1U5IA 1XVJA 2WCBA 1SMGA 2LP2A 1UHNA 2QPTA 4GAOA 3CTNA 5TNCA 1QJTA 1A75B 1ZMZA 1NWDA 1SBJA 1YX8A 2LHIA 1XFWO 1PULA 3FS7A 4GGNA 5AANA 1JSAA 1Y1XA 2QACA 2ZRSA 2JOJA 3HX4A 4ZCUA 1U5IB 1J7QA 2BECA 4PHJA 1FI5A 1RFJA 1YTZC 2SASA 1MWNA 3GK2A 4XYNA 2PVBA 1FF1A 1K90D 1G8IA 2KBIA 4NQGA 4QJ5B 1BF5A 4MZKA 2MLEC 4PCWA 1CFCA 5KU1A 1EXRA 1WLMA 2JTTA 1PALA 3TZ1A 3AAKA 2BBMA 1JF2A 1TNPA 3IQQA 3WHTB 1LXFC 4NDCA 1OQPA 2LP3A 2LUXA 3E3RA 1WRZA 1KQMC 1KK7Y 1S5GY 1CMGA 4OKHA 1MHOA 2LLUA 3IQOA 4FQOA 2COLB 4A4BA 1CFFA 1SR6C 1A2XA 3VRRA 3O78A 1YR5A 1NCZA 1BR4B 1RTP1 1V1FA 2JT0A 1BG1A 3DVMA 1AHRA 2HETA 2JQ6A 4R1EA 2ZN9A 1CDNA 3OB2B 5DKNA 1UUSA 2WOSA 1IH0A 1ODBA 1CLLA 4PE7A 4N5XA 1CM1A 5CSJA 2NCOA 2MA2A 5CSNA 1NPQA 1WLZA 4QJ4B 1BU3A 1WDCC 1QV1A 3BXKA 2VRGA 3EK4A 1MXLC 2K61A 4JWQA 3SG7A 2ZN8A 2H61C 4MBEA 1DJZA 1OMVA 1PRWA 1S6IA 1TIZA 2KQYA 3GK4X 4U8DA 2M8UA 1K8UA 2BCXA 3VRPA 4GFTA 2LMUA 1JBAA 5ER4X 5JJGA 2AMIA 3I5GC 4YGEB 1M46A 4MRXA 1SCMB 1C7WA 2LNKA 4TNCA 4I5KA 2ZNDA 3TUYB 2OS8B 4C0KA 3M0WA 1SL9A 2M29A 2L50A 4YBHB 1IJ5A 4N1FA 2OTGC 2V53A 2SCPA 2GGZA 2BL0B 2FCEA 1QVIY 1AJ4A 2EC6B 1ALWA 2JU0A 1Q80A 1CFDA 1PK0D 1CB1A 4N1GA 1X02A 2CTNA 3FIAA 1SRAA 1CMFA 1YUUA 2FOTA 3DVEA 1KWOB 2MLFC 1EL4A 1BODA 3DF0A 2TN4A 3JVTC 4HSZA 2P6BB 1QLSA 4YGCB 3H4SE 1EG3A 4C0LA 1R2UA 1YUTA 1J7RA 2RGIA 1GGZA 1YVLA 3GK1A 1CDMA 3DF0B 2M49B 2G9BA 3LK0A 2LVJA 3PALA 1UWOA 2I18A 2ZKMX 4MSPA 2Q91A 2KAXA 5FYXA 1CFPA 2I94A 3QRXA 1IQ3A 2Y1NA 1RECA 2MAZA 2L2EA 1ZFSA 5HLVA 4YI9A 4MN0A 1SW8A 3IF7A 1JFJA 1W7IB 4MLWA 5AXIA 2MRDA 3D0YA 1MUXA 3EKJA 4NDDA 5K89A 1IQ5A 2M1UA 1UHJA 4HREE 5G08A 1TTXA 1BR1B 4WRIA 3TDIA 2DOQA 4FTGA 3AKAA 3TS5B 1N2DA 1AJ5A 2MJWB 1SKTA 1K95A 3D0YB 1GJYA 3BUXB
chains in the Genus database with same CATH superfamily
1JUOA 4GGFA 1DJXA 2KAVA 4ETOA 2KI4B 4PHKA 1F70A 1J7OA 1DELA 3A8RA 1J7PA 4Q04A 1DF0A 2F33A 2LMTA 5AFPA 1SYMA 4GBAA 2CNPA 1A4PA 1S36A 1UURA 1J1EA 2LLTA 3VGOA 3ZNIA 4CIDA 1G33A 3C1VA 1TCFA 2HQ8A 3AAJA 3VRQA 1DF0B 2LHLA 1MF8B 1OSAA 2ZFDA 1D1OA 3CS1A 1OOIX 4YGAA 4E68A 3NSKA 2CXJA 1DJGA 2PYQA 4IJ7A 1QTXA 1KFXL 1QASA 3KHEA 5DICA 1CNPA 2JZIA 1K94A 3O4YA 2FJUB 1TWOA 2KBMA 2EHBA 4JD9A 2KDHA 3CR2A 1S6JA 2NLNA 3FE6A 5J3XA 4USLA 2K0JA 2K7OA 4AOMA 4M2QA 5EL2A 3D76A 2F8PA 2BE6A 1Z4HA 3I5HB 2GTEA 2H2KA 3O6BA 2KNEA 1XA5A 5KTYA 3JTDB 3IVTA 3SS3A 1BLQA 1NSHA 3N7HA 3PLFB 3VROA 2HQWA 3BJHA 1CKKA 1RK9A 1JFKA 1Y6WA 2LLSA 1S1EA 1SCMC 4DUQA 2CBLA 4DRWA 1QS7A 3A4UB 3O4XA 5FI7A 4AQJA 3TUYC 2OS8C 1B47A 1XK4A 2F3ZA 1SNLA 3SG4A 2BBNA 2PALA 1OW4A 2LC5A 2M7NA 1LA0A 3PM8A 3TDZA 2KOTA 5FI2A 1K9PA 1B7TY 3BOWA 4D1EA 1NX0A 2BL0C 1XFXO 2KQ6A 3NGVA 4DCKA 1B9AA 2LUCA 2BNXA 2EC6C 4GNKB 2L2CA 4HRGA 1EH2A 3WNXB 3SG5A 1OMRA 1OOFA 1UHKA 2NCPA 4MZLA 3S0AA 3FWBA 2OPOA 3BOWB 3RM1A 1KWOC 1QX5B 1E8AA 1S26D 1YVHA 1J1DA 3PM2A 2PRUA 1TUZA 3B6XA 1SL8A 2WCJA 1CDPA 2WCHA 4PHMA 4YGDB 1N65A 2A4JA 3BUNB 2LCPA 1ZUZA 1TN4A 2B1UA 2KHNA 4JQ0D 2L0PA 2L5YA 4NDBA 3EK8A 1EG4A 4ORBB 1AK8A 1DTLA 2JT8A 3KO0A 4PE0A 1L7ZA 1XFYO 1J55A 4P5OE 2WCKA 3EKHA 1AP4A 2Y1MA 1EJ3A 3PN7B 1M63B 4XJKA 1NYAA 3RLZA 1WY9A 2WCEA 4KYNA 1F54A 2KLEA 1TNXA 3NSOA 5CSFA 5HKWA 1V1GA 1SK6D 4A4CA 1DJYA 2YGUA 1S6CA 1ALVA 1XYDA 4XJKB 2LE9B 2O60A 2L98A 3TS5C 2KSPA 2JC2A 1FW4A 1K9UA 2QEVA 3CDNA 3O2PA 3BQ3A 1AVSA 4ORAB 3L4AA 2KPHA 4CFRA 3L47A 1PSRA 2KI4C 1OZSA 1L2OB 2QEOA 5PALA 1B8RA 4L9MA 1KFUL 4OV2A 1QXPA 3HCMA 1KFXS 1NUBA 2E6WA 4QJ3B 4GGFC 3FWCA 1UHIA 3NSLA 1NIWA 2JNXA 4ORCB 3EVRA 3BYAA 1DQEA 1UP5A 3LK1A 1IRJA 2F2OA 2GGMA 1YRUB 2WNDA 1QV0A 1FI6A 1XFRA 4HRHA 1BOCA 4YRUA 2CCMA 1M45A 1ZOTB 1HT9A 2KI6C 2LVKA 5AERA 1OOJA 3EK7A 4YGBB 4CLNA 4ICBA 3CR4X 1DMOA 1TNQA 2KFGA 2FCDA 5HYDA 2JNFA 3CWGA 2KYCA 4DIRA 1BJFA 3D10A 2MHHA 2HF5A 3EVUA 3D77A 2M0RA 2P70A 1H4BA 2BKIB 2NZ0A 3CZTX 4IL1A 1Y0VH 3DVJA 5I2OA 2F3YA 1B1GA 3I5HC 3OGNA 1XO5A 2BAPA 2Q4UA 1S3PA 3CGAA 2M3WA 4JKTA 1BMOA 3JTDC 2LMVA 1ZACA 3OB1B 1KK8B 2JXCA 4MEWA 4YI8A 5I8NA 5IBWA 2L4HA 4UPGA 2WORA 1KCYA 4OCIA 1MXEA 2L5XB 5DKQA 1UHHA 1K96A 1B8LA 4OVNF 1FPWA 3ZWHA 1YRTB 4OZDA 3SG6A 1CTRA 1LA3A 2D8NA 2WC6A 2KYFA 1W7JB 1NCXA 1C3ZA 1GQMA 1XFZO 1PVAA 1PVBA 3SS5A 3CZ0A 1DGUA 2KFHA 3WHUB 2EGDA 1PSBA 3BUMB 1WRLA 1NX1A 1VRKA 5B8IB 2KAYA 3I5FB 1XK4C 2JTZA 3BUWB 3I5IB 1SY9A 1TOPA 4I5JA 2JT3A 3TDUA 4OR9B 1DJIA 2JWWA 3S0GA 3R1PA 1ORGA 1KSMA 1K93D 2F2PA 2IS9A 2ZRTA 1KQVA 1H8BA 2WCFA 1JSAA 4ZCVA 4M2PA 1NX3A 2M9GA 1MQ1A 3D73A 3K21A 4MVFA 1YUSA 1M39A 3PSRA 1A03A 1IKUA 1N0YA 3F45A 3OP0A 3SIBA 1C07A 3LL8B 1JC2A 1KK7Z 1AUIB 2L51A 3SG2A 1NX2A 1S5GZ 3S0BA 2Y4QA 1JF0A 1B8CA 2M7LA 1K2HA 3MSEB 1SPYA 5GQQC 2KI6D 5HKZA 1C7VA 2LVVA 1TNWA 3K1EA 3D75A 5I2LA 5BPJA 2PASA 1IJ6A 5DKRA 1LKJA 2LVIA 3BFHA 4PT1A 3SIAA 4CFQA 1K9KA 2I2RE 3DY9A 3PN7C 3OHMB 3CLNA 4JPZB 5KSZA 2LANA 2LV7A 2M97A 4I5NB 4I5LB 2K7BA 2CT9A 1Y1UA 3PJIA 3KF9A 5HL1A 1B7TZ 1KFUS 2JXLA 4P2YB 5D69A 3SG3A 1IG5A 1XFUO 3S0EA 2R2IA 1RJVA 3AKBA 3VB1A 4MRYA 3WXAA 1CM4A 3ICBA 2L4IA 1F71A 3S0FA 4GPLB 1IGVA 1GGWA 1DVIA 1L2OC 1CLBA 5CSIA 1DJHA 1IIOA 1OOHA 1KQMB 3DVKA 2K7CA 3KPXA 3NSIA 3CR5X 5JOLA 5AEQA 1QIVA 3UNWA 4BY5A 1Y1AA 1OZOA 3OBVA 5HKYA 5F6TA 1XFVO 2K60A 5CPVA 1SR6B 1FBVA 2M1KB 2E30A 1RWYA 3OX5A 1B4CA 2BKHB 4PALA 2BCBA 3R72A 1JWDA 1YURA 2AUCA 2PSRA 5ER5A 1QX7A 2BCAA 1NP8A 4MZJA 2K8MB 4C0JA 1QVIZ 4WQ2A 1G4YR 3KEVA 4AQIA 2ISDA 1HQVA 4PE4A 1RROA 2ZNEA 1YX7A 3CABA 1F4QA 2H61A 1CDLA 3EVVA 4PDZA 3PATA 3SJSA 4CPVA 1WDCB 3OX6A 2Y5IA 3V2LA 4PHNA 4DS7A 3DYEA 3EG5B 3NXAA 3GOFA 1IWQA 2WCMA 2JPTA 1LINA 3BUOB 4FQTA 2QEHA 2MBXA 1M31A 1KK8C 1QLKA 1NCYA 3D78A 5I2QA 2BE4A 1MR8A 4F0ZB 3I5GB 3QMEA 2NXQA 2JRFA 5D3OA 3CYZA 1DT7B 4F7FA 3Q8IA 4GUKA 3LCPC 1TCOB 2I7AA 2O5GA 5HLOA 1P28A 2G2BA 3SS4A 1T14A 3LLEA 4BY4A 1OMDA 2LM5A 3VRNA 1DEKA 1OE9B 3I5IC 3I5FC 2OTGB 1KSOA 2JULA 2K2FA 2KGBC 1LVCD 4PE1A 1DGVA 3BFAA 2WC8A 2KGRA 2HPSA 2K2AA 1A29A 1F55A 3DD4A 3NHTA 3S0DA 1TRFA 1CLMA 1F4OA 1DJWA 2KFFA 4M2OA 2AAOA 1F8HA 1BT6A 1QATA 2PMYA 5D7FA 3JVTB 1SL7A 1R6PA 1SCVA 4WQ3A 1A75A 1WRKA 1QX2A 3PFVA 1QIWA 2K7DA 2GV5A 2LAPA 3DXLA 1U5IA 1XVJA 2WCBA 1SMGA 2WCLA 2LP2A 1UHNA 2QPTA 4GAOA 3CTNA 5TNCA 1QJTA 1A75B 1ZMZA 1NWDA 1SBJA 1YX8A 2ERBA 2LHIA 1XFWO 3B87A 1PULA 1W9ZA 3FS7A 4GGNA 5AANA 1Y1XA 2QACA 2ZRSA 2JOJA 3HX4A 4ZCUA 1U5IB 1J7QA 2BECA 3CZ2A 4PHJA 1RFJA 1YTZC 2SASA 1MWNA 3GK2A 4XYNA 2PVBA 1FF1A 1QWVA 1K90D 1G8IA 3L4LA 2KBIA 4NQGA 1Z2CB 4QJ5B 1BF5A 4MZKA 2MLEC 4PCWA 1CFCA 3NHIA 5KU1A 1EXRA 1WLMA 2JTTA 1PALA 3TZ1A 3AAKA 3B88A 2BBMA 1JF2A 1TNPA 3IQQA 3WHTB 1LXFC 4NDCA 1OQPA 2LP3A 2KLDA 2LUXA 3E3RA 1WRZA 1KQMC 1KK7Y 2PQLA 1S5GY 1CMGA 4OKHA 1MHOA 2LLUA 2H8VA 3CZ1A 2COLB 3IQOA 4FQOA 4A4BA 1CFFA 1SR6C 1A2XA 3VRRA 3O78A 1YR5A 1NCZA 1BR4B 1RTP1 1V1FA 3FE8A 2JT0A 1BG1A 3DVMA 1AHRA 2HETA 3RZSA 2JQ6A 4R1EA 2ZN9A 1CDNA 3OB2B 3UO9A 5DKNA 1UUSA 2WOSA 1IH0A 1ODBA 1CLLA 4PE7A 4N5XA 1C3YA 1CM1A 5CSJA 2NCOA 2MA2A 5CSNA 1NPQA 1WLZA 4QJ4B 1BU3A 1WDCC 1QV1A 3BXKA 2VRGA 3EK4A 3D74A 1MXLC 2K61A 4JWQA 3BFBA 3SG7A 2QEBA 2ZN8A 2H61C 4MBEA 1DJZA 1OMVA 1PRWA 1S6IA 1TIZA 2KQYA 3GK4X 4U8DA 2M8UA 1K8UA 2BCXA 3VRPA 4GFTA 2LMUA 1JBAA 5ER4X 2P71A 5JJGA 2AMIA 3R1VA 3I5GC 4YGEB 1M46A 4MRXA 1SCMB 1C7WA 2LNKA 4TNCA 4I5KA 2ZNDA 4INWA 3TUYB 2OS8B 4C0KA 2JPOA 1SL9A 3M0WA 2M29A 2L50A 4YBHB 1IJ5A 4N1FA 2OTGC 2V53A 2SCPA 2GGZA 2BL0B 2FCEA 1QVIY 3DZTA 3R1OA 1AJ4A 2EC6B 1ALWA 2JU0A 1Q80A 1CFDA 1PK0D 1CB1A 4N1GA 1X02A 2CTNA 1LS8A 1SRAA 3FIAA 1CMFA 1YUUA 2FOTA 3DVEA 1KWOB 2MLFC 1EL4A 1BODA 3DF0A 2TN4A 3JVTC 4INXA 4HSZA 2P6BB 1QLSA 4YGCB 3H4SE 1EG3A 4C0LA 1R2UA 1FI5A 1OOGA 1YUTA 1J7RA 2RGIA 1GGZA 1YVLA 3B86A 2FJYA 1CDMA 3GK1A 3DF0B 1GM0A 2M49B 2G9BA 3LK0A 2LVJA 3PALA 1UWOA 2I18A 2ZKMX 4MSPA 2Q91A 2QDIA 2KAXA 5FYXA 1CFPA 1SSEB 2I94A 3QRXA 5FI6A 1IQ3A 1DC1A 2Y1NA 1RECA 2MAZA 2L2EA 1ZFSA 3B7AA 5HLVA 4YI9A 4MN0A 1SW8A 3IF7A 1JFJA 1W7IB 4MLWA 5AXIA 2MRDA 3D0YA 1MUXA 3EKJA 4NDDA 5I94A 5K89A 1IQ5A 2M1UA 1UHJA 4HREE 5G08A 1TTXA 1BR1B 4WRIA 3TDIA 2DOQA 4FTGA 3FE9A 3AKAA 3TS5B 1TUJA 2WC5A 1N2DA 1AJ5A 2MJWB 1SKTA 1K95A 3D0YB 1GJYA 3BUXB
chains in the Genus database with same CATH topology
1JUOA 4GGFA 1DJXA 2KAVA 4ETOA 2KI4B 4PHKA 1F70A 1J7OA 1J7PA 3A8RA 4Q04A 1DF0A 2F33A 2LMTA 5AFPA 1SYMA 4GBAA 2CNPA 1A4PA 1S36A 1UURA 1J1EA 2LLTA 3VGOA 3ZNIA 4CIDA 1G33A 3C1VA 1TCFA 2HQ8A 3AAJA 3VRQA 1DF0B 2LHLA 1MF8B 1OSAA 2ZFDA 1D1OA 3CS1A 4YGAA 4E68A 3NSKA 2CXJA 1DJGA 1CNPA 1QTXA 1KFXL 1QASA 3KHEA 2JZIA 1K94A 3O4YA 2FJUB 2KBMA 2EHBA 2KDHA 3CR2A 1S6JA 2NLNA 5J3XA 4USLA 2K0JA 2K7OA 4AOMA 4M2QA 2F8PA 2BE6A 3I5HB 2H2KA 3O6BA 2KNEA 1XA5A 5KTYA 3JTDB 1BLQA 1NSHA 3PLFB 3VROA 2HQWA 1CKKA 1RK9A 1JFKA 1Y6WA 2LLSA 1S1EA 1SCMC 4DUQA 2CBLA 4DRWA 1QS7A 3A4UB 4AQJA 3TUYC 2OS8C 1B47A 1XK4A 2F3ZA 1SNLA 3SG4A 2BBNA 2PALA 3PM8A 2LC5A 2M7NA 1LA0A 3TDZA 2KOTA 1K9PA 1B7TY 3BOWA 4D1EA 1NX0A 2BL0C 1XFXO 2KQ6A 1B9AA 2LUCA 2EC6C 4GNKB 4HRGA 1EH2A 3WNXB 3SG5A 1OMRA 1UHKA 2NCPA 4MZLA 3FWBA 2OPOA 3BOWB 3RM1A 1KWOC 1QX5B 1E8AA 1S26D 1YVHA 1J1DA 2PRUA 1SL8A 1CDPA 4PHMA 4YGDB 1N65A 2A4JA 3BUNB 2LCPA 1ZUZA 1TN4A 2B1UA 2KHNA 4JQ0D 2L0PA 4NDBA 3EK8A 1EG4A 4ORBB 1AK8A 1DTLA 2JT8A 3KO0A 4PE0A 1L7ZA 1XFYO 1J55A 4P5OE 3EKHA 1AP4A 2Y1MA 1EJ3A 3PN7B 1M63B 4XJKA 1NYAA 3RLZA 1WY9A 2WCEA 1F54A 1TNXA 3NSOA 5CSFA 5HKWA 1V1GA 1SK6D 4A4CA 1DJYA 1S6CA 1ALVA 1XYDA 4XJKB 2LE9B 2O60A 2L98A 3TS5C 2KSPA 2JC2A 1FW4A 1K9UA 3O2PA 3BQ3A 1AVSA 4ORAB 4CFRA 1PSRA 2KI4C 1OZSA 1L2OB 5PALA 1B8RA 4L9MA 1KFUL 4OV2A 1QXPA 3HCMA 1KFXS 1NUBA 2E6WA 4QJ3B 4GGFC 3FWCA 1UHIA 3NSLA 1NIWA 2JNXA 4ORCB 3EVRA 3BYAA 1UP5A 3LK1A 1IRJA 2F2OA 2GGMA 1YRUB 2WNDA 1QV0A 1FI6A 4HRHA 1BOCA 4YRUA 2CCMA 1M45A 1ZOTB 1HT9A 2KI6C 2LVKA 5AERA 1OOJA 3EK7A 4YGBB 4CLNA 4ICBA 3CR4X 1DMOA 1TNQA 2KFGA 2FCDA 5HYDA 2JNFA 3CWGA 2KYCA 4DIRA 1BJFA 3D10A 2MHHA 2HF5A 3EVUA 2M0RA 1H4BA 2BKIB 2NZ0A 3CZTX 4IL1A 1Y0VH 3DVJA 5I2OA 2F3YA 1B1GA 3I5HC 4DCKA 1XO5A 2Q4UA 3CGAA 1S3PA 2M3WA 4MEWA 1BMOA 3JTDC 2LMVA 1ZACA 3OB1B 1KK8B 2JXCA 4YI8A 5I8NA 5IBWA 1GGWA 2L4HA 4UPGA 2WORA 1KCYA 4OCIA 1MXEA 2L5XB 5DKQA 1UHHA 1K96A 1B8LA 4OVNF 1FPWA 3ZWHA 1YRTB 3SG6A 1CTRA 1LA3A 2D8NA 2KYFA 1W7JB 1NCXA 1GQMA 1XFZO 1PVAA 1PVBA 1DGUA 2KFHA 3WHUB 2EGDA 1PSBA 3BUMB 1WRLA 1NX1A 1VRKA 5B8IB 2KAYA 3I5FB 1XK4C 2JTZA 3BUWB 3I5IB 1SY9A 1TOPA 4I5JA 2JT3A 3TDUA 4OR9B 1DJIA 2JWWA 1KSMA 1K93D 2F2PA 2IS9A 2ZRTA 1KQVA 1H8BA 2WCFA 4ZCVA 4M2PA 1NX3A 2M9GA 1MQ1A 1A03A 3K21A 4MVFA 1YUSA 1M39A 3PSRA 1IKUA 1N0YA 3F45A 3OP0A 3SIBA 1C07A 3LL8B 1JC2A 1KK7Z 1AUIB 2L51A 3SG2A 1NX2A 1S5GZ 1K2HA 2Y4QA 1JF0A 1B8CA 2M7LA 3MSEB 1SPYA 5GQQC 2KI6D 5HKZA 1C7VA 2LVVA 1TNWA 5I2LA 5BPJA 2PASA 1IJ6A 5DKRA 1LKJA 2LVIA 3SIAA 4CFQA 1K9KA 2I2RE 3PN7C 3OHMB 3CLNA 4JPZB 5KSZA 2LANA 2LV7A 2M97A 4I5NB 4I5LB 2K7BA 2CT9A 1Y1UA 3KF9A 1B7TZ 1KFUS 2JXLA 4P2YB 5D69A 3SG3A 1IG5A 1XFUO 2R2IA 1RJVA 3AKBA 4MRYA 3WXAA 1CM4A 3ICBA 2L4IA 1F71A 4GPLB 1IGVA 1DVIA 1L2OC 1CLBA 5CSIA 1DJHA 1KQMB 3DVKA 2K7CA 3KPXA 3NSIA 3CR5X 5JOLA 5AEQA 1QIVA 4BY5A 1Y1AA 1OZOA 5HKYA 5F6TA 1XFVO 5CPVA 1B4CA 1SR6B 1FBVA 2M1KB 2E30A 1RWYA 3OX5A 2BKHB 4PALA 2BCBA 1JWDA 1YURA 2AUCA 2PSRA 5ER5A 1QX7A 2BCAA 1NP8A 4MZJA 2K8MB 4C0JA 1QVIZ 4WQ2A 1G4YR 3KEVA 4AQIA 2ISDA 1HQVA 4PE4A 1RROA 2ZNEA 1YX7A 1F4QA 2H61A 1CDLA 3EVVA 4PDZA 3PATA 3SJSA 4CPVA 1WDCB 3OX6A 2Y5IA 4DS7A 4PHNA 3NXAA 3GOFA 1IWQA 3BUOB 2JPTA 1LINA 2MBXA 1M31A 1KK8C 1QLKA 1NCYA 5I2QA 2BE4A 1MR8A 4F0ZB 3I5GB 2NXQA 2JRFA 1DT7B 4GUKA 3LCPC 1TCOB 2I7AA 2O5GA 5HLOA 2G2BA 4BY4A 3LLEA 1OMDA 2LM5A 3VRNA 1OE9B 3I5IC 3I5FC 2OTGB 1KSOA 2JULA 2K2FA 2KGBC 1LVCD 4PE1A 1DGVA 2WC8A 2KGRA 2HPSA 2K2AA 1A29A 1F55A 3DD4A 1TRFA 1CLMA 1F4OA 1DJWA 2KFFA 4M2OA 2AAOA 1F8HA 1BT6A 1QATA 2PMYA 5D7FA 3JVTB 1SL7A 1R6PA 1SCVA 4WQ3A 1A75A 1WRKA 1QX2A 3PFVA 1QIWA 2K7DA 2GV5A 2LAPA 1U5IA 1XVJA 2WCBA 1SMGA 2LP2A 1UHNA 2QPTA 4GAOA 3CTNA 5TNCA 1QJTA 1A75B 1ZMZA 1NWDA 1SBJA 1YX8A 2LHIA 1XFWO 1PULA 3FS7A 4GGNA 5AANA 1JSAA 1Y1XA 2QACA 2ZRSA 2JOJA 3HX4A 4ZCUA 1U5IB 1J7QA 2BECA 4PHJA 1FI5A 1RFJA 1YTZC 2SASA 1MWNA 3GK2A 4XYNA 2PVBA 1FF1A 1K90D 1G8IA 2KBIA 4NQGA 4QJ5B 1BF5A 4MZKA 2MLEC 4PCWA 1CFCA 5KU1A 1EXRA 1WLMA 2JTTA 1PALA 3TZ1A 3AAKA 2BBMA 1JF2A 1TNPA 3IQQA 3WHTB 1LXFC 4NDCA 1OQPA 2LP3A 2LUXA 3E3RA 1WRZA 1KQMC 1KK7Y 1S5GY 1CMGA 4OKHA 1MHOA 2LLUA 3IQOA 4FQOA 2COLB 4A4BA 1CFFA 1SR6C 1A2XA 3VRRA 3O78A 1YR5A 1NCZA 1BR4B 1RTP1 1V1FA 2JT0A 1BG1A 3DVMA 1AHRA 2HETA 2JQ6A 4R1EA 2ZN9A 1CDNA 3OB2B 5DKNA 1UUSA 2WOSA 1IH0A 1ODBA 1CLLA 4PE7A 4N5XA 1CM1A 5CSJA 2NCOA 2MA2A 5CSNA 1NPQA 1WLZA 4QJ4B 1BU3A 1WDCC 1QV1A 3BXKA 2VRGA 3EK4A 1MXLC 2K61A 4JWQA 3SG7A 2ZN8A 2H61C 4MBEA 1DJZA 1OMVA 1PRWA 1S6IA 1TIZA 2KQYA 3GK4X 4U8DA 2M8UA 1K8UA 2BCXA 3VRPA 4GFTA 2LMUA 1JBAA 5ER4X 5JJGA 2AMIA 3I5GC 4YGEB 1M46A 4MRXA 1SCMB 1C7WA 2LNKA 4TNCA 4I5KA 2ZNDA 3TUYB 2OS8B 4C0KA 3M0WA 1SL9A 2M29A 2L50A 4YBHB 1IJ5A 4N1FA 2OTGC 2V53A 2SCPA 2GGZA 2BL0B 2FCEA 1QVIY 1AJ4A 2EC6B 1ALWA 2JU0A 1Q80A 1CFDA 1PK0D 1CB1A 4N1GA 1X02A 2CTNA 3FIAA 1SRAA 1CMFA 1YUUA 2FOTA 3DVEA 1KWOB 2MLFC 1EL4A 1BODA 3DF0A 2TN4A 3JVTC 4HSZA 2P6BB 1QLSA 4YGCB 3H4SE 1EG3A 4C0LA 1R2UA 1YUTA 1J7RA 2RGIA 1GGZA 1YVLA 3GK1A 1CDMA 3DF0B 2M49B 2G9BA 3LK0A 2LVJA 3PALA 1UWOA 2I18A 2ZKMX 4MSPA 2Q91A 2KAXA 5FYXA 1CFPA 2I94A 3QRXA 1IQ3A 2Y1NA 1RECA 2MAZA 2L2EA 1ZFSA 5HLVA 4YI9A 4MN0A 1SW8A 3IF7A 1JFJA 1W7IB 4MLWA 5AXIA 2MRDA 3D0YA 1MUXA 3EKJA 4NDDA 5K89A 1IQ5A 2M1UA 1UHJA 4HREE 5G08A 1TTXA 1BR1B 4WRIA 3TDIA 2DOQA 4FTGA 3AKAA 3TS5B 1N2DA 1AJ5A 2MJWB 1SKTA 1K95A 3D0YB 1GJYA 3BUXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUO A;  4GGF A;  1DJX A;  2KAV A;  4ETO A;  2KI4 B;  4PHK A;  1F70 A;  1J7O A;  1J7P A;  3A8R A;  4Q04 A;  1DF0 A;  2F33 A;  2LMT A;  5AFP A;  1SYM A;  4GBA A;  2CNP A;  1A4P A;  1S36 A;  1UUR A;  1J1E A;  2LLT A;  3VGO A;  3ZNI A;  4CID A;  1G33 A;  3C1V A;  1TCF A;  2HQ8 A;  3AAJ A;  3VRQ A;  1DF0 B;  2LHL A;  1MF8 B;  1OSA A;  2ZFD A;  1D1O A;  3CS1 A;  4YGA A;  4E68 A;  3NSK A;  2CXJ A;  1DJG A;  1CNP A;  1QTX A;  1KFX L;  1QAS A;  3KHE A;  2JZI A;  1K94 A;  3O4Y A;  2FJU B;  2KBM A;  2EHB A;  2KDH A;  3CR2 A;  1S6J A;  2NLN A;  5J3X A;  4USL A;  2K0J A;  2K7O A;  4AOM A;  4M2Q A;  2F8P A;  2BE6 A;  3I5H B;  2H2K A;  3O6B A;  2KNE A;  1XA5 A;  5KTY A;  3JTD B;  1BLQ A;  1NSH A;  3PLF B;  3VRO A;  2HQW A;  1CKK A;  1RK9 A;  1JFK A;  1Y6W A;  2LLS A;  1S1E A;  1SCM C;  4DUQ A;  2CBL A;  4DRW A;  1QS7 A;  3A4U B;  4AQJ A;  3TUY C;  2OS8 C;  1B47 A;  1XK4 A;  2F3Z A;  1SNL A;  3SG4 A;  2BBN A;  2PAL A;  3PM8 A;  2LC5 A;  2M7N A;  1LA0 A;  3TDZ A;  2KOT A;  1K9P A;  1B7T Y;  3BOW A;  4D1E A;  1NX0 A;  2BL0 C;  1XFX O;  2KQ6 A;  1B9A A;  2LUC A;  2EC6 C;  4GNK B;  4HRG A;  1EH2 A;  3WNX B;  3SG5 A;  1OMR A;  1UHK A;  2NCP A;  4MZL A;  3FWB A;  2OPO A;  3BOW B;  3RM1 A;  1KWO C;  1QX5 B;  1E8A A;  1S26 D;  1YVH A;  1J1D A;  2PRU A;  1SL8 A;  1CDP A;  4PHM A;  4YGD B;  1N65 A;  2A4J A;  3BUN B;  2LCP A;  1ZUZ A;  1TN4 A;  2B1U A;  2KHN A;  4JQ0 D;  2L0P A;  4NDB A;  3EK8 A;  1EG4 A;  4ORB B;  1AK8 A;  1DTL A;  2JT8 A;  3KO0 A;  4PE0 A;  1L7Z A;  1XFY O;  1J55 A;  4P5O E;  3EKH A;  1AP4 A;  2Y1M A;  1EJ3 A;  3PN7 B;  1M63 B;  4XJK A;  1NYA A;  3RLZ A;  1WY9 A;  2WCE A;  1F54 A;  1TNX A;  3NSO A;  5CSF A;  5HKW A;  1V1G A;  1SK6 D;  4A4C A;  1DJY A;  1S6C A;  1ALV A;  1XYD A;  4XJK B;  2LE9 B;  2O60 A;  2L98 A;  3TS5 C;  2KSP A;  2JC2 A;  1FW4 A;  1K9U A;  3O2P A;  3BQ3 A;  1AVS A;  4ORA B;  4CFR A;  1PSR A;  2KI4 C;  1OZS A;  1L2O B;  5PAL A;  1B8R A;  4L9M A;  1KFU L;  4OV2 A;  1QXP A;  3HCM A;  1KFX S;  1NUB A;  2E6W A;  4QJ3 B;  4GGF C;  3FWC A;  1UHI A;  3NSL A;  1NIW A;  2JNX A;  4ORC B;  3EVR A;  3BYA A;  1UP5 A;  3LK1 A;  1IRJ A;  2F2O A;  2GGM A;  1YRU B;  2WND A;  1QV0 A;  1FI6 A;  4HRH A;  1BOC A;  4YRU A;  2CCM A;  1M45 A;  1ZOT B;  1HT9 A;  2KI6 C;  2LVK A;  5AER A;  1OOJ A;  3EK7 A;  4YGB B;  4CLN A;  4ICB A;  3CR4 X;  1DMO A;  1TNQ A;  2KFG A;  2FCD A;  5HYD A;  2JNF A;  3CWG A;  2KYC A;  4DIR A;  1BJF A;  3D10 A;  2MHH A;  2HF5 A;  3EVU A;  2M0R A;  1H4B A;  2BKI B;  2NZ0 A;  3CZT X;  4IL1 A;  1Y0V H;  3DVJ A;  5I2O A;  2F3Y A;  1B1G A;  3I5H C;  4DCK A;  1XO5 A;  2Q4U A;  3CGA A;  1S3P A;  2M3W A;  4MEW A;  1BMO A;  3JTD C;  2LMV A;  1ZAC A;  3OB1 B;  1KK8 B;  2JXC A;  4YI8 A;  5I8N A;  5IBW A;  1GGW A;  2L4H A;  4UPG A;  2WOR A;  1KCY A;  4OCI A;  1MXE A;  2L5X B;  5DKQ A;  1UHH A;  1K96 A;  1B8L A;  4OVN F;  1FPW A;  3ZWH A;  1YRT B;  3SG6 A;  1CTR A;  1LA3 A;  2D8N A;  2KYF A;  1W7J B;  1NCX A;  1GQM A;  1XFZ O;  1PVA A;  1PVB A;  1DGU A;  2KFH A;  3WHU B;  2EGD A;  1PSB A;  3BUM B;  1WRL A;  1NX1 A;  1VRK A;  5B8I B;  2KAY A;  3I5F B;  1XK4 C;  2JTZ A;  3BUW B;  3I5I B;  1SY9 A;  1TOP A;  4I5J A;  2JT3 A;  3TDU A;  4OR9 B;  1DJI A;  2JWW A;  1KSM A;  1K93 D;  2F2P A;  2IS9 A;  2ZRT A;  1KQV A;  1H8B A;  2WCF A;  4ZCV A;  4M2P A;  1NX3 A;  2M9G A;  1MQ1 A;  1A03 A;  3K21 A;  4MVF A;  1YUS A;  1M39 A;  3PSR A;  1IKU A;  1N0Y A;  3F45 A;  3OP0 A;  3SIB A;  1C07 A;  3LL8 B;  1JC2 A;  1KK7 Z;  1AUI B;  2L51 A;  3SG2 A;  1NX2 A;  1S5G Z;  1K2H A;  2Y4Q A;  1JF0 A;  1B8C A;  2M7L A;  3MSE B;  1SPY A;  5GQQ C;  2KI6 D;  5HKZ A;  1C7V A;  2LVV A;  1TNW A;  5I2L A;  5BPJ A;  2PAS A;  1IJ6 A;  5DKR A;  1LKJ A;  2LVI A;  3SIA A;  4CFQ A;  1K9K A;  2I2R E;  3PN7 C;  3OHM B;  3CLN A;  4JPZ B;  5KSZ A;  2LAN A;  2LV7 A;  2M97 A;  4I5N B;  4I5L B;  2K7B A;  2CT9 A;  1Y1U A;  3KF9 A;  1B7T Z;  1KFU S;  2JXL A;  4P2Y B;  5D69 A;  3SG3 A;  1IG5 A;  1XFU O;  2R2I A;  1RJV A;  3AKB A;  4MRY A;  3WXA A;  1CM4 A;  3ICB A;  2L4I A;  1F71 A;  4GPL B;  1IGV A;  1DVI A;  1L2O C;  1CLB A;  5CSI A;  1DJH A;  1KQM B;  3DVK A;  2K7C A;  3KPX A;  3NSI A;  3CR5 X;  5JOL A;  5AEQ A;  1QIV A;  4BY5 A;  1Y1A A;  1OZO A;  5HKY A;  5F6T A;  1XFV O;  5CPV A;  1B4C A;  1SR6 B;  1FBV A;  2M1K B;  2E30 A;  1RWY A;  3OX5 A;  2BKH B;  4PAL A;  2BCB A;  1JWD A;  1YUR A;  2AUC A;  2PSR A;  5ER5 A;  1QX7 A;  2BCA A;  1NP8 A;  4MZJ A;  2K8M B;  4C0J A;  1QVI Z;  4WQ2 A;  1G4Y R;  3KEV A;  4AQI A;  2ISD A;  1HQV A;  4PE4 A;  1RRO A;  2ZNE A;  1YX7 A;  1F4Q A;  2H61 A;  1CDL A;  3EVV A;  4PDZ A;  3PAT A;  3SJS A;  4CPV A;  1WDC B;  3OX6 A;  2Y5I A;  4DS7 A;  4PHN A;  3NXA A;  3GOF A;  1IWQ A;  3BUO B;  2JPT A;  1LIN A;  2MBX A;  1M31 A;  1KK8 C;  1QLK A;  1NCY A;  5I2Q A;  2BE4 A;  1MR8 A;  4F0Z B;  3I5G B;  2NXQ A;  2JRF A;  1DT7 B;  4GUK A;  3LCP C;  1TCO B;  2I7A A;  2O5G A;  5HLO A;  2G2B A;  4BY4 A;  3LLE A;  1OMD A;  2LM5 A;  3VRN A;  1OE9 B;  3I5I C;  3I5F C;  2OTG B;  1KSO A;  2JUL A;  2K2F A;  2KGB C;  1LVC D;  4PE1 A;  1DGV A;  2WC8 A;  2KGR A;  2HPS A;  2K2A A;  1A29 A;  1F55 A;  3DD4 A;  1TRF A;  1CLM A;  1F4O A;  1DJW A;  2KFF A;  4M2O A;  2AAO A;  1F8H A;  1BT6 A;  1QAT A;  2PMY A;  5D7F A;  3JVT B;  1SL7 A;  1R6P A;  1SCV A;  4WQ3 A;  1A75 A;  1WRK A;  1QX2 A;  3PFV A;  1QIW A;  2K7D A;  2GV5 A;  2LAP A;  1U5I A;  1XVJ A;  2WCB A;  1SMG A;  2LP2 A;  1UHN A;  2QPT A;  4GAO A;  3CTN A;  5TNC A;  1QJT A;  1A75 B;  1ZMZ A;  1NWD A;  1SBJ A;  1YX8 A;  2LHI A;  1XFW O;  1PUL A;  3FS7 A;  4GGN A;  5AAN A;  1JSA A;  1Y1X A;  2QAC A;  2ZRS A;  2JOJ A;  3HX4 A;  4ZCU A;  1U5I B;  1J7Q A;  2BEC A;  4PHJ A;  1FI5 A;  1RFJ A;  1YTZ C;  2SAS A;  1MWN A;  3GK2 A;  4XYN A;  2PVB A;  1FF1 A;  1K90 D;  1G8I A;  2KBI A;  4NQG A;  4QJ5 B;  1BF5 A;  4MZK A;  2MLE C;  4PCW A;  1CFC A;  5KU1 A;  1EXR A;  1WLM A;  2JTT A;  1PAL A;  3TZ1 A;  3AAK A;  2BBM A;  1JF2 A;  1TNP A;  3IQQ A;  3WHT B;  1LXF C;  4NDC A;  1OQP A;  2LP3 A;  2LUX A;  3E3R A;  1WRZ A;  1KQM C;  1KK7 Y;  1S5G Y;  1CMG A;  4OKH A;  1MHO A;  2LLU A;  3IQO A;  4FQO A;  2COL B;  4A4B A;  1CFF A;  1SR6 C;  1A2X A;  3VRR A;  3O78 A;  1YR5 A;  1NCZ A;  1BR4 B;  1RTP 1;  1V1F A;  2JT0 A;  1BG1 A;  3DVM A;  1AHR A;  2HET A;  2JQ6 A;  4R1E A;  2ZN9 A;  1CDN A;  3OB2 B;  5DKN A;  1UUS A;  2WOS A;  1IH0 A;  1ODB A;  1CLL A;  4PE7 A;  4N5X A;  1CM1 A;  5CSJ A;  2NCO A;  2MA2 A;  5CSN A;  1NPQ A;  1WLZ A;  4QJ4 B;  1BU3 A;  1WDC C;  1QV1 A;  3BXK A;  2VRG A;  3EK4 A;  1MXL C;  2K61 A;  4JWQ A;  3SG7 A;  2ZN8 A;  2H61 C;  4MBE A;  1DJZ A;  1OMV A;  1PRW A;  1S6I A;  1TIZ A;  2KQY A;  3GK4 X;  4U8D A;  2M8U A;  1K8U A;  2BCX A;  3VRP A;  4GFT A;  2LMU A;  1JBA A;  5ER4 X;  5JJG A;  2AMI A;  3I5G C;  4YGE B;  1M46 A;  4MRX A;  1SCM B;  1C7W A;  2LNK A;  4TNC A;  4I5K A;  2ZND A;  3TUY B;  2OS8 B;  4C0K A;  3M0W A;  1SL9 A;  2M29 A;  2L50 A;  4YBH B;  1IJ5 A;  4N1F A;  2OTG C;  2V53 A;  2SCP A;  2GGZ A;  2BL0 B;  2FCE A;  1QVI Y;  1AJ4 A;  2EC6 B;  1ALW A;  2JU0 A;  1Q80 A;  1CFD A;  1PK0 D;  1CB1 A;  4N1G A;  1X02 A;  2CTN A;  3FIA A;  1SRA A;  1CMF A;  1YUU A;  2FOT A;  3DVE A;  1KWO B;  2MLF C;  1EL4 A;  1BOD A;  3DF0 A;  2TN4 A;  3JVT C;  4HSZ A;  2P6B B;  1QLS A;  4YGC B;  3H4S E;  1EG3 A;  4C0L A;  1R2U A;  1YUT A;  1J7R A;  2RGI A;  1GGZ A;  1YVL A;  3GK1 A;  1CDM A;  3DF0 B;  2M49 B;  2G9B A;  3LK0 A;  2LVJ A;  3PAL A;  1UWO A;  2I18 A;  2ZKM X;  4MSP A;  2Q91 A;  2KAX A;  5FYX A;  1CFP A;  2I94 A;  3QRX A;  1IQ3 A;  2Y1N A;  1REC A;  2MAZ A;  2L2E A;  1ZFS A;  5HLV A;  4YI9 A;  4MN0 A;  1SW8 A;  3IF7 A;  1JFJ A;  1W7I B;  4MLW A;  5AXI A;  2MRD A;  3D0Y A;  1MUX A;  3EKJ A;  4NDD A;  5K89 A;  1IQ5 A;  2M1U A;  1UHJ A;  4HRE E;  5G08 A;  1TTX A;  1BR1 B;  4WRI A;  3TDI A;  2DOQ A;  4FTG A;  3AKA A;  3TS5 B;  1N2D A;  1AJ5 A;  2MJW B;  1SKT A;  1K95 A;  3D0Y B;  1GJY A;  3BUX B; 
#chains in the Genus database with same CATH topology
 1JUO A;  4GGF A;  1DJX A;  2KAV A;  4ETO A;  2KI4 B;  4PHK A;  1F70 A;  1J7O A;  1DEL A;  3A8R A;  1J7P A;  4Q04 A;  1DF0 A;  2F33 A;  2LMT A;  5AFP A;  1SYM A;  4GBA A;  2CNP A;  1A4P A;  1S36 A;  1UUR A;  1J1E A;  2LLT A;  3VGO A;  3ZNI A;  4CID A;  1G33 A;  3C1V A;  1TCF A;  2HQ8 A;  3AAJ A;  3VRQ A;  1DF0 B;  2LHL A;  1MF8 B;  1OSA A;  2ZFD A;  1D1O A;  3CS1 A;  1OOI X;  4YGA A;  4E68 A;  3NSK A;  2CXJ A;  1DJG A;  2PYQ A;  4IJ7 A;  1QTX A;  1KFX L;  1QAS A;  3KHE A;  5DIC A;  1CNP A;  2JZI A;  1K94 A;  3O4Y A;  2FJU B;  1TWO A;  2KBM A;  2EHB A;  4JD9 A;  2KDH A;  3CR2 A;  1S6J A;  2NLN A;  3FE6 A;  5J3X A;  4USL A;  2K0J A;  2K7O A;  4AOM A;  4M2Q A;  5EL2 A;  3D76 A;  2F8P A;  2BE6 A;  1Z4H A;  3I5H B;  2GTE A;  2H2K A;  3O6B A;  2KNE A;  1XA5 A;  5KTY A;  3JTD B;  3IVT A;  3SS3 A;  1BLQ A;  1NSH A;  3N7H A;  3PLF B;  3VRO A;  2HQW A;  3BJH A;  1CKK A;  1RK9 A;  1JFK A;  1Y6W A;  2LLS A;  1S1E A;  1SCM C;  4DUQ A;  2CBL A;  4DRW A;  1QS7 A;  3A4U B;  3O4X A;  5FI7 A;  4AQJ A;  3TUY C;  2OS8 C;  1B47 A;  1XK4 A;  2F3Z A;  1SNL A;  3SG4 A;  2BBN A;  2PAL A;  1OW4 A;  2LC5 A;  2M7N A;  1LA0 A;  3PM8 A;  3TDZ A;  2KOT A;  5FI2 A;  1K9P A;  1B7T Y;  3BOW A;  4D1E A;  1NX0 A;  2BL0 C;  1XFX O;  2KQ6 A;  3NGV A;  4DCK A;  1B9A A;  2LUC A;  2BNX A;  2EC6 C;  4GNK B;  2L2C A;  4HRG A;  1EH2 A;  3WNX B;  3SG5 A;  1OMR A;  1OOF A;  1UHK A;  2NCP A;  4MZL A;  3S0A A;  3FWB A;  2OPO A;  3BOW B;  3RM1 A;  1KWO C;  1QX5 B;  1E8A A;  1S26 D;  1YVH A;  1J1D A;  3PM2 A;  2PRU A;  1TUZ A;  3B6X A;  1SL8 A;  2WCJ A;  1CDP A;  2WCH A;  4PHM A;  4YGD B;  1N65 A;  2A4J A;  3BUN B;  2LCP A;  1ZUZ A;  1TN4 A;  2B1U A;  2KHN A;  4JQ0 D;  2L0P A;  2L5Y A;  4NDB A;  3EK8 A;  1EG4 A;  4ORB B;  1AK8 A;  1DTL A;  2JT8 A;  3KO0 A;  4PE0 A;  1L7Z A;  1XFY O;  1J55 A;  4P5O E;  2WCK A;  3EKH A;  1AP4 A;  2Y1M A;  1EJ3 A;  3PN7 B;  1M63 B;  4XJK A;  1NYA A;  3RLZ A;  1WY9 A;  2WCE A;  4KYN A;  1F54 A;  2KLE A;  1TNX A;  3NSO A;  5CSF A;  5HKW A;  1V1G A;  1SK6 D;  4A4C A;  1DJY A;  2YGU A;  1S6C A;  1ALV A;  1XYD A;  4XJK B;  2LE9 B;  2O60 A;  2L98 A;  3TS5 C;  2KSP A;  2JC2 A;  1FW4 A;  1K9U A;  2QEV A;  3CDN A;  3O2P A;  3BQ3 A;  1AVS A;  4ORA B;  3L4A A;  2KPH A;  4CFR A;  3L47 A;  1PSR A;  2KI4 C;  1OZS A;  1L2O B;  2QEO A;  5PAL A;  1B8R A;  4L9M A;  1KFU L;  4OV2 A;  1QXP A;  3HCM A;  1KFX S;  1NUB A;  2E6W A;  4QJ3 B;  4GGF C;  3FWC A;  1UHI A;  3NSL A;  1NIW A;  2JNX A;  4ORC B;  3EVR A;  3BYA A;  1DQE A;  1UP5 A;  3LK1 A;  1IRJ A;  2F2O A;  2GGM A;  1YRU B;  2WND A;  1QV0 A;  1FI6 A;  1XFR A;  4HRH A;  1BOC A;  4YRU A;  2CCM A;  1M45 A;  1ZOT B;  1HT9 A;  2KI6 C;  2LVK A;  5AER A;  1OOJ A;  3EK7 A;  4YGB B;  4CLN A;  4ICB A;  3CR4 X;  1DMO A;  1TNQ A;  2KFG A;  2FCD A;  5HYD A;  2JNF A;  3CWG A;  2KYC A;  4DIR A;  1BJF A;  3D10 A;  2MHH A;  2HF5 A;  3EVU A;  3D77 A;  2M0R A;  2P70 A;  1H4B A;  2BKI B;  2NZ0 A;  3CZT X;  4IL1 A;  1Y0V H;  3DVJ A;  5I2O A;  2F3Y A;  1B1G A;  3I5H C;  3OGN A;  1XO5 A;  2BAP A;  2Q4U A;  1S3P A;  3CGA A;  2M3W A;  4JKT A;  1BMO A;  3JTD C;  2LMV A;  1ZAC A;  3OB1 B;  1KK8 B;  2JXC A;  4MEW A;  4YI8 A;  5I8N A;  5IBW A;  2L4H A;  4UPG A;  2WOR A;  1KCY A;  4OCI A;  1MXE A;  2L5X B;  5DKQ A;  1UHH A;  1K96 A;  1B8L A;  4OVN F;  1FPW A;  3ZWH A;  1YRT B;  4OZD A;  3SG6 A;  1CTR A;  1LA3 A;  2D8N A;  2WC6 A;  2KYF A;  1W7J B;  1NCX A;  1C3Z A;  1GQM A;  1XFZ O;  1PVA A;  1PVB A;  3SS5 A;  3CZ0 A;  1DGU A;  2KFH A;  3WHU B;  2EGD A;  1PSB A;  3BUM B;  1WRL A;  1NX1 A;  1VRK A;  5B8I B;  2KAY A;  3I5F B;  1XK4 C;  2JTZ A;  3BUW B;  3I5I B;  1SY9 A;  1TOP A;  4I5J A;  2JT3 A;  3TDU A;  4OR9 B;  1DJI A;  2JWW A;  3S0G A;  3R1P A;  1ORG A;  1KSM A;  1K93 D;  2F2P A;  2IS9 A;  2ZRT A;  1KQV A;  1H8B A;  2WCF A;  1JSA A;  4ZCV A;  4M2P A;  1NX3 A;  2M9G A;  1MQ1 A;  3D73 A;  3K21 A;  4MVF A;  1YUS A;  1M39 A;  3PSR A;  1A03 A;  1IKU A;  1N0Y A;  3F45 A;  3OP0 A;  3SIB A;  1C07 A;  3LL8 B;  1JC2 A;  1KK7 Z;  1AUI B;  2L51 A;  3SG2 A;  1NX2 A;  1S5G Z;  3S0B A;  2Y4Q A;  1JF0 A;  1B8C A;  2M7L A;  1K2H A;  3MSE B;  1SPY A;  5GQQ C;  2KI6 D;  5HKZ A;  1C7V A;  2LVV A;  1TNW A;  3K1E A;  3D75 A;  5I2L A;  5BPJ A;  2PAS A;  1IJ6 A;  5DKR A;  1LKJ A;  2LVI A;  3BFH A;  4PT1 A;  3SIA A;  4CFQ A;  1K9K A;  2I2R E;  3DY9 A;  3PN7 C;  3OHM B;  3CLN A;  4JPZ B;  5KSZ A;  2LAN A;  2LV7 A;  2M97 A;  4I5N B;  4I5L B;  2K7B A;  2CT9 A;  1Y1U A;  3PJI A;  3KF9 A;  5HL1 A;  1B7T Z;  1KFU S;  2JXL A;  4P2Y B;  5D69 A;  3SG3 A;  1IG5 A;  1XFU O;  3S0E A;  2R2I A;  1RJV A;  3AKB A;  3VB1 A;  4MRY A;  3WXA A;  1CM4 A;  3ICB A;  2L4I A;  1F71 A;  3S0F A;  4GPL B;  1IGV A;  1GGW A;  1DVI A;  1L2O C;  1CLB A;  5CSI A;  1DJH A;  1IIO A;  1OOH A;  1KQM B;  3DVK A;  2K7C A;  3KPX A;  3NSI A;  3CR5 X;  5JOL A;  5AEQ A;  1QIV A;  3UNW A;  4BY5 A;  1Y1A A;  1OZO A;  3OBV A;  5HKY A;  5F6T A;  1XFV O;  2K60 A;  5CPV A;  1SR6 B;  1FBV A;  2M1K B;  2E30 A;  1RWY A;  3OX5 A;  1B4C A;  2BKH B;  4PAL A;  2BCB A;  3R72 A;  1JWD A;  1YUR A;  2AUC A;  2PSR A;  5ER5 A;  1QX7 A;  2BCA A;  1NP8 A;  4MZJ A;  2K8M B;  4C0J A;  1QVI Z;  4WQ2 A;  1G4Y R;  3KEV A;  4AQI A;  2ISD A;  1HQV A;  4PE4 A;  1RRO A;  2ZNE A;  1YX7 A;  3CAB A;  1F4Q A;  2H61 A;  1CDL A;  3EVV A;  4PDZ A;  3PAT A;  3SJS A;  4CPV A;  1WDC B;  3OX6 A;  2Y5I A;  3V2L A;  4PHN A;  4DS7 A;  3DYE A;  3EG5 B;  3NXA A;  3GOF A;  1IWQ A;  2WCM A;  2JPT A;  1LIN A;  3BUO B;  4FQT A;  2QEH A;  2MBX A;  1M31 A;  1KK8 C;  1QLK A;  1NCY A;  3D78 A;  5I2Q A;  2BE4 A;  1MR8 A;  4F0Z B;  3I5G B;  3QME A;  2NXQ A;  2JRF A;  5D3O A;  3CYZ A;  1DT7 B;  4F7F A;  3Q8I A;  4GUK A;  3LCP C;  1TCO B;  2I7A A;  2O5G A;  5HLO A;  1P28 A;  2G2B A;  3SS4 A;  1T14 A;  3LLE A;  4BY4 A;  1OMD A;  2LM5 A;  3VRN A;  1DEK A;  1OE9 B;  3I5I C;  3I5F C;  2OTG B;  1KSO A;  2JUL A;  2K2F A;  2KGB C;  1LVC D;  4PE1 A;  1DGV A;  3BFA A;  2WC8 A;  2KGR A;  2HPS A;  2K2A A;  1A29 A;  1F55 A;  3DD4 A;  3NHT A;  3S0D A;  1TRF A;  1CLM A;  1F4O A;  1DJW A;  2KFF A;  4M2O A;  2AAO A;  1F8H A;  1BT6 A;  1QAT A;  2PMY A;  5D7F A;  3JVT B;  1SL7 A;  1R6P A;  1SCV A;  4WQ3 A;  1A75 A;  1WRK A;  1QX2 A;  3PFV A;  1QIW A;  2K7D A;  2GV5 A;  2LAP A;  3DXL A;  1U5I A;  1XVJ A;  2WCB A;  1SMG A;  2WCL A;  2LP2 A;  1UHN A;  2QPT A;  4GAO A;  3CTN A;  5TNC A;  1QJT A;  1A75 B;  1ZMZ A;  1NWD A;  1SBJ A;  1YX8 A;  2ERB A;  2LHI A;  1XFW O;  3B87 A;  1PUL A;  1W9Z A;  3FS7 A;  4GGN A;  5AAN A;  1Y1X A;  2QAC A;  2ZRS A;  2JOJ A;  3HX4 A;  4ZCU A;  1U5I B;  1J7Q A;  2BEC A;  3CZ2 A;  4PHJ A;  1RFJ A;  1YTZ C;  2SAS A;  1MWN A;  3GK2 A;  4XYN A;  2PVB A;  1FF1 A;  1QWV A;  1K90 D;  1G8I A;  3L4L A;  2KBI A;  4NQG A;  1Z2C B;  4QJ5 B;  1BF5 A;  4MZK A;  2MLE C;  4PCW A;  1CFC A;  3NHI A;  5KU1 A;  1EXR A;  1WLM A;  2JTT A;  1PAL A;  3TZ1 A;  3AAK A;  3B88 A;  2BBM A;  1JF2 A;  1TNP A;  3IQQ A;  3WHT B;  1LXF C;  4NDC A;  1OQP A;  2LP3 A;  2KLD A;  2LUX A;  3E3R A;  1WRZ A;  1KQM C;  1KK7 Y;  2PQL A;  1S5G Y;  1CMG A;  4OKH A;  1MHO A;  2LLU A;  2H8V A;  3CZ1 A;  2COL B;  3IQO A;  4FQO A;  4A4B A;  1CFF A;  1SR6 C;  1A2X A;  3VRR A;  3O78 A;  1YR5 A;  1NCZ A;  1BR4 B;  1RTP 1;  1V1F A;  3FE8 A;  2JT0 A;  1BG1 A;  3DVM A;  1AHR A;  2HET A;  3RZS A;  2JQ6 A;  4R1E A;  2ZN9 A;  1CDN A;  3OB2 B;  3UO9 A;  5DKN A;  1UUS A;  2WOS A;  1IH0 A;  1ODB A;  1CLL A;  4PE7 A;  4N5X A;  1C3Y A;  1CM1 A;  5CSJ A;  2NCO A;  2MA2 A;  5CSN A;  1NPQ A;  1WLZ A;  4QJ4 B;  1BU3 A;  1WDC C;  1QV1 A;  3BXK A;  2VRG A;  3EK4 A;  3D74 A;  1MXL C;  2K61 A;  4JWQ A;  3BFB A;  3SG7 A;  2QEB A;  2ZN8 A;  2H61 C;  4MBE A;  1DJZ A;  1OMV A;  1PRW A;  1S6I A;  1TIZ A;  2KQY A;  3GK4 X;  4U8D A;  2M8U A;  1K8U A;  2BCX A;  3VRP A;  4GFT A;  2LMU A;  1JBA A;  5ER4 X;  2P71 A;  5JJG A;  2AMI A;  3R1V A;  3I5G C;  4YGE B;  1M46 A;  4MRX A;  1SCM B;  1C7W A;  2LNK A;  4TNC A;  4I5K A;  2ZND A;  4INW A;  3TUY B;  2OS8 B;  4C0K A;  2JPO A;  1SL9 A;  3M0W A;  2M29 A;  2L50 A;  4YBH B;  1IJ5 A;  4N1F A;  2OTG C;  2V53 A;  2SCP A;  2GGZ A;  2BL0 B;  2FCE A;  1QVI Y;  3DZT A;  3R1O A;  1AJ4 A;  2EC6 B;  1ALW A;  2JU0 A;  1Q80 A;  1CFD A;  1PK0 D;  1CB1 A;  4N1G A;  1X02 A;  2CTN A;  1LS8 A;  1SRA A;  3FIA A;  1CMF A;  1YUU A;  2FOT A;  3DVE A;  1KWO B;  2MLF C;  1EL4 A;  1BOD A;  3DF0 A;  2TN4 A;  3JVT C;  4INX A;  4HSZ A;  2P6B B;  1QLS A;  4YGC B;  3H4S E;  1EG3 A;  4C0L A;  1R2U A;  1FI5 A;  1OOG A;  1YUT A;  1J7R A;  2RGI A;  1GGZ A;  1YVL A;  3B86 A;  2FJY A;  1CDM A;  3GK1 A;  3DF0 B;  1GM0 A;  2M49 B;  2G9B A;  3LK0 A;  2LVJ A;  3PAL A;  1UWO A;  2I18 A;  2ZKM X;  4MSP A;  2Q91 A;  2QDI A;  2KAX A;  5FYX A;  1CFP A;  1SSE B;  2I94 A;  3QRX A;  5FI6 A;  1IQ3 A;  1DC1 A;  2Y1N A;  1REC A;  2MAZ A;  2L2E A;  1ZFS A;  3B7A A;  5HLV A;  4YI9 A;  4MN0 A;  1SW8 A;  3IF7 A;  1JFJ A;  1W7I B;  4MLW A;  5AXI A;  2MRD A;  3D0Y A;  1MUX A;  3EKJ A;  4NDD A;  5I94 A;  5K89 A;  1IQ5 A;  2M1U A;  1UHJ A;  4HRE E;  5G08 A;  1TTX A;  1BR1 B;  4WRI A;  3TDI A;  2DOQ A;  4FTG A;  3FE9 A;  3AKA A;  3TS5 B;  1TUJ A;  2WC5 A;  1N2D A;  1AJ5 A;  2MJW B;  1SKT A;  1K95 A;  3D0Y B;  1GJY A;  3BUX B; 
#chains in the Genus database with same CATH homology
 1JUO A;  4GGF A;  1DJX A;  2KAV A;  4ETO A;  2KI4 B;  4PHK A;  1F70 A;  1J7O A;  1J7P A;  3A8R A;  4Q04 A;  1DF0 A;  2F33 A;  2LMT A;  5AFP A;  1SYM A;  4GBA A;  2CNP A;  1A4P A;  1S36 A;  1UUR A;  1J1E A;  2LLT A;  3VGO A;  3ZNI A;  4CID A;  1G33 A;  3C1V A;  1TCF A;  2HQ8 A;  3AAJ A;  3VRQ A;  1DF0 B;  2LHL A;  1MF8 B;  1OSA A;  2ZFD A;  1D1O A;  3CS1 A;  4YGA A;  4E68 A;  3NSK A;  2CXJ A;  1DJG A;  1CNP A;  1QTX A;  1KFX L;  1QAS A;  3KHE A;  2JZI A;  1K94 A;  3O4Y A;  2FJU B;  2KBM A;  2EHB A;  2KDH A;  3CR2 A;  1S6J A;  2NLN A;  5J3X A;  4USL A;  2K0J A;  2K7O A;  4AOM A;  4M2Q A;  2F8P A;  2BE6 A;  3I5H B;  2H2K A;  3O6B A;  2KNE A;  1XA5 A;  5KTY A;  3JTD B;  1BLQ A;  1NSH A;  3PLF B;  3VRO A;  2HQW A;  1CKK A;  1RK9 A;  1JFK A;  1Y6W A;  2LLS A;  1S1E A;  1SCM C;  4DUQ A;  2CBL A;  4DRW A;  1QS7 A;  3A4U B;  4AQJ A;  3TUY C;  2OS8 C;  1B47 A;  1XK4 A;  2F3Z A;  1SNL A;  3SG4 A;  2BBN A;  2PAL A;  3PM8 A;  2LC5 A;  2M7N A;  1LA0 A;  3TDZ A;  2KOT A;  1K9P A;  1B7T Y;  3BOW A;  4D1E A;  1NX0 A;  2BL0 C;  1XFX O;  2KQ6 A;  1B9A A;  2LUC A;  2EC6 C;  4GNK B;  4HRG A;  1EH2 A;  3WNX B;  3SG5 A;  1OMR A;  1UHK A;  2NCP A;  4MZL A;  3FWB A;  2OPO A;  3BOW B;  3RM1 A;  1KWO C;  1QX5 B;  1E8A A;  1S26 D;  1YVH A;  1J1D A;  2PRU A;  1SL8 A;  1CDP A;  4PHM A;  4YGD B;  1N65 A;  2A4J A;  3BUN B;  2LCP A;  1ZUZ A;  1TN4 A;  2B1U A;  2KHN A;  4JQ0 D;  2L0P A;  4NDB A;  3EK8 A;  1EG4 A;  4ORB B;  1AK8 A;  1DTL A;  2JT8 A;  3KO0 A;  4PE0 A;  1L7Z A;  1XFY O;  1J55 A;  4P5O E;  3EKH A;  1AP4 A;  2Y1M A;  1EJ3 A;  3PN7 B;  1M63 B;  4XJK A;  1NYA A;  3RLZ A;  1WY9 A;  2WCE A;  1F54 A;  1TNX A;  3NSO A;  5CSF A;  5HKW A;  1V1G A;  1SK6 D;  4A4C A;  1DJY A;  1S6C A;  1ALV A;  1XYD A;  4XJK B;  2LE9 B;  2O60 A;  2L98 A;  3TS5 C;  2KSP A;  2JC2 A;  1FW4 A;  1K9U A;  3O2P A;  3BQ3 A;  1AVS A;  4ORA B;  4CFR A;  1PSR A;  2KI4 C;  1OZS A;  1L2O B;  5PAL A;  1B8R A;  4L9M A;  1KFU L;  4OV2 A;  1QXP A;  3HCM A;  1KFX S;  1NUB A;  2E6W A;  4QJ3 B;  4GGF C;  3FWC A;  1UHI A;  3NSL A;  1NIW A;  2JNX A;  4ORC B;  3EVR A;  3BYA A;  1UP5 A;  3LK1 A;  1IRJ A;  2F2O A;  2GGM A;  1YRU B;  2WND A;  1QV0 A;  1FI6 A;  4HRH A;  1BOC A;  4YRU A;  2CCM A;  1M45 A;  1ZOT B;  1HT9 A;  2KI6 C;  2LVK A;  5AER A;  1OOJ A;  3EK7 A;  4YGB B;  4CLN A;  4ICB A;  3CR4 X;  1DMO A;  1TNQ A;  2KFG A;  2FCD A;  5HYD A;  2JNF A;  3CWG A;  2KYC A;  4DIR A;  1BJF A;  3D10 A;  2MHH A;  2HF5 A;  3EVU A;  2M0R A;  1H4B A;  2BKI B;  2NZ0 A;  3CZT X;  4IL1 A;  1Y0V H;  3DVJ A;  5I2O A;  2F3Y A;  1B1G A;  3I5H C;  4DCK A;  1XO5 A;  2Q4U A;  3CGA A;  1S3P A;  2M3W A;  4MEW A;  1BMO A;  3JTD C;  2LMV A;  1ZAC A;  3OB1 B;  1KK8 B;  2JXC A;  4YI8 A;  5I8N A;  5IBW A;  1GGW A;  2L4H A;  4UPG A;  2WOR A;  1KCY A;  4OCI A;  1MXE A;  2L5X B;  5DKQ A;  1UHH A;  1K96 A;  1B8L A;  4OVN F;  1FPW A;  3ZWH A;  1YRT B;  3SG6 A;  1CTR A;  1LA3 A;  2D8N A;  2KYF A;  1W7J B;  1NCX A;  1GQM A;  1XFZ O;  1PVA A;  1PVB A;  1DGU A;  2KFH A;  3WHU B;  2EGD A;  1PSB A;  3BUM B;  1WRL A;  1NX1 A;  1VRK A;  5B8I B;  2KAY A;  3I5F B;  1XK4 C;  2JTZ A;  3BUW B;  3I5I B;  1SY9 A;  1TOP A;  4I5J A;  2JT3 A;  3TDU A;  4OR9 B;  1DJI A;  2JWW A;  1KSM A;  1K93 D;  2F2P A;  2IS9 A;  2ZRT A;  1KQV A;  1H8B A;  2WCF A;  4ZCV A;  4M2P A;  1NX3 A;  2M9G A;  1MQ1 A;  1A03 A;  3K21 A;  4MVF A;  1YUS A;  1M39 A;  3PSR A;  1IKU A;  1N0Y A;  3F45 A;  3OP0 A;  3SIB A;  1C07 A;  3LL8 B;  1JC2 A;  1KK7 Z;  1AUI B;  2L51 A;  3SG2 A;  1NX2 A;  1S5G Z;  1K2H A;  2Y4Q A;  1JF0 A;  1B8C A;  2M7L A;  3MSE B;  1SPY A;  5GQQ C;  2KI6 D;  5HKZ A;  1C7V A;  2LVV A;  1TNW A;  5I2L A;  5BPJ A;  2PAS A;  1IJ6 A;  5DKR A;  1LKJ A;  2LVI A;  3SIA A;  4CFQ A;  1K9K A;  2I2R E;  3PN7 C;  3OHM B;  3CLN A;  4JPZ B;  5KSZ A;  2LAN A;  2LV7 A;  2M97 A;  4I5N B;  4I5L B;  2K7B A;  2CT9 A;  1Y1U A;  3KF9 A;  1B7T Z;  1KFU S;  2JXL A;  4P2Y B;  5D69 A;  3SG3 A;  1IG5 A;  1XFU O;  2R2I A;  1RJV A;  3AKB A;  4MRY A;  3WXA A;  1CM4 A;  3ICB A;  2L4I A;  1F71 A;  4GPL B;  1IGV A;  1DVI A;  1L2O C;  1CLB A;  5CSI A;  1DJH A;  1KQM B;  3DVK A;  2K7C A;  3KPX A;  3NSI A;  3CR5 X;  5JOL A;  5AEQ A;  1QIV A;  4BY5 A;  1Y1A A;  1OZO A;  5HKY A;  5F6T A;  1XFV O;  5CPV A;  1B4C A;  1SR6 B;  1FBV A;  2M1K B;  2E30 A;  1RWY A;  3OX5 A;  2BKH B;  4PAL A;  2BCB A;  1JWD A;  1YUR A;  2AUC A;  2PSR A;  5ER5 A;  1QX7 A;  2BCA A;  1NP8 A;  4MZJ A;  2K8M B;  4C0J A;  1QVI Z;  4WQ2 A;  1G4Y R;  3KEV A;  4AQI A;  2ISD A;  1HQV A;  4PE4 A;  1RRO A;  2ZNE A;  1YX7 A;  1F4Q A;  2H61 A;  1CDL A;  3EVV A;  4PDZ A;  3PAT A;  3SJS A;  4CPV A;  1WDC B;  3OX6 A;  2Y5I A;  4DS7 A;  4PHN A;  3NXA A;  3GOF A;  1IWQ A;  3BUO B;  2JPT A;  1LIN A;  2MBX A;  1M31 A;  1KK8 C;  1QLK A;  1NCY A;  5I2Q A;  2BE4 A;  1MR8 A;  4F0Z B;  3I5G B;  2NXQ A;  2JRF A;  1DT7 B;  4GUK A;  3LCP C;  1TCO B;  2I7A A;  2O5G A;  5HLO A;  2G2B A;  4BY4 A;  3LLE A;  1OMD A;  2LM5 A;  3VRN A;  1OE9 B;  3I5I C;  3I5F C;  2OTG B;  1KSO A;  2JUL A;  2K2F A;  2KGB C;  1LVC D;  4PE1 A;  1DGV A;  2WC8 A;  2KGR A;  2HPS A;  2K2A A;  1A29 A;  1F55 A;  3DD4 A;  1TRF A;  1CLM A;  1F4O A;  1DJW A;  2KFF A;  4M2O A;  2AAO A;  1F8H A;  1BT6 A;  1QAT A;  2PMY A;  5D7F A;  3JVT B;  1SL7 A;  1R6P A;  1SCV A;  4WQ3 A;  1A75 A;  1WRK A;  1QX2 A;  3PFV A;  1QIW A;  2K7D A;  2GV5 A;  2LAP A;  1U5I A;  1XVJ A;  2WCB A;  1SMG A;  2LP2 A;  1UHN A;  2QPT A;  4GAO A;  3CTN A;  5TNC A;  1QJT A;  1A75 B;  1ZMZ A;  1NWD A;  1SBJ A;  1YX8 A;  2LHI A;  1XFW O;  1PUL A;  3FS7 A;  4GGN A;  5AAN A;  1JSA A;  1Y1X A;  2QAC A;  2ZRS A;  2JOJ A;  3HX4 A;  4ZCU A;  1U5I B;  1J7Q A;  2BEC A;  4PHJ A;  1FI5 A;  1RFJ A;  1YTZ C;  2SAS A;  1MWN A;  3GK2 A;  4XYN A;  2PVB A;  1FF1 A;  1K90 D;  1G8I A;  2KBI A;  4NQG A;  4QJ5 B;  1BF5 A;  4MZK A;  2MLE C;  4PCW A;  1CFC A;  5KU1 A;  1EXR A;  1WLM A;  2JTT A;  1PAL A;  3TZ1 A;  3AAK A;  2BBM A;  1JF2 A;  1TNP A;  3IQQ A;  3WHT B;  1LXF C;  4NDC A;  1OQP A;  2LP3 A;  2LUX A;  3E3R A;  1WRZ A;  1KQM C;  1KK7 Y;  1S5G Y;  1CMG A;  4OKH A;  1MHO A;  2LLU A;  3IQO A;  4FQO A;  2COL B;  4A4B A;  1CFF A;  1SR6 C;  1A2X A;  3VRR A;  3O78 A;  1YR5 A;  1NCZ A;  1BR4 B;  1RTP 1;  1V1F A;  2JT0 A;  1BG1 A;  3DVM A;  1AHR A;  2HET A;  2JQ6 A;  4R1E A;  2ZN9 A;  1CDN A;  3OB2 B;  5DKN A;  1UUS A;  2WOS A;  1IH0 A;  1ODB A;  1CLL A;  4PE7 A;  4N5X A;  1CM1 A;  5CSJ A;  2NCO A;  2MA2 A;  5CSN A;  1NPQ A;  1WLZ A;  4QJ4 B;  1BU3 A;  1WDC C;  1QV1 A;  3BXK A;  2VRG A;  3EK4 A;  1MXL C;  2K61 A;  4JWQ A;  3SG7 A;  2ZN8 A;  2H61 C;  4MBE A;  1DJZ A;  1OMV A;  1PRW A;  1S6I A;  1TIZ A;  2KQY A;  3GK4 X;  4U8D A;  2M8U A;  1K8U A;  2BCX A;  3VRP A;  4GFT A;  2LMU A;  1JBA A;  5ER4 X;  5JJG A;  2AMI A;  3I5G C;  4YGE B;  1M46 A;  4MRX A;  1SCM B;  1C7W A;  2LNK A;  4TNC A;  4I5K A;  2ZND A;  3TUY B;  2OS8 B;  4C0K A;  3M0W A;  1SL9 A;  2M29 A;  2L50 A;  4YBH B;  1IJ5 A;  4N1F A;  2OTG C;  2V53 A;  2SCP A;  2GGZ A;  2BL0 B;  2FCE A;  1QVI Y;  1AJ4 A;  2EC6 B;  1ALW A;  2JU0 A;  1Q80 A;  1CFD A;  1PK0 D;  1CB1 A;  4N1G A;  1X02 A;  2CTN A;  3FIA A;  1SRA A;  1CMF A;  1YUU A;  2FOT A;  3DVE A;  1KWO B;  2MLF C;  1EL4 A;  1BOD A;  3DF0 A;  2TN4 A;  3JVT C;  4HSZ A;  2P6B B;  1QLS A;  4YGC B;  3H4S E;  1EG3 A;  4C0L A;  1R2U A;  1YUT A;  1J7R A;  2RGI A;  1GGZ A;  1YVL A;  3GK1 A;  1CDM A;  3DF0 B;  2M49 B;  2G9B A;  3LK0 A;  2LVJ A;  3PAL A;  1UWO A;  2I18 A;  2ZKM X;  4MSP A;  2Q91 A;  2KAX A;  5FYX A;  1CFP A;  2I94 A;  3QRX A;  1IQ3 A;  2Y1N A;  1REC A;  2MAZ A;  2L2E A;  1ZFS A;  5HLV A;  4YI9 A;  4MN0 A;  1SW8 A;  3IF7 A;  1JFJ A;  1W7I B;  4MLW A;  5AXI A;  2MRD A;  3D0Y A;  1MUX A;  3EKJ A;  4NDD A;  5K89 A;  1IQ5 A;  2M1U A;  1UHJ A;  4HRE E;  5G08 A;  1TTX A;  1BR1 B;  4WRI A;  3TDI A;  2DOQ A;  4FTG A;  3AKA A;  3TS5 B;  1N2D A;  1AJ5 A;  2MJW B;  1SKT A;  1K95 A;  3D0Y B;  1GJY A;  3BUX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...