1U5IB

Crystal structure analysis of rat m-calpain mutant lys10 thr
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
NESEEERQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQGIYKRFDTDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAMFRAFRSLDKNGTGQIQVNIQEWLQLTMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calpain 2, large [catalytic] subunit precursor
publication title Activation of calpain by Ca2+: roles of the large subunit N-terminal and domain III-IV linker peptides
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1u5iB00
1KWOC 1M39A 1GJYA 2LAPA 3IQOA 1LINA 3FWBA 1JUOA 2JC2A 4N1GA 2Y5IA 2D8NA 1J55A 3I5IB 2ZRSA 3CLNA 1ZACA 5I2OA 2BCBA 3E3RA 2M9GA 1EXRA 2NLNA 2F3YA 3CGAA 3EVUA 2QPTA 2NZ0A 1KQMB 1CMFA 1PVAA 5ER5A 5I2QA 4NDCA 1UHHA 2LVIA 4USLA 4ZCVA 4PHKA 1C7WA 5ER4X 2HF5A 1CDLA 1C07A 3H4SE 2LE9B 1KFXL 4OCIA 4XJKB 1BOCA 1CNPA 1B1GA 4C0LA 1TNPA 2ZNEA 2LHIA 1PALA 1A03A 4PE0A 1OOJA 1AJ5A 2KI6D 4N5XA 5CSNA 1YUTA 2LLTA 3OX5A 1SCVA 5HLOA 1KK8C 1WRZA 2OTGC 4TNCA 3EK8A 3TS5B 1PVBA 1Y1AA 5HYDA 1F4OA 5IBWA 2KAYA 4CFRA 1IQ5A 1KK7Y 3JVTC 1TOPA 1B7TY 1K9KA 2M29A 3WHTB 3D10A 3O4YA 4F0ZB 1CFFA 1YX7A 2JT3A 3JTDC 2OS8C 2KHNA 1NPQA 1QTXA 1GGZA 1ZUZA 5GQQC 3BUXB 1IH0A 2CT9A 1K8UA 3BUMB 3NXAA 4PCWA 4JQ0D 3VGOA 2KI6C 2ZKMX 2EHBA 2JTZA 3OB1B 4PE7A 3LK1A 3HX4A 2I18A 2KSPA 2MJWB 2O60A 4C0KA 1KK8B 1F4QA 2CNPA 1EG4A 2KFFA 1CB1A 1SY9A 1MHOA 5HKYA 1SBJA 1SCMC 1KK7Z 5JOLA 1RECA 1B7TZ 2JWWA 2JNXA 3SG4A 3SIBA 4BY4A 1RROA 3JVTB 5KU1A 2HETA 1B9AA 2L50A 4MSPA 2M3WA 2M8UA 4DCKA 4PE4A 3BOWA 1B4CA 2M0RA 2AMIA 1DJIA 2OS8B 3OB2B 4HRGA 1KFXS 2KNEA 4PHMA 1YVHA 2MHHA 1W7JB 3SG3A 2JT0A 2KI4C 2G9BA 4MRYA 5PALA 1CDPA 3PATA 3IF7A 1YUUA 2LV7A 2K7OA 2CTNA 2JU0A 2L4HA 2JPTA 1A75A 5D69A 3DF0B 2OPOA 4QJ5B 4GFTA 1SPYA 3TDZA 1EJ3A 1QLKA 1DVIA 1S36A 1VRKA 2GV5A 2L51A 3GK4X 1W7IB 2O5GA 3EVVA 1FI6A 1UHIA 1XFVO 1TNQA 2DOQA 3BQ3A 3O2PA 4GNKB 1JBAA 2L4IA 1E8AA 2L98A 2KQ6A 3OHMB 4PHJA 2FJUB 1JFKA 2M1KB 2KGBC 3BUOB 3VRPA 3VRQA 2Q91A 1IJ5A 2MBXA 2IS9A 2FOTA 2K2FA 4GGFC 1YR5A 1OZOA 1YRUB 4YGEB 4AQIA 1RK9A 3A4UB 1SNLA 1SR6C 3CTNA 4MVFA 3PSRA 1RJVA 2LC5A 2KI4B 1QIVA 3WNXB 2F2OA 1NX1A 3EKJA 1SK6D 1FF1A 4WRIA 1WDCB 5JJGA 1NUBA 3EK4A 3AAKA 1KFUL 5HKZA 3SIAA 5F6TA 1YURA 2LM5A 1UHJA 3CS1A 2KOTA 1YTZC 3KF9A 3O78A 1PRWA 2KDHA 4YGDB 1DJYA 2M7NA 4YGAA 4OV2A 2KYCA 4XYNA 1DJXA 1K93D 2PALA 1DGVA 1N0YA 1Y1XA 3DD4A 1B47A 4PHNA 1U5IB 4NDDA 1J7QA 1B8CA 2CCMA 1QASA 4CPVA 2BE4A 2K7BA 1SRAA 4MZJA 1FPWA 1MXEA 5AEQA 1KCYA 1V1FA 3LCPC 1M46A 1YX8A 1SR6B 1JSAA 5AERA 1NCYA 3KPXA 2LLSA 4R1EA 2LVVA 4GUKA 5CPVA 1F8HA 3BUWB 2HPSA 2HQWA 5I8NA 2K2AA 1JFJA 2M7LA 2KQYA 4HREE 3NSLA 1KWOB 4YI9A 1X02A 2JQ6A 2K61A 1EG3A 1IGVA 1GGWA 3WHUB 1J7OA 1NYAA 1IJ6A 2JT8A 1XO5A 2F33A 3A8RA 1TIZA 2JOJA 1F55A 1LXFC 2LVJA 2WOSA 3AKBA 2K7DA 5K89A 4CLNA 2R2IA 1SYMA 1CKKA 4OKHA 4MLWA 5AXIA 3KHEA 1WY9A 3I5HC 1H4BA 2I2RE 4DRWA 3D0YB 1Q80A 1FBVA 2PMYA 2LP2A 1CM1A 2LANA 5KSZA 1ALVA 1MF8B 4WQ3A 2JRFA 4Q04A 1NX2A 3LK0A 2LMVA 1KFUS 2KFHA 1YUSA 2LNKA 3DVJA 1M63B 3SJSA 1J7PA 4GAOA 4I5NB 3AKAA 2MAZA 1F70A 3NSIA 2F2PA 1CTRA 1IWQA 5FYXA 4ZCUA 2OTGB 3NSKA 1ZFSA 1L7ZA 2ZN8A 1DT7B 1JF2A 5DKQA 1J1DA 1R2UA 1TCOB 2Y1MA 3JTDB 4M2OA 4ORBB 1TRFA 1IKUA 4MZKA 2G2BA 3NSOA 1A29A 2E6WA 1AHRA 1TN4A 4AQJA 1SW8A 1RWYA 1DF0A 3I5FC 4JPZB 4DUQA 1BF5A 3HCMA 3GOFA 1H8BA 1PSRA 1Y0VH 4JWQA 5CSIA 3SG2A 1K2HA 1XYDA 1S6CA 4WQ2A 4DIRA 4I5KA 1EL4A 1NWDA 3BYAA 3CR2A 1K96A 4HSZA 1UHKA 4D1EA 1J1EA 2H61A 2K8MB 1NP8A 5DKRA 1NSHA 1QS7A 1IG5A 4ORAB 3ZNIA 4BY5A 4UPGA 1K9PA 1M45A 1SCMB 2BL0C 2ZRTA 2Y1NA 4QJ4B 1DGUA 1SKTA 4ICBA 1L2OC 3FS7A 2Y4QA 1LA3A 2L2EA 1F54A 1WLMA 2CBLA 1QV0A 2H2KA 5AANA 1SMGA 1CM4A 4YGBB 2KAXA 1TCFA 1AJ4A 2H61C 3CR5X 1S6IA 1V1GA 3SG7A 4GBAA 1EH2A 3VRRA 1B8RA 1ODBA 2E30A 1KQVA 4XJKA 1S5GZ 3GK1A 4A4BA 1GQMA 3I5IC 1A2XA 4M2PA 4PDZA 4M2QA 2BBMA 2COLB 2LLUA 4OR9B 1BLQA 1AVSA 1NCXA 1NX3A 1ALWA 2LMUA 4IL1A 1DJGA 1KQMC 3BOWB 3SG6A 2WNDA 1K9UA 1XFUO 3TUYC 2SASA 4QJ3B 1XVJA 1OSAA 2K0JA 2RGIA 3KEVA 2VRGA 5G08A 5I2LA 1MR8A 2FCDA 1G33A 3RLZA 1A75B 1ZOTB 3O6BA 1UWOA 3TDUA 3OX6A 5AFPA 1QV1A 1UURA 1DJHA 4YGCB 1XFZO 3CWGA 4HRHA 1PULA 1QX7A 1ZMZA 2F8PA 3M0WA 4CFQA 1QIWA 5J3XA 1QXPA 1PSBA 4P2YB 1C7VA 1DTLA 2P6BB 1TTXA 3CR4X 3IQQA 2JTTA 3TS5C 2KAVA 5CSJA 2BECA 3AAJA 2KBMA 2K7CA 4MZLA 1BU3A 1SL7A 2EGDA 4GGNA 2L0PA 4NDBA 2NXQA 1AP4A 3VROA 1G4YR 2BCAA 3TUYB 1WRKA 2PASA 4PE1A 1XFYO 1JWDA 1TNWA 1DJWA 2BKHB 1MXLC 2LCPA 4A4CA 3ZWHA 1QX5B 1BG1A 1OZSA 1BJFA 1XFWO 2LUXA 2ZN9A 1LA0A 4FTGA 1DMOA 2ZNDA 4L9MA 2AUCA 2JXLA 1AUIB 3EK7A 1S3PA 1Y1UA 1CDMA 1RTP1 1QLSA 2L5XB 2BKIB 2LP3A 1WLZA 5BPJA 2LHLA 3TZ1A 3DF0A 2PRUA 1FI5A 1A4PA 1WRLA 3SG5A 2I94A 4OVNF 1D1OA 2NCPA 2A4JA 5DKNA 3PN7C 1KSMA 4YBHB 2JZIA 2M97A 1HT9A 1UUSA 3LLEA 2ZFDA 1YRTB 2JXCA 1OMVA 1XFXO 2PVBA 3I5HB 1JC2A 1SL8A 4MEWA 2EC6C 5CSFA 1LKJA 2BBNA 2BCXA 1B8LA 1AK8A 1OE9B 1CFDA 3KO0A 2KFGA 4ETOA 1DJZA 1S26D 1LVCD 2MLEC 4YI8A 4YRUA 2LVKA 2F3ZA 4MRXA 1F71A 1CMGA 3K21A 2WC8A 3ICBA 2MLFC 5HKWA 1BODA 1M31A 1QVIY 2TN4A 3DVKA 2PSRA 3EKHA 3BXKA 1HQVA 1S5GY 2GGMA 2KGRA 1XK4A 3FWCA 1MUXA 1NCZA 1CLBA 1K95A 1UHNA 2B1UA 2WORA 1OQPA 3PN7B 3QRXA 2V53A 3I5GC 2Q4UA 1J7RA 5HLVA 1OMRA 3PFVA 3DVMA 3FIAA 1QX2A 5D7FA 1NX0A 2QACA 4ORCB 2EC6B 3DVEA 1BR1B 1PK0D 1K90D 1QATA 4P5OE 1U5IA 3LL8B 3WXAA 1BMOA 1NIWA 1TNXA 4GGFA 4CIDA 1BR4B 4N1FA 1G8IA 1QJTA 3PM8A 3I5FB 2MA2A 3F45A 1N65A 1RFJA 1WDCC 1JF0A 2NCOA 3C1VA 2ISDA 1XK4C 1QVIZ 4C0JA 3TDIA 3VRNA 1CLLA 2SCPA 3PALA 4E68A 3BUNB 1IRJA 1SL9A 2KBIA 2LUCA 1MQ1A 4U8DA 2WCBA 1FW4A 3OP0A 2LMTA 1KSOA 1S1EA 2MRDA 1YVLA 4AOMA 1BT6A 2CXJA 5KTYA 3I5GB 3PLFB 2WCFA 1MWNA 3MSEB 4MN0A 2GGZA 2BL0B 1CFPA 1DF0B 2I7AA 1Y6WA 1CFCA 1L2OB 1XA5A 2JULA 3GK2A 1S6JA 1CDNA 1R6PA 4DS7A 2M49B 3EVRA 5TNCA 4FQOA 1K94A 2BE6A 1N2DA 2AAOA 3CZTX 2HQ8A 2JNFA 4MBEA 4GPLB 1IQ3A 2FCEA 1UP5A 2M1UA 3RM1A 4PALA 3D0YA 5B8IB 1OMDA 1CLMA 2KYFA 4I5LB 4NQGA 2WCEA 4I5JA
chains in the Genus database with same CATH superfamily
1KWOC 1M39A 1GJYA 2LAPA 3IQOA 1DC1A 1LINA 3FWBA 1JUOA 2JC2A 4N1GA 2Y5IA 2BNXA 2D8NA 1J55A 4INWA 3I5IB 2ZRSA 3CLNA 1ZACA 5I2OA 2BCBA 3E3RA 2M9GA 1EXRA 2NLNA 2F3YA 4PT1A 3CGAA 3EVUA 2QPTA 2NZ0A 1KQMB 5FI7A 1PVAA 1CMFA 5ER5A 3B86A 5I2QA 4NDCA 1UHHA 1DEKA 2LVIA 4USLA 4ZCVA 4PHKA 1C7WA 5ER4X 2HF5A 1CDLA 3K1EA 1C07A 3H4SE 2LE9B 1KFXL 4OCIA 4XJKB 1BOCA 1CNPA 1B1GA 4C0LA 1TNPA 2P70A 2ZNEA 2LHIA 1PALA 1A03A 4PE0A 1OOJA 3OBVA 1AJ5A 3CYZA 2KI6D 4N5XA 5CSNA 1YUTA 2LLTA 3OX5A 1SCVA 5HLOA 1KK8C 1WRZA 2OTGC 5D3OA 3SS4A 4TNCA 3EK8A 3TS5B 1PVBA 1Y1AA 5HYDA 1F4OA 5IBWA 2KAYA 4CFRA 1IQ5A 1KK7Y 3JVTC 1TOPA 1B7TY 1K9KA 2M29A 3WHTB 3D10A 3O4YA 4F0ZB 3EG5B 1CFFA 1YX7A 2JT3A 1TUZA 3JTDC 5HL1A 1OW4A 2OS8C 2KHNA 1QWVA 1NPQA 1QTXA 1GGZA 1ZUZA 5GQQC 3BUXB 2KPHA 1IH0A 1W9ZA 2CT9A 1K8UA 3BUMB 3NXAA 4PCWA 4JQ0D 1P28A 3VGOA 2KI6C 2ZKMX 2EHBA 2JTZA 3OB1B 4PE7A 2QEVA 3LK1A 3HX4A 2I18A 3D78A 2KSPA 2MJWB 2O60A 4C0KA 1KK8B 1F4QA 2CNPA 1EG4A 2KFFA 1CB1A 1SY9A 1MHOA 5HKYA 1SBJA 1SCMC 1KK7Z 5JOLA 1RECA 1B7TZ 2JWWA 2JNXA 3SG4A 3SIBA 4BY4A 1RROA 3JVTB 5KU1A 2HETA 1B9AA 2L50A 3DZTA 4MSPA 2M3WA 2M8UA 4DCKA 4PE4A 3BOWA 1B4CA 3L4AA 2M0RA 2AMIA 1DJIA 2OS8B 3OB2B 4HRGA 1KFXS 2KNEA 2QEBA 4PHMA 1YVHA 2MHHA 1W7JB 3BJHA 3SG3A 2JT0A 2KI4C 2G9BA 4MRYA 3OGNA 5PALA 1CDPA 3PATA 3IF7A 1YUUA 2LV7A 2K7OA 2CTNA 2JU0A 2YGUA 2L4HA 2JPTA 1A75A 3D76A 3R1VA 5D69A 3DF0B 2OPOA 3S0EA 4QJ5B 4GFTA 1SPYA 3TDZA 1EJ3A 1QLKA 1DVIA 1S36A 1VRKA 2GV5A 2L51A 3GK4X 1W7IB 2O5GA 3EVVA 1FI6A 1UHIA 1XFVO 1TNQA 2DOQA 2QDIA 3BQ3A 3O2PA 4GNKB 1JBAA 2L4IA 1E8AA 2L98A 2KQ6A 3OHMB 4PHJA 2FJUB 1JFKA 2M1KB 2KGBC 1XFRA 3BUOB 3VRPA 3VRQA 2Q91A 3UO9A 1IJ5A 2MBXA 2IS9A 2FOTA 2K2FA 4GGFC 1YR5A 1OZOA 1YRUB 4YGEB 4AQIA 1RK9A 3D73A 3A4UB 4JKTA 1SNLA 1SR6C 3CTNA 4MVFA 3PSRA 2GTEA 1RJVA 2LC5A 2KI4B 1QIVA 3WNXB 2F2OA 1NX1A 3S0AA 3EKJA 1SK6D 1FF1A 4WRIA 1WDCB 5JJGA 1NUBA 3EK4A 3AAKA 1KFUL 3BFAA 5HKZA 3SIAA 2PQLA 5F6TA 1YURA 2LM5A 3CZ2A 4IJ7A 1UHJA 1DQEA 3CS1A 2KOTA 1YTZC 3KF9A 3O78A 1PRWA 2KDHA 4YGDB 1DJYA 2M7NA 4YGAA 1KCYA 4OV2A 2KYCA 4XYNA 1DJXA 1K93D 2PALA 1DGVA 1N0YA 1Y1XA 3DD4A 1B47A 4PHNA 2QEOA 2BAPA 1U5IB 4NDDA 1J7QA 1B8CA 2CCMA 1QASA 4CPVA 2BE4A 2K7BA 1SRAA 4MZJA 3V2LA 1MXEA 3DXLA 3QMEA 5AEQA 1V1FA 3LCPC 1M46A 1YX8A 1SR6B 3FE9A 5AERA 1NCYA 3KPXA 2LLSA 4R1EA 1JSAA 2LVVA 2L2CA 4GUKA 5CPVA 1F8HA 3NHIA 3S0FA 3BUWB 2HPSA 2HQWA 5I8NA 2K2AA 1JFJA 2M7LA 5FI6A 2KQYA 4HREE 3NSLA 1KWOB 4YI9A 1X02A 2JQ6A 2K61A 1EG3A 1IGVA 1GGWA 3WHUB 1J7OA 1NYAA 1IJ6A 2JT8A 3S0GA 1XO5A 2F33A 2JPOA 1TIZA 3A8RA 2JOJA 3VB1A 1F55A 1LXFC 2LVJA 2WOSA 1OOFA 3AKBA 2K7DA 5K89A 4CLNA 2R2IA 2L5YA 1SYMA 2WCMA 1CKKA 4OKHA 4MLWA 5AXIA 3KHEA 1WY9A 3I5HC 1H4BA 4F7FA 1TUJA 2I2RE 4DRWA 3D0YB 1Q80A 1FBVA 2PMYA 2LP2A 1CM1A 3UNWA 2LANA 5KSZA 1ALVA 1MF8B 3IVTA 3R72A 4WQ3A 2JRFA 4Q04A 1GM0A 1NX2A 2WCKA 3LK0A 2LMVA 1KFUS 1Z2CB 2ERBA 2KFHA 2WC5A 1YUSA 2LNKA 3DVJA 1M63B 3SJSA 1J7PA 5DICA 4GAOA 4I5NB 3AKAA 2MAZA 1F70A 3NSIA 2F2PA 1CTRA 1IWQA 5FYXA 3L4LA 4ZCUA 2OTGB 1Z4HA 3DYEA 4JD9A 3NSKA 1ZFSA 1L7ZA 2ZN8A 1DT7B 1JF2A 5DKQA 1J1DA 1R2UA 1TCOB 2Y1MA 3JTDB 4M2OA 4ORBB 1TRFA 1IKUA 4MZKA 2G2BA 3NSOA 1A29A 2E6WA 1AHRA 1TN4A 4AQJA 1SW8A 1RWYA 1DF0A 3I5FC 4JPZB 4DUQA 1BF5A 3HCMA 3GOFA 1H8BA 1PSRA 1Y0VH 4JWQA 5CSIA 3SG2A 1K2HA 1XYDA 3N7HA 1S6CA 4WQ2A 4DIRA 4I5KA 1EL4A 1NWDA 3BYAA 3CR2A 1K96A 4HSZA 1UHKA 4INXA 4D1EA 1J1EA 2H61A 2K8MB 1NP8A 1IIOA 5DKRA 1NSHA 1QS7A 1IG5A 1OOIX 4ORAB 3ZNIA 4BY5A 4UPGA 1K9PA 1M45A 1SCMB 2BL0C 2ZRTA 3PJIA 2Y1NA 4QJ4B 1DGUA 1SKTA 4ICBA 1L2OC 1C3YA 1C3ZA 2Y4QA 2WCJA 3FS7A 1LA3A 2L2EA 1F54A 1WLMA 2CBLA 1QV0A 2H2KA 5AANA 3DY9A 1SMGA 1CM4A 4YGBB 3B87A 2KAXA 1TCFA 1AJ4A 2H61C 1ORGA 3CR5X 3S0BA 1S6IA 1V1GA 3SG7A 4GBAA 1EH2A 3VRRA 1B8RA 1ODBA 2E30A 1KQVA 4XJKA 1S5GZ 3GK1A 4A4BA 1GQMA 3I5IC 1A2XA 4M2PA 4PDZA 4M2QA 2BBMA 2COLB 2LLUA 2K60A 4OR9B 1BLQA 1AVSA 1NCXA 1NX3A 1ALWA 2LMUA 4IL1A 1DJGA 1KQMC 3BOWB 3SG6A 2WNDA 1K9UA 2PYQA 1XFUO 3TUYC 2SASA 4QJ3B 1XVJA 1OSAA 2K0JA 2RGIA 3KEVA 2VRGA 5G08A 5I2LA 3BFBA 5I94A 1MR8A 3Q8IA 2FCDA 1G33A 3RLZA 1A75B 1ZOTB 3O6BA 1UWOA 3TDUA 3OX6A 5AFPA 1QV1A 1UURA 1DJHA 4YGCB 1XFZO 3CWGA 4HRHA 1PULA 1QX7A 1ZMZA 2F8PA 3M0WA 4CFQA 1T14A 1QIWA 5J3XA 1QXPA 1PSBA 4P2YB 1C7VA 1DTLA 2P6BB 1TTXA 3CR4X 1OOGA 3CZ1A 2JTTA 3IQQA 3TS5C 3B6XA 2KAVA 5CSJA 2BECA 3AAJA 2KBMA 2K7CA 4MZLA 1BU3A 1SL7A 2EGDA 4GGNA 2L0PA 4NDBA 2NXQA 1AP4A 3VROA 3L47A 1G4YR 2BCAA 3TUYB 1WRKA 2PASA 4PE1A 1XFYO 1JWDA 1TNWA 1DJWA 2BKHB 1MXLC 2LCPA 4A4CA 3ZWHA 1QX5B 1BG1A 1OZSA 1BJFA 1XFWO 2LUXA 2ZN9A 1LA0A 3CDNA 4FTGA 1DMOA 2ZNDA 4L9MA 2AUCA 2JXLA 1AUIB 3EK7A 1S3PA 1Y1UA 1CDMA 1RTP1 1QLSA 2L5XB 2FJYA 2QEHA 2BKIB 3SS5A 2LP3A 1WLZA 5BPJA 2LHLA 3TZ1A 3DF0A 3NHTA 2PRUA 1FI5A 1A4PA 4FQTA 1WRLA 3SG5A 2I94A 3S0DA 4OVNF 3B7AA 3NGVA 2WCLA 1D1OA 2NCPA 2A4JA 5DKNA 3PN7C 1KSMA 4YBHB 2JZIA 2M97A 4OZDA 1HT9A 1UUSA 3LLEA 2ZFDA 1YRTB 2JXCA 1OMVA 1XFXO 2PVBA 3I5HB 1JC2A 1SL8A 4MEWA 2EC6C 1SSEB 5CSFA 1LKJA 2BBNA 2BCXA 1B8LA 5EL2A 1OE9B 1CFDA 3KO0A 1AK8A 2KFGA 4ETOA 1DJZA 1S26D 1LVCD 2MLEC 4YI8A 4YRUA 2LVKA 2F3ZA 4MRXA 1F71A 1CMGA 3K21A 2WC8A 3ICBA 2MLFC 3PM2A 5HKWA 1BODA 1M31A 1QVIY 2H8VA 5FI2A 2TN4A 2KLDA 3DVKA 2PSRA 3EKHA 3BXKA 3O4XA 1LS8A 1HQVA 1S5GY 2GGMA 2KGRA 1XK4A 3FWCA 1MUXA 1NCZA 1CLBA 1K95A 1UHNA 2B1UA 2WORA 1OQPA 3PN7B 3QRXA 2V53A 3I5GC 2Q4UA 1J7RA 5HLVA 3D77A 1OMRA 3PFVA 3SS3A 3DVMA 3FIAA 1QX2A 5D7FA 1NX0A 2QACA 1DELA 4ORCB 2WCHA 1FPWA 2EC6B 3DVEA 1BR1B 1PK0D 1K90D 1QATA 4P5OE 1U5IA 3LL8B 3WXAA 1BMOA 1NIWA 1TNXA 4GGFA 4CIDA 1BR4B 4N1FA 1G8IA 1QJTA 2WC6A 3PM8A 3BFHA 3CZ0A 1OOHA 2MA2A 3I5FB 3F45A 1N65A 1RFJA 1WDCC 1JF0A 2NCOA 3C1VA 2ISDA 1XK4C 3FE6A 1QVIZ 3FE8A 3CABA 4C0JA 3TDIA 3R1OA 3VRNA 1CLLA 2SCPA 3PALA 4E68A 3BUNB 1IRJA 1SL9A 2KBIA 2LUCA 1MQ1A 4U8DA 2WCBA 1FW4A 4KYNA 3OP0A 1TWOA 1KSOA 1S1EA 2LMTA 2MRDA 1YVLA 4AOMA 1BT6A 2CXJA 3RZSA 5KTYA 3I5GB 3PLFB 2WCFA 1MWNA 3MSEB 4MN0A 2GGZA 2BL0B 1CFPA 1DF0B 2I7AA 1Y6WA 3D74A 1L2OB 1XA5A 1CFCA 2JULA 3GK2A 1S6JA 1CDNA 1R6PA 2KLEA 4DS7A 2P71A 3R1PA 2M49B 3EVRA 5TNCA 4FQOA 1K94A 2BE6A 1N2DA 2AAOA 3B88A 2HQ8A 2JNFA 3CZTX 4GPLB 4MBEA 1IQ3A 2FCEA 1UP5A 2M1UA 3D75A 4PALA 3RM1A 3D0YA 5B8IB 1OMDA 1CLMA 2KYFA 4I5LB 4NQGA 2WCEA 4I5JA
chains in the Genus database with same CATH topology
1KWOC 1M39A 1GJYA 2LAPA 3IQOA 1LINA 3FWBA 1JUOA 2JC2A 4N1GA 2Y5IA 2D8NA 1J55A 3I5IB 2ZRSA 3CLNA 1ZACA 5I2OA 2BCBA 3E3RA 2M9GA 1EXRA 2NLNA 2F3YA 3CGAA 3EVUA 2QPTA 2NZ0A 1KQMB 1CMFA 1PVAA 5ER5A 5I2QA 4NDCA 1UHHA 2LVIA 4USLA 4ZCVA 4PHKA 1C7WA 5ER4X 2HF5A 1CDLA 1C07A 3H4SE 2LE9B 1KFXL 4OCIA 4XJKB 1BOCA 1CNPA 1B1GA 4C0LA 1TNPA 2ZNEA 2LHIA 1PALA 1A03A 4PE0A 1OOJA 1AJ5A 2KI6D 4N5XA 5CSNA 1YUTA 2LLTA 3OX5A 1SCVA 5HLOA 1KK8C 1WRZA 2OTGC 4TNCA 3EK8A 3TS5B 1PVBA 1Y1AA 5HYDA 1F4OA 5IBWA 2KAYA 4CFRA 1IQ5A 1KK7Y 3JVTC 1TOPA 1B7TY 1K9KA 2M29A 3WHTB 3D10A 3O4YA 4F0ZB 1CFFA 1YX7A 2JT3A 3JTDC 2OS8C 2KHNA 1NPQA 1QTXA 1GGZA 1ZUZA 5GQQC 3BUXB 1IH0A 2CT9A 1K8UA 3BUMB 3NXAA 4PCWA 4JQ0D 3VGOA 2KI6C 2ZKMX 2EHBA 2JTZA 3OB1B 4PE7A 3LK1A 3HX4A 2I18A 2KSPA 2MJWB 2O60A 4C0KA 1KK8B 1F4QA 2CNPA 1EG4A 2KFFA 1CB1A 1SY9A 1MHOA 5HKYA 1SBJA 1SCMC 1KK7Z 5JOLA 1RECA 1B7TZ 2JWWA 2JNXA 3SG4A 3SIBA 4BY4A 1RROA 3JVTB 5KU1A 2HETA 1B9AA 2L50A 4MSPA 2M3WA 2M8UA 4DCKA 4PE4A 3BOWA 1B4CA 2M0RA 2AMIA 1DJIA 2OS8B 3OB2B 4HRGA 1KFXS 2KNEA 4PHMA 1YVHA 2MHHA 1W7JB 3SG3A 2JT0A 2KI4C 2G9BA 4MRYA 5PALA 1CDPA 3PATA 3IF7A 1YUUA 2LV7A 2K7OA 2CTNA 2JU0A 2L4HA 2JPTA 1A75A 5D69A 3DF0B 2OPOA 4QJ5B 4GFTA 1SPYA 3TDZA 1EJ3A 1QLKA 1DVIA 1S36A 1VRKA 2GV5A 2L51A 3GK4X 1W7IB 2O5GA 3EVVA 1FI6A 1UHIA 1XFVO 1TNQA 2DOQA 3BQ3A 3O2PA 4GNKB 1JBAA 2L4IA 1E8AA 2L98A 2KQ6A 3OHMB 4PHJA 2FJUB 1JFKA 2M1KB 2KGBC 3BUOB 3VRPA 3VRQA 2Q91A 1IJ5A 2MBXA 2IS9A 2FOTA 2K2FA 4GGFC 1YR5A 1OZOA 1YRUB 4YGEB 4AQIA 1RK9A 3A4UB 1SNLA 1SR6C 3CTNA 4MVFA 3PSRA 1RJVA 2LC5A 2KI4B 1QIVA 3WNXB 2F2OA 1NX1A 3EKJA 1SK6D 1FF1A 4WRIA 1WDCB 5JJGA 1NUBA 3EK4A 3AAKA 1KFUL 5HKZA 3SIAA 5F6TA 1YURA 2LM5A 1UHJA 3CS1A 2KOTA 1YTZC 3KF9A 3O78A 1PRWA 2KDHA 4YGDB 1DJYA 2M7NA 4YGAA 4OV2A 2KYCA 4XYNA 1DJXA 1K93D 2PALA 1DGVA 1N0YA 1Y1XA 3DD4A 1B47A 4PHNA 1U5IB 4NDDA 1J7QA 1B8CA 2CCMA 1QASA 4CPVA 2BE4A 2K7BA 1SRAA 4MZJA 1FPWA 1MXEA 5AEQA 1KCYA 1V1FA 3LCPC 1M46A 1YX8A 1SR6B 1JSAA 5AERA 1NCYA 3KPXA 2LLSA 4R1EA 2LVVA 4GUKA 5CPVA 1F8HA 3BUWB 2HPSA 2HQWA 5I8NA 2K2AA 1JFJA 2M7LA 2KQYA 4HREE 3NSLA 1KWOB 4YI9A 1X02A 2JQ6A 2K61A 1EG3A 1IGVA 1GGWA 3WHUB 1J7OA 1NYAA 1IJ6A 2JT8A 1XO5A 2F33A 3A8RA 1TIZA 2JOJA 1F55A 1LXFC 2LVJA 2WOSA 3AKBA 2K7DA 5K89A 4CLNA 2R2IA 1SYMA 1CKKA 4OKHA 4MLWA 5AXIA 3KHEA 1WY9A 3I5HC 1H4BA 2I2RE 4DRWA 3D0YB 1Q80A 1FBVA 2PMYA 2LP2A 1CM1A 2LANA 5KSZA 1ALVA 1MF8B 4WQ3A 2JRFA 4Q04A 1NX2A 3LK0A 2LMVA 1KFUS 2KFHA 1YUSA 2LNKA 3DVJA 1M63B 3SJSA 1J7PA 4GAOA 4I5NB 3AKAA 2MAZA 1F70A 3NSIA 2F2PA 1CTRA 1IWQA 5FYXA 4ZCUA 2OTGB 3NSKA 1ZFSA 1L7ZA 2ZN8A 1DT7B 1JF2A 5DKQA 1J1DA 1R2UA 1TCOB 2Y1MA 3JTDB 4M2OA 4ORBB 1TRFA 1IKUA 4MZKA 2G2BA 3NSOA 1A29A 2E6WA 1AHRA 1TN4A 4AQJA 1SW8A 1RWYA 1DF0A 3I5FC 4JPZB 4DUQA 1BF5A 3HCMA 3GOFA 1H8BA 1PSRA 1Y0VH 4JWQA 5CSIA 3SG2A 1K2HA 1XYDA 1S6CA 4WQ2A 4DIRA 4I5KA 1EL4A 1NWDA 3BYAA 3CR2A 1K96A 4HSZA 1UHKA 4D1EA 1J1EA 2H61A 2K8MB 1NP8A 5DKRA 1NSHA 1QS7A 1IG5A 4ORAB 3ZNIA 4BY5A 4UPGA 1K9PA 1M45A 1SCMB 2BL0C 2ZRTA 2Y1NA 4QJ4B 1DGUA 1SKTA 4ICBA 1L2OC 3FS7A 2Y4QA 1LA3A 2L2EA 1F54A 1WLMA 2CBLA 1QV0A 2H2KA 5AANA 1SMGA 1CM4A 4YGBB 2KAXA 1TCFA 1AJ4A 2H61C 3CR5X 1S6IA 1V1GA 3SG7A 4GBAA 1EH2A 3VRRA 1B8RA 1ODBA 2E30A 1KQVA 4XJKA 1S5GZ 3GK1A 4A4BA 1GQMA 3I5IC 1A2XA 4M2PA 4PDZA 4M2QA 2BBMA 2COLB 2LLUA 4OR9B 1BLQA 1AVSA 1NCXA 1NX3A 1ALWA 2LMUA 4IL1A 1DJGA 1KQMC 3BOWB 3SG6A 2WNDA 1K9UA 1XFUO 3TUYC 2SASA 4QJ3B 1XVJA 1OSAA 2K0JA 2RGIA 3KEVA 2VRGA 5G08A 5I2LA 1MR8A 2FCDA 1G33A 3RLZA 1A75B 1ZOTB 3O6BA 1UWOA 3TDUA 3OX6A 5AFPA 1QV1A 1UURA 1DJHA 4YGCB 1XFZO 3CWGA 4HRHA 1PULA 1QX7A 1ZMZA 2F8PA 3M0WA 4CFQA 1QIWA 5J3XA 1QXPA 1PSBA 4P2YB 1C7VA 1DTLA 2P6BB 1TTXA 3CR4X 3IQQA 2JTTA 3TS5C 2KAVA 5CSJA 2BECA 3AAJA 2KBMA 2K7CA 4MZLA 1BU3A 1SL7A 2EGDA 4GGNA 2L0PA 4NDBA 2NXQA 1AP4A 3VROA 1G4YR 2BCAA 3TUYB 1WRKA 2PASA 4PE1A 1XFYO 1JWDA 1TNWA 1DJWA 2BKHB 1MXLC 2LCPA 4A4CA 3ZWHA 1QX5B 1BG1A 1OZSA 1BJFA 1XFWO 2LUXA 2ZN9A 1LA0A 4FTGA 1DMOA 2ZNDA 4L9MA 2AUCA 2JXLA 1AUIB 3EK7A 1S3PA 1Y1UA 1CDMA 1RTP1 1QLSA 2L5XB 2BKIB 2LP3A 1WLZA 5BPJA 2LHLA 3TZ1A 3DF0A 2PRUA 1FI5A 1A4PA 1WRLA 3SG5A 2I94A 4OVNF 1D1OA 2NCPA 2A4JA 5DKNA 3PN7C 1KSMA 4YBHB 2JZIA 2M97A 1HT9A 1UUSA 3LLEA 2ZFDA 1YRTB 2JXCA 1OMVA 1XFXO 2PVBA 3I5HB 1JC2A 1SL8A 4MEWA 2EC6C 5CSFA 1LKJA 2BBNA 2BCXA 1B8LA 1AK8A 1OE9B 1CFDA 3KO0A 2KFGA 4ETOA 1DJZA 1S26D 1LVCD 2MLEC 4YI8A 4YRUA 2LVKA 2F3ZA 4MRXA 1F71A 1CMGA 3K21A 2WC8A 3ICBA 2MLFC 5HKWA 1BODA 1M31A 1QVIY 2TN4A 3DVKA 2PSRA 3EKHA 3BXKA 1HQVA 1S5GY 2GGMA 2KGRA 1XK4A 3FWCA 1MUXA 1NCZA 1CLBA 1K95A 1UHNA 2B1UA 2WORA 1OQPA 3PN7B 3QRXA 2V53A 3I5GC 2Q4UA 1J7RA 5HLVA 1OMRA 3PFVA 3DVMA 3FIAA 1QX2A 5D7FA 1NX0A 2QACA 4ORCB 2EC6B 3DVEA 1BR1B 1PK0D 1K90D 1QATA 4P5OE 1U5IA 3LL8B 3WXAA 1BMOA 1NIWA 1TNXA 4GGFA 4CIDA 1BR4B 4N1FA 1G8IA 1QJTA 3PM8A 3I5FB 2MA2A 3F45A 1N65A 1RFJA 1WDCC 1JF0A 2NCOA 3C1VA 2ISDA 1XK4C 1QVIZ 4C0JA 3TDIA 3VRNA 1CLLA 2SCPA 3PALA 4E68A 3BUNB 1IRJA 1SL9A 2KBIA 2LUCA 1MQ1A 4U8DA 2WCBA 1FW4A 3OP0A 2LMTA 1KSOA 1S1EA 2MRDA 1YVLA 4AOMA 1BT6A 2CXJA 5KTYA 3I5GB 3PLFB 2WCFA 1MWNA 3MSEB 4MN0A 2GGZA 2BL0B 1CFPA 1DF0B 2I7AA 1Y6WA 1CFCA 1L2OB 1XA5A 2JULA 3GK2A 1S6JA 1CDNA 1R6PA 4DS7A 2M49B 3EVRA 5TNCA 4FQOA 1K94A 2BE6A 1N2DA 2AAOA 3CZTX 2HQ8A 2JNFA 4MBEA 4GPLB 1IQ3A 2FCEA 1UP5A 2M1UA 3RM1A 4PALA 3D0YA 5B8IB 1OMDA 1CLMA 2KYFA 4I5LB 4NQGA 2WCEA 4I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KWO C;  1M39 A;  1GJY A;  2LAP A;  3IQO A;  1LIN A;  3FWB A;  1JUO A;  2JC2 A;  4N1G A;  2Y5I A;  2D8N A;  1J55 A;  3I5I B;  2ZRS A;  3CLN A;  1ZAC A;  5I2O A;  2BCB A;  3E3R A;  2M9G A;  1EXR A;  2NLN A;  2F3Y A;  3CGA A;  3EVU A;  2QPT A;  2NZ0 A;  1KQM B;  1CMF A;  1PVA A;  5ER5 A;  5I2Q A;  4NDC A;  1UHH A;  2LVI A;  4USL A;  4ZCV A;  4PHK A;  1C7W A;  5ER4 X;  2HF5 A;  1CDL A;  1C07 A;  3H4S E;  2LE9 B;  1KFX L;  4OCI A;  4XJK B;  1BOC A;  1CNP A;  1B1G A;  4C0L A;  1TNP A;  2ZNE A;  2LHI A;  1PAL A;  1A03 A;  4PE0 A;  1OOJ A;  1AJ5 A;  2KI6 D;  4N5X A;  5CSN A;  1YUT A;  2LLT A;  3OX5 A;  1SCV A;  5HLO A;  1KK8 C;  1WRZ A;  2OTG C;  4TNC A;  3EK8 A;  3TS5 B;  1PVB A;  1Y1A A;  5HYD A;  1F4O A;  5IBW A;  2KAY A;  4CFR A;  1IQ5 A;  1KK7 Y;  3JVT C;  1TOP A;  1B7T Y;  1K9K A;  2M29 A;  3WHT B;  3D10 A;  3O4Y A;  4F0Z B;  1CFF A;  1YX7 A;  2JT3 A;  3JTD C;  2OS8 C;  2KHN A;  1NPQ A;  1QTX A;  1GGZ A;  1ZUZ A;  5GQQ C;  3BUX B;  1IH0 A;  2CT9 A;  1K8U A;  3BUM B;  3NXA A;  4PCW A;  4JQ0 D;  3VGO A;  2KI6 C;  2ZKM X;  2EHB A;  2JTZ A;  3OB1 B;  4PE7 A;  3LK1 A;  3HX4 A;  2I18 A;  2KSP A;  2MJW B;  2O60 A;  4C0K A;  1KK8 B;  1F4Q A;  2CNP A;  1EG4 A;  2KFF A;  1CB1 A;  1SY9 A;  1MHO A;  5HKY A;  1SBJ A;  1SCM C;  1KK7 Z;  5JOL A;  1REC A;  1B7T Z;  2JWW A;  2JNX A;  3SG4 A;  3SIB A;  4BY4 A;  1RRO A;  3JVT B;  5KU1 A;  2HET A;  1B9A A;  2L50 A;  4MSP A;  2M3W A;  2M8U A;  4DCK A;  4PE4 A;  3BOW A;  1B4C A;  2M0R A;  2AMI A;  1DJI A;  2OS8 B;  3OB2 B;  4HRG A;  1KFX S;  2KNE A;  4PHM A;  1YVH A;  2MHH A;  1W7J B;  3SG3 A;  2JT0 A;  2KI4 C;  2G9B A;  4MRY A;  5PAL A;  1CDP A;  3PAT A;  3IF7 A;  1YUU A;  2LV7 A;  2K7O A;  2CTN A;  2JU0 A;  2L4H A;  2JPT A;  1A75 A;  5D69 A;  3DF0 B;  2OPO A;  4QJ5 B;  4GFT A;  1SPY A;  3TDZ A;  1EJ3 A;  1QLK A;  1DVI A;  1S36 A;  1VRK A;  2GV5 A;  2L51 A;  3GK4 X;  1W7I B;  2O5G A;  3EVV A;  1FI6 A;  1UHI A;  1XFV O;  1TNQ A;  2DOQ A;  3BQ3 A;  3O2P A;  4GNK B;  1JBA A;  2L4I A;  1E8A A;  2L98 A;  2KQ6 A;  3OHM B;  4PHJ A;  2FJU B;  1JFK A;  2M1K B;  2KGB C;  3BUO B;  3VRP A;  3VRQ A;  2Q91 A;  1IJ5 A;  2MBX A;  2IS9 A;  2FOT A;  2K2F A;  4GGF C;  1YR5 A;  1OZO A;  1YRU B;  4YGE B;  4AQI A;  1RK9 A;  3A4U B;  1SNL A;  1SR6 C;  3CTN A;  4MVF A;  3PSR A;  1RJV A;  2LC5 A;  2KI4 B;  1QIV A;  3WNX B;  2F2O A;  1NX1 A;  3EKJ A;  1SK6 D;  1FF1 A;  4WRI A;  1WDC B;  5JJG A;  1NUB A;  3EK4 A;  3AAK A;  1KFU L;  5HKZ A;  3SIA A;  5F6T A;  1YUR A;  2LM5 A;  1UHJ A;  3CS1 A;  2KOT A;  1YTZ C;  3KF9 A;  3O78 A;  1PRW A;  2KDH A;  4YGD B;  1DJY A;  2M7N A;  4YGA A;  4OV2 A;  2KYC A;  4XYN A;  1DJX A;  1K93 D;  2PAL A;  1DGV A;  1N0Y A;  1Y1X A;  3DD4 A;  1B47 A;  4PHN A;  1U5I B;  4NDD A;  1J7Q A;  1B8C A;  2CCM A;  1QAS A;  4CPV A;  2BE4 A;  2K7B A;  1SRA A;  4MZJ A;  1FPW A;  1MXE A;  5AEQ A;  1KCY A;  1V1F A;  3LCP C;  1M46 A;  1YX8 A;  1SR6 B;  1JSA A;  5AER A;  1NCY A;  3KPX A;  2LLS A;  4R1E A;  2LVV A;  4GUK A;  5CPV A;  1F8H A;  3BUW B;  2HPS A;  2HQW A;  5I8N A;  2K2A A;  1JFJ A;  2M7L A;  2KQY A;  4HRE E;  3NSL A;  1KWO B;  4YI9 A;  1X02 A;  2JQ6 A;  2K61 A;  1EG3 A;  1IGV A;  1GGW A;  3WHU B;  1J7O A;  1NYA A;  1IJ6 A;  2JT8 A;  1XO5 A;  2F33 A;  3A8R A;  1TIZ A;  2JOJ A;  1F55 A;  1LXF C;  2LVJ A;  2WOS A;  3AKB A;  2K7D A;  5K89 A;  4CLN A;  2R2I A;  1SYM A;  1CKK A;  4OKH A;  4MLW A;  5AXI A;  3KHE A;  1WY9 A;  3I5H C;  1H4B A;  2I2R E;  4DRW A;  3D0Y B;  1Q80 A;  1FBV A;  2PMY A;  2LP2 A;  1CM1 A;  2LAN A;  5KSZ A;  1ALV A;  1MF8 B;  4WQ3 A;  2JRF A;  4Q04 A;  1NX2 A;  3LK0 A;  2LMV A;  1KFU S;  2KFH A;  1YUS A;  2LNK A;  3DVJ A;  1M63 B;  3SJS A;  1J7P A;  4GAO A;  4I5N B;  3AKA A;  2MAZ A;  1F70 A;  3NSI A;  2F2P A;  1CTR A;  1IWQ A;  5FYX A;  4ZCU A;  2OTG B;  3NSK A;  1ZFS A;  1L7Z A;  2ZN8 A;  1DT7 B;  1JF2 A;  5DKQ A;  1J1D A;  1R2U A;  1TCO B;  2Y1M A;  3JTD B;  4M2O A;  4ORB B;  1TRF A;  1IKU A;  4MZK A;  2G2B A;  3NSO A;  1A29 A;  2E6W A;  1AHR A;  1TN4 A;  4AQJ A;  1SW8 A;  1RWY A;  1DF0 A;  3I5F C;  4JPZ B;  4DUQ A;  1BF5 A;  3HCM A;  3GOF A;  1H8B A;  1PSR A;  1Y0V H;  4JWQ A;  5CSI A;  3SG2 A;  1K2H A;  1XYD A;  1S6C A;  4WQ2 A;  4DIR A;  4I5K A;  1EL4 A;  1NWD A;  3BYA A;  3CR2 A;  1K96 A;  4HSZ A;  1UHK A;  4D1E A;  1J1E A;  2H61 A;  2K8M B;  1NP8 A;  5DKR A;  1NSH A;  1QS7 A;  1IG5 A;  4ORA B;  3ZNI A;  4BY5 A;  4UPG A;  1K9P A;  1M45 A;  1SCM B;  2BL0 C;  2ZRT A;  2Y1N A;  4QJ4 B;  1DGU A;  1SKT A;  4ICB A;  1L2O C;  3FS7 A;  2Y4Q A;  1LA3 A;  2L2E A;  1F54 A;  1WLM A;  2CBL A;  1QV0 A;  2H2K A;  5AAN A;  1SMG A;  1CM4 A;  4YGB B;  2KAX A;  1TCF A;  1AJ4 A;  2H61 C;  3CR5 X;  1S6I A;  1V1G A;  3SG7 A;  4GBA A;  1EH2 A;  3VRR A;  1B8R A;  1ODB A;  2E30 A;  1KQV A;  4XJK A;  1S5G Z;  3GK1 A;  4A4B A;  1GQM A;  3I5I C;  1A2X A;  4M2P A;  4PDZ A;  4M2Q A;  2BBM A;  2COL B;  2LLU A;  4OR9 B;  1BLQ A;  1AVS A;  1NCX A;  1NX3 A;  1ALW A;  2LMU A;  4IL1 A;  1DJG A;  1KQM C;  3BOW B;  3SG6 A;  2WND A;  1K9U A;  1XFU O;  3TUY C;  2SAS A;  4QJ3 B;  1XVJ A;  1OSA A;  2K0J A;  2RGI A;  3KEV A;  2VRG A;  5G08 A;  5I2L A;  1MR8 A;  2FCD A;  1G33 A;  3RLZ A;  1A75 B;  1ZOT B;  3O6B A;  1UWO A;  3TDU A;  3OX6 A;  5AFP A;  1QV1 A;  1UUR A;  1DJH A;  4YGC B;  1XFZ O;  3CWG A;  4HRH A;  1PUL A;  1QX7 A;  1ZMZ A;  2F8P A;  3M0W A;  4CFQ A;  1QIW A;  5J3X A;  1QXP A;  1PSB A;  4P2Y B;  1C7V A;  1DTL A;  2P6B B;  1TTX A;  3CR4 X;  3IQQ A;  2JTT A;  3TS5 C;  2KAV A;  5CSJ A;  2BEC A;  3AAJ A;  2KBM A;  2K7C A;  4MZL A;  1BU3 A;  1SL7 A;  2EGD A;  4GGN A;  2L0P A;  4NDB A;  2NXQ A;  1AP4 A;  3VRO A;  1G4Y R;  2BCA A;  3TUY B;  1WRK A;  2PAS A;  4PE1 A;  1XFY O;  1JWD A;  1TNW A;  1DJW A;  2BKH B;  1MXL C;  2LCP A;  4A4C A;  3ZWH A;  1QX5 B;  1BG1 A;  1OZS A;  1BJF A;  1XFW O;  2LUX A;  2ZN9 A;  1LA0 A;  4FTG A;  1DMO A;  2ZND A;  4L9M A;  2AUC A;  2JXL A;  1AUI B;  3EK7 A;  1S3P A;  1Y1U A;  1CDM A;  1RTP 1;  1QLS A;  2L5X B;  2BKI B;  2LP3 A;  1WLZ A;  5BPJ A;  2LHL A;  3TZ1 A;  3DF0 A;  2PRU A;  1FI5 A;  1A4P A;  1WRL A;  3SG5 A;  2I94 A;  4OVN F;  1D1O A;  2NCP A;  2A4J A;  5DKN A;  3PN7 C;  1KSM A;  4YBH B;  2JZI A;  2M97 A;  1HT9 A;  1UUS A;  3LLE A;  2ZFD A;  1YRT B;  2JXC A;  1OMV A;  1XFX O;  2PVB A;  3I5H B;  1JC2 A;  1SL8 A;  4MEW A;  2EC6 C;  5CSF A;  1LKJ A;  2BBN A;  2BCX A;  1B8L A;  1AK8 A;  1OE9 B;  1CFD A;  3KO0 A;  2KFG A;  4ETO A;  1DJZ A;  1S26 D;  1LVC D;  2MLE C;  4YI8 A;  4YRU A;  2LVK A;  2F3Z A;  4MRX A;  1F71 A;  1CMG A;  3K21 A;  2WC8 A;  3ICB A;  2MLF C;  5HKW A;  1BOD A;  1M31 A;  1QVI Y;  2TN4 A;  3DVK A;  2PSR A;  3EKH A;  3BXK A;  1HQV A;  1S5G Y;  2GGM A;  2KGR A;  1XK4 A;  3FWC A;  1MUX A;  1NCZ A;  1CLB A;  1K95 A;  1UHN A;  2B1U A;  2WOR A;  1OQP A;  3PN7 B;  3QRX A;  2V53 A;  3I5G C;  2Q4U A;  1J7R A;  5HLV A;  1OMR A;  3PFV A;  3DVM A;  3FIA A;  1QX2 A;  5D7F A;  1NX0 A;  2QAC A;  4ORC B;  2EC6 B;  3DVE A;  1BR1 B;  1PK0 D;  1K90 D;  1QAT A;  4P5O E;  1U5I A;  3LL8 B;  3WXA A;  1BMO A;  1NIW A;  1TNX A;  4GGF A;  4CID A;  1BR4 B;  4N1F A;  1G8I A;  1QJT A;  3PM8 A;  3I5F B;  2MA2 A;  3F45 A;  1N65 A;  1RFJ A;  1WDC C;  1JF0 A;  2NCO A;  3C1V A;  2ISD A;  1XK4 C;  1QVI Z;  4C0J A;  3TDI A;  3VRN A;  1CLL A;  2SCP A;  3PAL A;  4E68 A;  3BUN B;  1IRJ A;  1SL9 A;  2KBI A;  2LUC A;  1MQ1 A;  4U8D A;  2WCB A;  1FW4 A;  3OP0 A;  2LMT A;  1KSO A;  1S1E A;  2MRD A;  1YVL A;  4AOM A;  1BT6 A;  2CXJ A;  5KTY A;  3I5G B;  3PLF B;  2WCF A;  1MWN A;  3MSE B;  4MN0 A;  2GGZ A;  2BL0 B;  1CFP A;  1DF0 B;  2I7A A;  1Y6W A;  1CFC A;  1L2O B;  1XA5 A;  2JUL A;  3GK2 A;  1S6J A;  1CDN A;  1R6P A;  4DS7 A;  2M49 B;  3EVR A;  5TNC A;  4FQO A;  1K94 A;  2BE6 A;  1N2D A;  2AAO A;  3CZT X;  2HQ8 A;  2JNF A;  4MBE A;  4GPL B;  1IQ3 A;  2FCE A;  1UP5 A;  2M1U A;  3RM1 A;  4PAL A;  3D0Y A;  5B8I B;  1OMD A;  1CLM A;  2KYF A;  4I5L B;  4NQG A;  2WCE A;  4I5J A; 
#chains in the Genus database with same CATH topology
 1KWO C;  1M39 A;  1GJY A;  2LAP A;  3IQO A;  1DC1 A;  1LIN A;  3FWB A;  1JUO A;  2JC2 A;  4N1G A;  2Y5I A;  2BNX A;  2D8N A;  1J55 A;  4INW A;  3I5I B;  2ZRS A;  3CLN A;  1ZAC A;  5I2O A;  2BCB A;  3E3R A;  2M9G A;  1EXR A;  2NLN A;  2F3Y A;  4PT1 A;  3CGA A;  3EVU A;  2QPT A;  2NZ0 A;  1KQM B;  5FI7 A;  1PVA A;  1CMF A;  5ER5 A;  3B86 A;  5I2Q A;  4NDC A;  1UHH A;  1DEK A;  2LVI A;  4USL A;  4ZCV A;  4PHK A;  1C7W A;  5ER4 X;  2HF5 A;  1CDL A;  3K1E A;  1C07 A;  3H4S E;  2LE9 B;  1KFX L;  4OCI A;  4XJK B;  1BOC A;  1CNP A;  1B1G A;  4C0L A;  1TNP A;  2P70 A;  2ZNE A;  2LHI A;  1PAL A;  1A03 A;  4PE0 A;  1OOJ A;  3OBV A;  1AJ5 A;  3CYZ A;  2KI6 D;  4N5X A;  5CSN A;  1YUT A;  2LLT A;  3OX5 A;  1SCV A;  5HLO A;  1KK8 C;  1WRZ A;  2OTG C;  5D3O A;  3SS4 A;  4TNC A;  3EK8 A;  3TS5 B;  1PVB A;  1Y1A A;  5HYD A;  1F4O A;  5IBW A;  2KAY A;  4CFR A;  1IQ5 A;  1KK7 Y;  3JVT C;  1TOP A;  1B7T Y;  1K9K A;  2M29 A;  3WHT B;  3D10 A;  3O4Y A;  4F0Z B;  3EG5 B;  1CFF A;  1YX7 A;  2JT3 A;  1TUZ A;  3JTD C;  5HL1 A;  1OW4 A;  2OS8 C;  2KHN A;  1QWV A;  1NPQ A;  1QTX A;  1GGZ A;  1ZUZ A;  5GQQ C;  3BUX B;  2KPH A;  1IH0 A;  1W9Z A;  2CT9 A;  1K8U A;  3BUM B;  3NXA A;  4PCW A;  4JQ0 D;  1P28 A;  3VGO A;  2KI6 C;  2ZKM X;  2EHB A;  2JTZ A;  3OB1 B;  4PE7 A;  2QEV A;  3LK1 A;  3HX4 A;  2I18 A;  3D78 A;  2KSP A;  2MJW B;  2O60 A;  4C0K A;  1KK8 B;  1F4Q A;  2CNP A;  1EG4 A;  2KFF A;  1CB1 A;  1SY9 A;  1MHO A;  5HKY A;  1SBJ A;  1SCM C;  1KK7 Z;  5JOL A;  1REC A;  1B7T Z;  2JWW A;  2JNX A;  3SG4 A;  3SIB A;  4BY4 A;  1RRO A;  3JVT B;  5KU1 A;  2HET A;  1B9A A;  2L50 A;  3DZT A;  4MSP A;  2M3W A;  2M8U A;  4DCK A;  4PE4 A;  3BOW A;  1B4C A;  3L4A A;  2M0R A;  2AMI A;  1DJI A;  2OS8 B;  3OB2 B;  4HRG A;  1KFX S;  2KNE A;  2QEB A;  4PHM A;  1YVH A;  2MHH A;  1W7J B;  3BJH A;  3SG3 A;  2JT0 A;  2KI4 C;  2G9B A;  4MRY A;  3OGN A;  5PAL A;  1CDP A;  3PAT A;  3IF7 A;  1YUU A;  2LV7 A;  2K7O A;  2CTN A;  2JU0 A;  2YGU A;  2L4H A;  2JPT A;  1A75 A;  3D76 A;  3R1V A;  5D69 A;  3DF0 B;  2OPO A;  3S0E A;  4QJ5 B;  4GFT A;  1SPY A;  3TDZ A;  1EJ3 A;  1QLK A;  1DVI A;  1S36 A;  1VRK A;  2GV5 A;  2L51 A;  3GK4 X;  1W7I B;  2O5G A;  3EVV A;  1FI6 A;  1UHI A;  1XFV O;  1TNQ A;  2DOQ A;  2QDI A;  3BQ3 A;  3O2P A;  4GNK B;  1JBA A;  2L4I A;  1E8A A;  2L98 A;  2KQ6 A;  3OHM B;  4PHJ A;  2FJU B;  1JFK A;  2M1K B;  2KGB C;  1XFR A;  3BUO B;  3VRP A;  3VRQ A;  2Q91 A;  3UO9 A;  1IJ5 A;  2MBX A;  2IS9 A;  2FOT A;  2K2F A;  4GGF C;  1YR5 A;  1OZO A;  1YRU B;  4YGE B;  4AQI A;  1RK9 A;  3D73 A;  3A4U B;  4JKT A;  1SNL A;  1SR6 C;  3CTN A;  4MVF A;  3PSR A;  2GTE A;  1RJV A;  2LC5 A;  2KI4 B;  1QIV A;  3WNX B;  2F2O A;  1NX1 A;  3S0A A;  3EKJ A;  1SK6 D;  1FF1 A;  4WRI A;  1WDC B;  5JJG A;  1NUB A;  3EK4 A;  3AAK A;  1KFU L;  3BFA A;  5HKZ A;  3SIA A;  2PQL A;  5F6T A;  1YUR A;  2LM5 A;  3CZ2 A;  4IJ7 A;  1UHJ A;  1DQE A;  3CS1 A;  2KOT A;  1YTZ C;  3KF9 A;  3O78 A;  1PRW A;  2KDH A;  4YGD B;  1DJY A;  2M7N A;  4YGA A;  1KCY A;  4OV2 A;  2KYC A;  4XYN A;  1DJX A;  1K93 D;  2PAL A;  1DGV A;  1N0Y A;  1Y1X A;  3DD4 A;  1B47 A;  4PHN A;  2QEO A;  2BAP A;  1U5I B;  4NDD A;  1J7Q A;  1B8C A;  2CCM A;  1QAS A;  4CPV A;  2BE4 A;  2K7B A;  1SRA A;  4MZJ A;  3V2L A;  1MXE A;  3DXL A;  3QME A;  5AEQ A;  1V1F A;  3LCP C;  1M46 A;  1YX8 A;  1SR6 B;  3FE9 A;  5AER A;  1NCY A;  3KPX A;  2LLS A;  4R1E A;  1JSA A;  2LVV A;  2L2C A;  4GUK A;  5CPV A;  1F8H A;  3NHI A;  3S0F A;  3BUW B;  2HPS A;  2HQW A;  5I8N A;  2K2A A;  1JFJ A;  2M7L A;  5FI6 A;  2KQY A;  4HRE E;  3NSL A;  1KWO B;  4YI9 A;  1X02 A;  2JQ6 A;  2K61 A;  1EG3 A;  1IGV A;  1GGW A;  3WHU B;  1J7O A;  1NYA A;  1IJ6 A;  2JT8 A;  3S0G A;  1XO5 A;  2F33 A;  2JPO A;  1TIZ A;  3A8R A;  2JOJ A;  3VB1 A;  1F55 A;  1LXF C;  2LVJ A;  2WOS A;  1OOF A;  3AKB A;  2K7D A;  5K89 A;  4CLN A;  2R2I A;  2L5Y A;  1SYM A;  2WCM A;  1CKK A;  4OKH A;  4MLW A;  5AXI A;  3KHE A;  1WY9 A;  3I5H C;  1H4B A;  4F7F A;  1TUJ A;  2I2R E;  4DRW A;  3D0Y B;  1Q80 A;  1FBV A;  2PMY A;  2LP2 A;  1CM1 A;  3UNW A;  2LAN A;  5KSZ A;  1ALV A;  1MF8 B;  3IVT A;  3R72 A;  4WQ3 A;  2JRF A;  4Q04 A;  1GM0 A;  1NX2 A;  2WCK A;  3LK0 A;  2LMV A;  1KFU S;  1Z2C B;  2ERB A;  2KFH A;  2WC5 A;  1YUS A;  2LNK A;  3DVJ A;  1M63 B;  3SJS A;  1J7P A;  5DIC A;  4GAO A;  4I5N B;  3AKA A;  2MAZ A;  1F70 A;  3NSI A;  2F2P A;  1CTR A;  1IWQ A;  5FYX A;  3L4L A;  4ZCU A;  2OTG B;  1Z4H A;  3DYE A;  4JD9 A;  3NSK A;  1ZFS A;  1L7Z A;  2ZN8 A;  1DT7 B;  1JF2 A;  5DKQ A;  1J1D A;  1R2U A;  1TCO B;  2Y1M A;  3JTD B;  4M2O A;  4ORB B;  1TRF A;  1IKU A;  4MZK A;  2G2B A;  3NSO A;  1A29 A;  2E6W A;  1AHR A;  1TN4 A;  4AQJ A;  1SW8 A;  1RWY A;  1DF0 A;  3I5F C;  4JPZ B;  4DUQ A;  1BF5 A;  3HCM A;  3GOF A;  1H8B A;  1PSR A;  1Y0V H;  4JWQ A;  5CSI A;  3SG2 A;  1K2H A;  1XYD A;  3N7H A;  1S6C A;  4WQ2 A;  4DIR A;  4I5K A;  1EL4 A;  1NWD A;  3BYA A;  3CR2 A;  1K96 A;  4HSZ A;  1UHK A;  4INX A;  4D1E A;  1J1E A;  2H61 A;  2K8M B;  1NP8 A;  1IIO A;  5DKR A;  1NSH A;  1QS7 A;  1IG5 A;  1OOI X;  4ORA B;  3ZNI A;  4BY5 A;  4UPG A;  1K9P A;  1M45 A;  1SCM B;  2BL0 C;  2ZRT A;  3PJI A;  2Y1N A;  4QJ4 B;  1DGU A;  1SKT A;  4ICB A;  1L2O C;  1C3Y A;  1C3Z A;  2Y4Q A;  2WCJ A;  3FS7 A;  1LA3 A;  2L2E A;  1F54 A;  1WLM A;  2CBL A;  1QV0 A;  2H2K A;  5AAN A;  3DY9 A;  1SMG A;  1CM4 A;  4YGB B;  3B87 A;  2KAX A;  1TCF A;  1AJ4 A;  2H61 C;  1ORG A;  3CR5 X;  3S0B A;  1S6I A;  1V1G A;  3SG7 A;  4GBA A;  1EH2 A;  3VRR A;  1B8R A;  1ODB A;  2E30 A;  1KQV A;  4XJK A;  1S5G Z;  3GK1 A;  4A4B A;  1GQM A;  3I5I C;  1A2X A;  4M2P A;  4PDZ A;  4M2Q A;  2BBM A;  2COL B;  2LLU A;  2K60 A;  4OR9 B;  1BLQ A;  1AVS A;  1NCX A;  1NX3 A;  1ALW A;  2LMU A;  4IL1 A;  1DJG A;  1KQM C;  3BOW B;  3SG6 A;  2WND A;  1K9U A;  2PYQ A;  1XFU O;  3TUY C;  2SAS A;  4QJ3 B;  1XVJ A;  1OSA A;  2K0J A;  2RGI A;  3KEV A;  2VRG A;  5G08 A;  5I2L A;  3BFB A;  5I94 A;  1MR8 A;  3Q8I A;  2FCD A;  1G33 A;  3RLZ A;  1A75 B;  1ZOT B;  3O6B A;  1UWO A;  3TDU A;  3OX6 A;  5AFP A;  1QV1 A;  1UUR A;  1DJH A;  4YGC B;  1XFZ O;  3CWG A;  4HRH A;  1PUL A;  1QX7 A;  1ZMZ A;  2F8P A;  3M0W A;  4CFQ A;  1T14 A;  1QIW A;  5J3X A;  1QXP A;  1PSB A;  4P2Y B;  1C7V A;  1DTL A;  2P6B B;  1TTX A;  3CR4 X;  1OOG A;  3CZ1 A;  2JTT A;  3IQQ A;  3TS5 C;  3B6X A;  2KAV A;  5CSJ A;  2BEC A;  3AAJ A;  2KBM A;  2K7C A;  4MZL A;  1BU3 A;  1SL7 A;  2EGD A;  4GGN A;  2L0P A;  4NDB A;  2NXQ A;  1AP4 A;  3VRO A;  3L47 A;  1G4Y R;  2BCA A;  3TUY B;  1WRK A;  2PAS A;  4PE1 A;  1XFY O;  1JWD A;  1TNW A;  1DJW A;  2BKH B;  1MXL C;  2LCP A;  4A4C A;  3ZWH A;  1QX5 B;  1BG1 A;  1OZS A;  1BJF A;  1XFW O;  2LUX A;  2ZN9 A;  1LA0 A;  3CDN A;  4FTG A;  1DMO A;  2ZND A;  4L9M A;  2AUC A;  2JXL A;  1AUI B;  3EK7 A;  1S3P A;  1Y1U A;  1CDM A;  1RTP 1;  1QLS A;  2L5X B;  2FJY A;  2QEH A;  2BKI B;  3SS5 A;  2LP3 A;  1WLZ A;  5BPJ A;  2LHL A;  3TZ1 A;  3DF0 A;  3NHT A;  2PRU A;  1FI5 A;  1A4P A;  4FQT A;  1WRL A;  3SG5 A;  2I94 A;  3S0D A;  4OVN F;  3B7A A;  3NGV A;  2WCL A;  1D1O A;  2NCP A;  2A4J A;  5DKN A;  3PN7 C;  1KSM A;  4YBH B;  2JZI A;  2M97 A;  4OZD A;  1HT9 A;  1UUS A;  3LLE A;  2ZFD A;  1YRT B;  2JXC A;  1OMV A;  1XFX O;  2PVB A;  3I5H B;  1JC2 A;  1SL8 A;  4MEW A;  2EC6 C;  1SSE B;  5CSF A;  1LKJ A;  2BBN A;  2BCX A;  1B8L A;  5EL2 A;  1OE9 B;  1CFD A;  3KO0 A;  1AK8 A;  2KFG A;  4ETO A;  1DJZ A;  1S26 D;  1LVC D;  2MLE C;  4YI8 A;  4YRU A;  2LVK A;  2F3Z A;  4MRX A;  1F71 A;  1CMG A;  3K21 A;  2WC8 A;  3ICB A;  2MLF C;  3PM2 A;  5HKW A;  1BOD A;  1M31 A;  1QVI Y;  2H8V A;  5FI2 A;  2TN4 A;  2KLD A;  3DVK A;  2PSR A;  3EKH A;  3BXK A;  3O4X A;  1LS8 A;  1HQV A;  1S5G Y;  2GGM A;  2KGR A;  1XK4 A;  3FWC A;  1MUX A;  1NCZ A;  1CLB A;  1K95 A;  1UHN A;  2B1U A;  2WOR A;  1OQP A;  3PN7 B;  3QRX A;  2V53 A;  3I5G C;  2Q4U A;  1J7R A;  5HLV A;  3D77 A;  1OMR A;  3PFV A;  3SS3 A;  3DVM A;  3FIA A;  1QX2 A;  5D7F A;  1NX0 A;  2QAC A;  1DEL A;  4ORC B;  2WCH A;  1FPW A;  2EC6 B;  3DVE A;  1BR1 B;  1PK0 D;  1K90 D;  1QAT A;  4P5O E;  1U5I A;  3LL8 B;  3WXA A;  1BMO A;  1NIW A;  1TNX A;  4GGF A;  4CID A;  1BR4 B;  4N1F A;  1G8I A;  1QJT A;  2WC6 A;  3PM8 A;  3BFH A;  3CZ0 A;  1OOH A;  2MA2 A;  3I5F B;  3F45 A;  1N65 A;  1RFJ A;  1WDC C;  1JF0 A;  2NCO A;  3C1V A;  2ISD A;  1XK4 C;  3FE6 A;  1QVI Z;  3FE8 A;  3CAB A;  4C0J A;  3TDI A;  3R1O A;  3VRN A;  1CLL A;  2SCP A;  3PAL A;  4E68 A;  3BUN B;  1IRJ A;  1SL9 A;  2KBI A;  2LUC A;  1MQ1 A;  4U8D A;  2WCB A;  1FW4 A;  4KYN A;  3OP0 A;  1TWO A;  1KSO A;  1S1E A;  2LMT A;  2MRD A;  1YVL A;  4AOM A;  1BT6 A;  2CXJ A;  3RZS A;  5KTY A;  3I5G B;  3PLF B;  2WCF A;  1MWN A;  3MSE B;  4MN0 A;  2GGZ A;  2BL0 B;  1CFP A;  1DF0 B;  2I7A A;  1Y6W A;  3D74 A;  1L2O B;  1XA5 A;  1CFC A;  2JUL A;  3GK2 A;  1S6J A;  1CDN A;  1R6P A;  2KLE A;  4DS7 A;  2P71 A;  3R1P A;  2M49 B;  3EVR A;  5TNC A;  4FQO A;  1K94 A;  2BE6 A;  1N2D A;  2AAO A;  3B88 A;  2HQ8 A;  2JNF A;  3CZT X;  4GPL B;  4MBE A;  1IQ3 A;  2FCE A;  1UP5 A;  2M1U A;  3D75 A;  4PAL A;  3RM1 A;  3D0Y A;  5B8I B;  1OMD A;  1CLM A;  2KYF A;  4I5L B;  4NQG A;  2WCE A;  4I5J A; 
#chains in the Genus database with same CATH homology
 1KWO C;  1M39 A;  1GJY A;  2LAP A;  3IQO A;  1LIN A;  3FWB A;  1JUO A;  2JC2 A;  4N1G A;  2Y5I A;  2D8N A;  1J55 A;  3I5I B;  2ZRS A;  3CLN A;  1ZAC A;  5I2O A;  2BCB A;  3E3R A;  2M9G A;  1EXR A;  2NLN A;  2F3Y A;  3CGA A;  3EVU A;  2QPT A;  2NZ0 A;  1KQM B;  1CMF A;  1PVA A;  5ER5 A;  5I2Q A;  4NDC A;  1UHH A;  2LVI A;  4USL A;  4ZCV A;  4PHK A;  1C7W A;  5ER4 X;  2HF5 A;  1CDL A;  1C07 A;  3H4S E;  2LE9 B;  1KFX L;  4OCI A;  4XJK B;  1BOC A;  1CNP A;  1B1G A;  4C0L A;  1TNP A;  2ZNE A;  2LHI A;  1PAL A;  1A03 A;  4PE0 A;  1OOJ A;  1AJ5 A;  2KI6 D;  4N5X A;  5CSN A;  1YUT A;  2LLT A;  3OX5 A;  1SCV A;  5HLO A;  1KK8 C;  1WRZ A;  2OTG C;  4TNC A;  3EK8 A;  3TS5 B;  1PVB A;  1Y1A A;  5HYD A;  1F4O A;  5IBW A;  2KAY A;  4CFR A;  1IQ5 A;  1KK7 Y;  3JVT C;  1TOP A;  1B7T Y;  1K9K A;  2M29 A;  3WHT B;  3D10 A;  3O4Y A;  4F0Z B;  1CFF A;  1YX7 A;  2JT3 A;  3JTD C;  2OS8 C;  2KHN A;  1NPQ A;  1QTX A;  1GGZ A;  1ZUZ A;  5GQQ C;  3BUX B;  1IH0 A;  2CT9 A;  1K8U A;  3BUM B;  3NXA A;  4PCW A;  4JQ0 D;  3VGO A;  2KI6 C;  2ZKM X;  2EHB A;  2JTZ A;  3OB1 B;  4PE7 A;  3LK1 A;  3HX4 A;  2I18 A;  2KSP A;  2MJW B;  2O60 A;  4C0K A;  1KK8 B;  1F4Q A;  2CNP A;  1EG4 A;  2KFF A;  1CB1 A;  1SY9 A;  1MHO A;  5HKY A;  1SBJ A;  1SCM C;  1KK7 Z;  5JOL A;  1REC A;  1B7T Z;  2JWW A;  2JNX A;  3SG4 A;  3SIB A;  4BY4 A;  1RRO A;  3JVT B;  5KU1 A;  2HET A;  1B9A A;  2L50 A;  4MSP A;  2M3W A;  2M8U A;  4DCK A;  4PE4 A;  3BOW A;  1B4C A;  2M0R A;  2AMI A;  1DJI A;  2OS8 B;  3OB2 B;  4HRG A;  1KFX S;  2KNE A;  4PHM A;  1YVH A;  2MHH A;  1W7J B;  3SG3 A;  2JT0 A;  2KI4 C;  2G9B A;  4MRY A;  5PAL A;  1CDP A;  3PAT A;  3IF7 A;  1YUU A;  2LV7 A;  2K7O A;  2CTN A;  2JU0 A;  2L4H A;  2JPT A;  1A75 A;  5D69 A;  3DF0 B;  2OPO A;  4QJ5 B;  4GFT A;  1SPY A;  3TDZ A;  1EJ3 A;  1QLK A;  1DVI A;  1S36 A;  1VRK A;  2GV5 A;  2L51 A;  3GK4 X;  1W7I B;  2O5G A;  3EVV A;  1FI6 A;  1UHI A;  1XFV O;  1TNQ A;  2DOQ A;  3BQ3 A;  3O2P A;  4GNK B;  1JBA A;  2L4I A;  1E8A A;  2L98 A;  2KQ6 A;  3OHM B;  4PHJ A;  2FJU B;  1JFK A;  2M1K B;  2KGB C;  3BUO B;  3VRP A;  3VRQ A;  2Q91 A;  1IJ5 A;  2MBX A;  2IS9 A;  2FOT A;  2K2F A;  4GGF C;  1YR5 A;  1OZO A;  1YRU B;  4YGE B;  4AQI A;  1RK9 A;  3A4U B;  1SNL A;  1SR6 C;  3CTN A;  4MVF A;  3PSR A;  1RJV A;  2LC5 A;  2KI4 B;  1QIV A;  3WNX B;  2F2O A;  1NX1 A;  3EKJ A;  1SK6 D;  1FF1 A;  4WRI A;  1WDC B;  5JJG A;  1NUB A;  3EK4 A;  3AAK A;  1KFU L;  5HKZ A;  3SIA A;  5F6T A;  1YUR A;  2LM5 A;  1UHJ A;  3CS1 A;  2KOT A;  1YTZ C;  3KF9 A;  3O78 A;  1PRW A;  2KDH A;  4YGD B;  1DJY A;  2M7N A;  4YGA A;  4OV2 A;  2KYC A;  4XYN A;  1DJX A;  1K93 D;  2PAL A;  1DGV A;  1N0Y A;  1Y1X A;  3DD4 A;  1B47 A;  4PHN A;  1U5I B;  4NDD A;  1J7Q A;  1B8C A;  2CCM A;  1QAS A;  4CPV A;  2BE4 A;  2K7B A;  1SRA A;  4MZJ A;  1FPW A;  1MXE A;  5AEQ A;  1KCY A;  1V1F A;  3LCP C;  1M46 A;  1YX8 A;  1SR6 B;  1JSA A;  5AER A;  1NCY A;  3KPX A;  2LLS A;  4R1E A;  2LVV A;  4GUK A;  5CPV A;  1F8H A;  3BUW B;  2HPS A;  2HQW A;  5I8N A;  2K2A A;  1JFJ A;  2M7L A;  2KQY A;  4HRE E;  3NSL A;  1KWO B;  4YI9 A;  1X02 A;  2JQ6 A;  2K61 A;  1EG3 A;  1IGV A;  1GGW A;  3WHU B;  1J7O A;  1NYA A;  1IJ6 A;  2JT8 A;  1XO5 A;  2F33 A;  3A8R A;  1TIZ A;  2JOJ A;  1F55 A;  1LXF C;  2LVJ A;  2WOS A;  3AKB A;  2K7D A;  5K89 A;  4CLN A;  2R2I A;  1SYM A;  1CKK A;  4OKH A;  4MLW A;  5AXI A;  3KHE A;  1WY9 A;  3I5H C;  1H4B A;  2I2R E;  4DRW A;  3D0Y B;  1Q80 A;  1FBV A;  2PMY A;  2LP2 A;  1CM1 A;  2LAN A;  5KSZ A;  1ALV A;  1MF8 B;  4WQ3 A;  2JRF A;  4Q04 A;  1NX2 A;  3LK0 A;  2LMV A;  1KFU S;  2KFH A;  1YUS A;  2LNK A;  3DVJ A;  1M63 B;  3SJS A;  1J7P A;  4GAO A;  4I5N B;  3AKA A;  2MAZ A;  1F70 A;  3NSI A;  2F2P A;  1CTR A;  1IWQ A;  5FYX A;  4ZCU A;  2OTG B;  3NSK A;  1ZFS A;  1L7Z A;  2ZN8 A;  1DT7 B;  1JF2 A;  5DKQ A;  1J1D A;  1R2U A;  1TCO B;  2Y1M A;  3JTD B;  4M2O A;  4ORB B;  1TRF A;  1IKU A;  4MZK A;  2G2B A;  3NSO A;  1A29 A;  2E6W A;  1AHR A;  1TN4 A;  4AQJ A;  1SW8 A;  1RWY A;  1DF0 A;  3I5F C;  4JPZ B;  4DUQ A;  1BF5 A;  3HCM A;  3GOF A;  1H8B A;  1PSR A;  1Y0V H;  4JWQ A;  5CSI A;  3SG2 A;  1K2H A;  1XYD A;  1S6C A;  4WQ2 A;  4DIR A;  4I5K A;  1EL4 A;  1NWD A;  3BYA A;  3CR2 A;  1K96 A;  4HSZ A;  1UHK A;  4D1E A;  1J1E A;  2H61 A;  2K8M B;  1NP8 A;  5DKR A;  1NSH A;  1QS7 A;  1IG5 A;  4ORA B;  3ZNI A;  4BY5 A;  4UPG A;  1K9P A;  1M45 A;  1SCM B;  2BL0 C;  2ZRT A;  2Y1N A;  4QJ4 B;  1DGU A;  1SKT A;  4ICB A;  1L2O C;  3FS7 A;  2Y4Q A;  1LA3 A;  2L2E A;  1F54 A;  1WLM A;  2CBL A;  1QV0 A;  2H2K A;  5AAN A;  1SMG A;  1CM4 A;  4YGB B;  2KAX A;  1TCF A;  1AJ4 A;  2H61 C;  3CR5 X;  1S6I A;  1V1G A;  3SG7 A;  4GBA A;  1EH2 A;  3VRR A;  1B8R A;  1ODB A;  2E30 A;  1KQV A;  4XJK A;  1S5G Z;  3GK1 A;  4A4B A;  1GQM A;  3I5I C;  1A2X A;  4M2P A;  4PDZ A;  4M2Q A;  2BBM A;  2COL B;  2LLU A;  4OR9 B;  1BLQ A;  1AVS A;  1NCX A;  1NX3 A;  1ALW A;  2LMU A;  4IL1 A;  1DJG A;  1KQM C;  3BOW B;  3SG6 A;  2WND A;  1K9U A;  1XFU O;  3TUY C;  2SAS A;  4QJ3 B;  1XVJ A;  1OSA A;  2K0J A;  2RGI A;  3KEV A;  2VRG A;  5G08 A;  5I2L A;  1MR8 A;  2FCD A;  1G33 A;  3RLZ A;  1A75 B;  1ZOT B;  3O6B A;  1UWO A;  3TDU A;  3OX6 A;  5AFP A;  1QV1 A;  1UUR A;  1DJH A;  4YGC B;  1XFZ O;  3CWG A;  4HRH A;  1PUL A;  1QX7 A;  1ZMZ A;  2F8P A;  3M0W A;  4CFQ A;  1QIW A;  5J3X A;  1QXP A;  1PSB A;  4P2Y B;  1C7V A;  1DTL A;  2P6B B;  1TTX A;  3CR4 X;  3IQQ A;  2JTT A;  3TS5 C;  2KAV A;  5CSJ A;  2BEC A;  3AAJ A;  2KBM A;  2K7C A;  4MZL A;  1BU3 A;  1SL7 A;  2EGD A;  4GGN A;  2L0P A;  4NDB A;  2NXQ A;  1AP4 A;  3VRO A;  1G4Y R;  2BCA A;  3TUY B;  1WRK A;  2PAS A;  4PE1 A;  1XFY O;  1JWD A;  1TNW A;  1DJW A;  2BKH B;  1MXL C;  2LCP A;  4A4C A;  3ZWH A;  1QX5 B;  1BG1 A;  1OZS A;  1BJF A;  1XFW O;  2LUX A;  2ZN9 A;  1LA0 A;  4FTG A;  1DMO A;  2ZND A;  4L9M A;  2AUC A;  2JXL A;  1AUI B;  3EK7 A;  1S3P A;  1Y1U A;  1CDM A;  1RTP 1;  1QLS A;  2L5X B;  2BKI B;  2LP3 A;  1WLZ A;  5BPJ A;  2LHL A;  3TZ1 A;  3DF0 A;  2PRU A;  1FI5 A;  1A4P A;  1WRL A;  3SG5 A;  2I94 A;  4OVN F;  1D1O A;  2NCP A;  2A4J A;  5DKN A;  3PN7 C;  1KSM A;  4YBH B;  2JZI A;  2M97 A;  1HT9 A;  1UUS A;  3LLE A;  2ZFD A;  1YRT B;  2JXC A;  1OMV A;  1XFX O;  2PVB A;  3I5H B;  1JC2 A;  1SL8 A;  4MEW A;  2EC6 C;  5CSF A;  1LKJ A;  2BBN A;  2BCX A;  1B8L A;  1AK8 A;  1OE9 B;  1CFD A;  3KO0 A;  2KFG A;  4ETO A;  1DJZ A;  1S26 D;  1LVC D;  2MLE C;  4YI8 A;  4YRU A;  2LVK A;  2F3Z A;  4MRX A;  1F71 A;  1CMG A;  3K21 A;  2WC8 A;  3ICB A;  2MLF C;  5HKW A;  1BOD A;  1M31 A;  1QVI Y;  2TN4 A;  3DVK A;  2PSR A;  3EKH A;  3BXK A;  1HQV A;  1S5G Y;  2GGM A;  2KGR A;  1XK4 A;  3FWC A;  1MUX A;  1NCZ A;  1CLB A;  1K95 A;  1UHN A;  2B1U A;  2WOR A;  1OQP A;  3PN7 B;  3QRX A;  2V53 A;  3I5G C;  2Q4U A;  1J7R A;  5HLV A;  1OMR A;  3PFV A;  3DVM A;  3FIA A;  1QX2 A;  5D7F A;  1NX0 A;  2QAC A;  4ORC B;  2EC6 B;  3DVE A;  1BR1 B;  1PK0 D;  1K90 D;  1QAT A;  4P5O E;  1U5I A;  3LL8 B;  3WXA A;  1BMO A;  1NIW A;  1TNX A;  4GGF A;  4CID A;  1BR4 B;  4N1F A;  1G8I A;  1QJT A;  3PM8 A;  3I5F B;  2MA2 A;  3F45 A;  1N65 A;  1RFJ A;  1WDC C;  1JF0 A;  2NCO A;  3C1V A;  2ISD A;  1XK4 C;  1QVI Z;  4C0J A;  3TDI A;  3VRN A;  1CLL A;  2SCP A;  3PAL A;  4E68 A;  3BUN B;  1IRJ A;  1SL9 A;  2KBI A;  2LUC A;  1MQ1 A;  4U8D A;  2WCB A;  1FW4 A;  3OP0 A;  2LMT A;  1KSO A;  1S1E A;  2MRD A;  1YVL A;  4AOM A;  1BT6 A;  2CXJ A;  5KTY A;  3I5G B;  3PLF B;  2WCF A;  1MWN A;  3MSE B;  4MN0 A;  2GGZ A;  2BL0 B;  1CFP A;  1DF0 B;  2I7A A;  1Y6W A;  1CFC A;  1L2O B;  1XA5 A;  2JUL A;  3GK2 A;  1S6J A;  1CDN A;  1R6P A;  4DS7 A;  2M49 B;  3EVR A;  5TNC A;  4FQO A;  1K94 A;  2BE6 A;  1N2D A;  2AAO A;  3CZT X;  2HQ8 A;  2JNF A;  4MBE A;  4GPL B;  1IQ3 A;  2FCE A;  1UP5 A;  2M1U A;  3RM1 A;  4PAL A;  3D0Y A;  5B8I B;  1OMD A;  1CLM A;  2KYF A;  4I5L B;  4NQG A;  2WCE A;  4I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...