2KFFA

Structure of the c-terminal domain of ehd1 with fnyestnpftak
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain-containing protein 1
publication title Structural insight into the interaction of proteins containing NPF, DPF, and GPF motifs with the C-terminal EH-domain of EHD1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2kffA00
2CNPA 3PATA 1TTXA 5DKQA 1F4QA 1QS7A 2TN4A 3WXAA 1OE9B 1B8LA 2OPOA 2K2FA 2GV5A 4ZCVA 1NPQA 5I2QA 1B7TY 2BBNA 1JUOA 1M39A 2JQ6A 3VRPA 1F4OA 1S6CA 3RM1A 1CDNA 3CR5X 2EC6B 1NCYA 2EC6C 3VRRA 1JBAA 5AANA 2V53A 1MUXA 1OSAA 1CDLA 1S26D 2MBXA 4ETOA 3AAJA 1N2DA 1ALVA 5G08A 1J1EA 3OB1B 5PALA 2K7OA 3BQ3A 1SMGA 1B4CA 2LVJA 1YUSA 2K2AA 1SNLA 1A4PA 1Y1XA 2B1UA 1F55A 5FYXA 3SIAA 1PRWA 2K61A 2LP3A 1OZSA 2ZRTA 3BUMB 3C1VA 2COLB 3JTDB 5J3XA 3TDUA 5JJGA 4NDCA 1EXRA 3DF0A 4YGDB 2JOJA 2CT9A 4L9MA 2OS8B 2K8MB 1DJXA 1IG5A 1NCZA 2KYCA 1SCMB 4NDBA 1SCMC 1M63B 1MWNA 4DCKA 2MHHA 1J7QA 2SASA 4PALA 1EJ3A 3CS1A 1TOPA 2F8PA 2F33A 2LMTA 1ALWA 1DJGA 1GQMA 4C0LA 1CLBA 1XFYO 5GQQC 3CR2A 5D69A 4D1EA 2KYFA 2LC5A 1FF1A 3I5FB 1K9UA 3I5FC 3LCPC 1UHNA 1BG1A 2LHIA 3CWGA 1CMFA 1F54A 5CSFA 2KFGA 2KFFA 1K95A 1DJHA 2M9GA 1OZOA 3TUYC 1KWOB 1KFXL 2JRFA 1KFXS 2I94A 1A03A 1TNWA 4I5JA 4HSZA 3AKBA 5AXIA 1BOCA 1XYDA 3ZNIA 1SL8A 3KF9A 1DF0A 2FCEA 1TNPA 3SG7A 3NXAA 2K7CA 1QTXA 2KI6D 3OX5A 1FI5A 1Y1UA 3IQOA 2MRDA 4A4BA 3NSOA 1RECA 3KO0A 3MSEB 1K8UA 4GUKA 4I5LB 3OHMB 1MXLC 1QVIZ 1SL7A 4OV2A 3FIAA 4HRGA 2GGZA 1SK6D 4CPVA 2Y5IA 1QJTA 4MRYA 4BY4A 2HPSA 5CSIA 1U5IA 4XYNA 3BOWB 1TRFA 1N65A 1TNQA 2QPTA 1ZUZA 4QJ4B 4PE1A 1SR6B 1TN4A 1SR6C 3FWBA 2G9BA 4Q04A 2WCEA 1PULA 2BKIB 2JT3A 2L51A 4M2QA 2M97A 3D10A 2EGDA 2JWWA 3CGAA 1B7TZ 1NCXA 4MN0A 3TS5B 3I5GB 3TS5C 3I5GC 4AQJA 2JXLA 1CDMA 4MVFA 3WHUB 1DT7B 4I5NB 5HKWA 1SBJA 2KHNA 4YGBB 1CB1A 1QX2A 2Y1MA 3EKJA 4XJKB 2CCMA 3PALA 1PK0D 2KFHA 1FBVA 3CTNA 3D0YA 4MBEA 1IGVA 1KK8B 1QIWA 1KK8C 2I18A 2KQYA 1S6IA 2SCPA 1SYMA 4ICBA 3EKHA 1NYAA 1LA3A 1R2UA 3OP0A 4N1FA 1MXEA 3O78A 2L0PA 3SG2A 2ISDA 5CSJA 1WY9A 1AJ5A 1H4BA 1K9KA 1AVSA 5K89A 1K2HA 3EK7A 1UHJA 5I2LA 2WCFA 5KTYA 1AP4A 2LLTA 1NSHA 1X02A 3RLZA 2MJWB 3KHEA 1PALA 5ER5A 1CNPA 1DF0B 2FOTA 4C0JA 4YBHB 4ZCUA 2M1KB 1QASA 3LLEA 2PSRA 1FI6A 2LNKA 1PSRA 2VRGA 4WQ2A 3BOWA 4C0KA 1CLMA 1F8HA 2E6WA 4ORBB 2I7AA 2MA2A 1GGWA 1NX2A 3TDZA 2E30A 1M45A 1MHOA 1HT9A 2BBMA 4R1EA 1LA0A 4ORAB 1J7RA 2M7LA 1BJFA 3GOFA 2LUXA 1YURA 1JF0A 1U5IB 1OMDA 1PVBA 1GJYA 1K94A 2LM5A 2ZN8A 3O6BA 3SG5A 1WRLA 2JPTA 2MLFC 3GK1A 1NP8A 1XO5A 1DVIA 2OTGC 2OTGB 3IQQA 1WRKA 2WORA 4XJKA 1CFPA 1EL4A 1B8CA 4AOMA 2IS9A 2I2RE 5HYDA 4JQ0D 4PE0A 2AAOA 1MR8A 4DIRA 1RROA 2CXJA 4CIDA 2KAYA 4HREE 1S6JA 1DJWA 2ZFDA 2O60A 2ZN9A 1IWQA 3PFVA 1OMVA 2LANA 3E3RA 3A4UB 5DKRA 4QJ5B 3CLNA 3EVRA 1L7ZA 2M1UA 5BPJA 3TUYB 2K7DA 1FW4A 3SG6A 1DJIA 2DOQA 4DRWA 2Q4UA 4P5OE 5AEQA 3I5IB 3SIBA 3I5IC 3D0YB 1DMOA 1IJ6A 2BE4A 2EHBA 2H2KA 4OCIA 1BMOA 1UP5A 1KQVA 1G33A 4GGNA 1KFUL 3HX4A 1KSMA 1KFUS 4P2YB 2FJUB 2M0RA 2O5GA 3BYAA 3AKAA 4GPLB 1GGZA 2LMUA 2LV7A 1DGUA 1QIVA 1BLQA 1QLKA 3PLFB 1NX0A 3SG3A 2LLSA 4PHMA 4ORCB 1AJ4A 2PMYA 1R6PA 1C7VA 3NSIA 1LKJA 4YRUA 3SG4A 1ZACA 1AUIB 2FCDA 2K7BA 1WDCB 1WDCC 1S3PA 2JT8A 3LK0A 2JNXA 2NCOA 1TIZA 1DJZA 2L2EA 1NIWA 5JOLA 2NCPA 3KPXA 1AHRA 2KOTA 4GGFC 1YUUA 5I8NA 3ICBA 2R2IA 1CFDA 3OB2B 3BUWB 4MZJA 1S36A 2KAVA 2JTZA 4YGAA 5AFPA 2MLEC 2BL0B 2BL0C 2KSPA 5HKYA 1W7IB 1Y0VH 3DD4A 3CR4X 1QATA 1BU3A 3VRQA 2JU0A 2Y4QA 3VRNA 1D1OA 2HQWA 1KK7Y 2M29A 1DTLA 2NZ0A 2KI6C 2PALA 1KSOA 1UHHA 4OKHA 4YGCB 3EVUA 1A29A 5CPVA 3WHTB 1BR4B 1W7JB 2WCBA 3OX6A 1A75B 3F45A 4GFTA 4BY5A 4FTGA 3EVVA 4OVNF 1HQVA 2HETA 1OOJA 1SCVA 1C07A 1RFJA 3BUNB 3GK4X 3FS7A 2KNEA 4CFRA 5IBWA 2LVIA 1YR5A 1K93D 1QV0A 2KDHA 2M7NA 1SRAA 1YUTA 2ZNEA 3QRXA 1K96A 4WRIA 4A4CA 2LHLA 1BT6A 3I5HB 3I5HC 2HQ8A 2ZKMX 5F6TA 2LUCA 4I5KA 5I2OA 1C7WA 1CTRA 3EK8A 2NLNA 4GNKB 4JWQA 3BUXB 1CKKA 4PE7A 1OQPA 1SKTA 4GGFA 3KEVA 5AERA 1JFJA 5ER4X 5B8IB 2P6BB 1F71A 1VRKA 1XA5A 1XFVO 2JULA 4MZLA 4PHJA 3TDIA 1LXFC 2K0JA 1S5GY 2Q91A 1UHIA 1YVHA 1PVAA 2KBMA 2QACA 4PE4A 4TNCA 1A2XA 1B47A 1YVLA 1XFXO 1XK4A 2JC2A 1S1EA 1NWDA 1XFWO 4U8DA 1BF5A 4M2PA 1MF8B 1N0YA 5CSNA 1NX3A 2KGBC 2LVKA 1RWYA 1BODA 1B8RA 4F0ZB 1ZMZA 1DJYA 2M3WA 2LCPA 1UUSA 2JNFA 2L4IA 2HF5A 2L50A 3PSRA 3IF7A 2AMIA 2BE6A 2G2BA 1J1DA 2H61C 2PASA 2Y1NA 3NSKA 2JT0A 3H4SE 2WC8A 1FPWA 4YI8A 4USLA 2F3YA 3BXKA 1RK9A 1QV1A 3JTDC 1EH2A 1A75A 1CM1A 4IL1A 2OS8C 2L98A 2LLUA 5KSZA 4PCWA 4N5XA 1Q80A 1H8BA 1YRTB 1YX7A 1BR1B 3DVMA 3SJSA 1NX1A 1JSAA 1DGVA 1K9PA 1V1FA 2RGIA 1YX8A 2ZRSA 4JPZB 4FQOA 4MZKA 3JVTB 4M2OA 3JVTC 4AQIA 1TNXA 1SW8A 1JFKA 3A8RA 1ODBA 1B1GA 2LVVA 2WNDA 2ZNDA 1NUBA 1XFUO 1Y1AA 1SL9A 4MRXA 2BECA 4WQ3A 2M49B 1CLLA 4NQGA 1QX7A 4HRHA 2LP2A 4UPGA 1JF2A 1MQ1A 2L4HA 2F2PA 3LK1A 2KBIA 1RJVA 3TZ1A 3O2PA 1IQ3A 4PDZA 1KWOC 2M8UA 2AUCA 3VGOA 4E68A 4CFQA 5TNCA 1KK7Z 1WLZA 2D8NA 2F3ZA 3DVJA 3GK2A 4N1GA 1YTZC 5D7FA 1AK8A 1CDPA 1QX5B 3WNXB 2BCBA 1E8AA 1QLSA 3PN7C 3PN7B 1XVJA 2GGMA 3BUOB 2CTNA 1XFZO 1B9AA 1ZOTB 3PM8A 1EG3A 1OMRA 5DKNA 4PHNA 1K90D 1SPYA 1CFCA 4NDDA 1F70A 1IRJA 1G4YR 2L5XB 5KU1A 5HKZA 3CZTX 3ZWHA 2H61A 4MEWA 4MSPA 1M46A 2BCXA 2BKHB 4PHKA 1CM4A 3EK4A 4GAOA 4YI9A 1J7PA 1XK4C 1JC2A 4DUQA 2F2OA 3HCMA 2JZIA 1YRUB 1KCYA 1Y6WA 2BCAA 1V1GA 2JXCA 1G8IA 2PRUA 2CBLA 2A4JA 2KI4B 2KI4C 1WRZA 3FWCA 1IQ5A 1SY9A 2LE9B 3VROA 2NXQA 1CMGA 1IH0A 1WLMA 3DF0B 1UURA 2WOSA 3NSLA 1J7OA 1S5GZ 2KQ6A 5HLOA 1LVCD 1M31A 1IJ5A 3AAKA 1TCFA 2LAPA 4CLNA 4MLWA 1L2OB 1KQMB 1L2OC 1KQMC 1PSBA 2KAXA 4DS7A 1QVIY 3DVKA 4OR9B 4YGEB 1JWDA 4GBAA 1TCOB 1RTP1 1ZFSA 2MAZA 1IKUA 1UWOA 1J55A 2LMVA 2PVBA 3M0WA 3LL8B 3O4YA 1EG4A 2KGRA 1UHKA 3K21A 4QJ3B 1LINA 5HLVA 1CFFA 2JTTA 3DVEA 1QXPA
chains in the Genus database with same CATH superfamily
2CNPA 3PATA 1TTXA 5DKQA 1F4QA 1QS7A 2TN4A 2QEBA 3WXAA 1OE9B 1B8LA 2OPOA 5I94A 2K2FA 2WCKA 3S0EA 2GV5A 4ZCVA 1NPQA 5I2QA 1B7TY 2BBNA 1JUOA 1M39A 2JQ6A 3IVTA 3VRPA 1F4OA 1S6CA 3RM1A 1CDNA 3CR5X 2EC6B 1NCYA 2EC6C 1LS8A 3VRRA 1JBAA 5AANA 2V53A 1MUXA 1OSAA 1CDLA 1S26D 2MBXA 4ETOA 3AAJA 1N2DA 1ALVA 5G08A 1J1EA 2BAPA 3OB1B 5PALA 2K7OA 3BQ3A 1SMGA 3NHTA 1B4CA 2LVJA 1YUSA 2K2AA 1SNLA 1A4PA 2WCJA 1Y1XA 2B1UA 3R1OA 5FYXA 1F55A 3SIAA 1PRWA 2K61A 2LP3A 1OZSA 2ZRTA 3BUMB 3C1VA 2COLB 3JTDB 3PM2A 5J3XA 3TDUA 4NDCA 1EXRA 3DF0A 4YGDB 2JOJA 2CT9A 4L9MA 2OS8B 2K8MB 1DJXA 1IG5A 1NCZA 2KYCA 1SCMB 4NDBA 1SCMC 1M63B 1OOIX 1MWNA 3CABA 4DCKA 1TUJA 2MHHA 1J7QA 2SASA 3S0FA 4PALA 1EJ3A 3CS1A 1TOPA 1TWOA 2F8PA 2F33A 2QEOA 2LMTA 1ALWA 1DJGA 1GQMA 4C0LA 3D75A 1XFYO 5GQQC 3L4LA 3CR2A 5D69A 4D1EA 2KYFA 1CLBA 2LC5A 1FF1A 3FE6A 3I5FB 1K9UA 3I5FC 3LCPC 1UHNA 1BG1A 2LHIA 3CWGA 3QMEA 1CMFA 1F54A 5CSFA 2KFGA 2KFFA 3Q8IA 1K95A 4KYNA 1DJHA 2M9GA 1OZOA 3TUYC 1KWOB 1KFXL 2JRFA 1KFXS 2I94A 1A03A 1TNWA 4I5JA 4HSZA 3AKBA 5AXIA 1BOCA 1XYDA 3ZNIA 1SL8A 3KF9A 1DF0A 2FCEA 1TNPA 3SS3A 3SG7A 3NXAA 3CZ2A 2K7CA 1QTXA 2KI6D 3OX5A 1FI5A 1Y1UA 3IQOA 2MRDA 4A4BA 1C3YA 2WC5A 3NSOA 1RECA 3KO0A 3MSEB 1K8UA 2BNXA 3DYEA 4GUKA 4INWA 4I5LB 3CZ1A 3OHMB 1MXLC 1QVIZ 1SL7A 4OV2A 3FIAA 4HRGA 2GGZA 1SK6D 4CPVA 2Y5IA 1QJTA 4MRYA 4BY4A 2QEVA 2HPSA 5CSIA 1U5IA 4XYNA 3B86A 3UNWA 3BOWB 2GTEA 1OOFA 1TRFA 1N65A 1TNQA 2QPTA 1ZUZA 4QJ4B 4PE1A 1SR6B 1TN4A 1SR6C 3FWBA 2G9BA 4Q04A 2WCEA 1PULA 2BKIB 2JT3A 2L51A 4M2QA 3BFHA 2M97A 3D10A 2EGDA 2JWWA 3CGAA 1B7TZ 1C3ZA 1NCXA 4MN0A 3TS5B 3I5GB 3TS5C 3I5GC 4AQJA 2JXLA 3B88A 1CDMA 4MVFA 3WHUB 1DT7B 4I5NB 5HKWA 1SBJA 2KHNA 4YGBB 3S0GA 1CB1A 3V2LA 2KLEA 2H8VA 1QX2A 2Y1MA 3EKJA 4XJKB 2CCMA 3PALA 1PK0D 2KFHA 3PJIA 1FBVA 3CTNA 2KPHA 2ERBA 3D0YA 4MBEA 1IGVA 1KK8B 1QIWA 1KK8C 2I18A 2KQYA 1S6IA 2SCPA 1SYMA 3EG5B 4PT1A 4ICBA 3EKHA 1NYAA 1LA3A 1R2UA 3OP0A 4N1FA 1DELA 1MXEA 2L0PA 3O78A 3SG2A 2ISDA 5CSJA 1WY9A 1AJ5A 1H4BA 1K9KA 1AVSA 5K89A 2PQLA 1K2HA 3EK7A 1UHJA 5I2LA 2P71A 2WCFA 3N7HA 5JJGA 5KTYA 1AP4A 5FI6A 3R1PA 2LLTA 1NSHA 1X02A 3RLZA 2MJWB 3KHEA 1PALA 5ER5A 1CNPA 1DF0B 2FOTA 4C0JA 4YBHB 4ZCUA 2M1KB 1QASA 3LLEA 2WCHA 2PSRA 1FI6A 2LNKA 3S0BA 1PSRA 2VRGA 4WQ2A 3BOWA 4C0KA 1CLMA 1F8HA 2E6WA 4ORBB 3UO9A 2I7AA 2MA2A 1GGWA 1DQEA 1NX2A 1T14A 2E30A 3TDZA 1M45A 1MHOA 3B87A 1HT9A 2BBMA 4R1EA 1LA0A 4ORAB 1J7RA 2M7LA 1BJFA 3GOFA 3DZTA 2LUXA 1YURA 1JF0A 1U5IB 1OMDA 1PVBA 1GJYA 1K94A 2LM5A 2ZN8A 3O6BA 3FE8A 3SG5A 1WRLA 2JPTA 2MLFC 3GK1A 1NP8A 2WCMA 1XO5A 1DVIA 2OTGC 2OTGB 3IQQA 1WRKA 2WORA 4XJKA 1W9ZA 3SS4A 1CFPA 1EL4A 1B8CA 4AOMA 2IS9A 2I2RE 5HYDA 4JQ0D 4PE0A 2AAOA 1MR8A 4DIRA 1RROA 4FQTA 2CXJA 4CIDA 2KAYA 4HREE 1S6JA 1DJWA 2ZFDA 2O60A 2ZN9A 1IIOA 1IWQA 2YGUA 3BFAA 3PFVA 1OMVA 2LANA 3E3RA 3A4UB 5DKRA 4QJ5B 3CLNA 3EVRA 3D74A 1L7ZA 2JPOA 2M1UA 5EL2A 2QDIA 3TUYB 5BPJA 2K7DA 3NHIA 1FW4A 3SG6A 1DJIA 2DOQA 4DRWA 2Q4UA 4P5OE 5AEQA 3I5IB 3SIBA 3I5IC 1OW4A 3D0YB 1DMOA 1IJ6A 2BE4A 2EHBA 2H2KA 4OCIA 1BMOA 1SSEB 1UP5A 3FE9A 1KQVA 1G33A 3BJHA 5DICA 4GGNA 1KFUL 3HX4A 1KSMA 1KFUS 4P2YB 3CYZA 2FJUB 2KLDA 2M0RA 2O5GA 3AKAA 3BYAA 3K1EA 1GGZA 4GPLB 2LMUA 2LV7A 1DGUA 1QIVA 1BLQA 1QLKA 3PLFB 1NX0A 3SG3A 2LLSA 3L47A 4ORCB 4PHMA 1AJ4A 2PMYA 1R6PA 1C7VA 3NSIA 3DXLA 1LKJA 4YRUA 3SG4A 1ZACA 3R72A 4A4CA 1AUIB 2FCDA 2K7BA 1WDCB 3B7AA 1WDCC 1S3PA 2FJYA 2JT8A 3LK0A 2JNXA 2NCOA 1TIZA 1DJZA 2L2EA 1NIWA 5JOLA 2NCPA 3KPXA 1AHRA 2KOTA 4GGFC 1YUUA 5I8NA 3ICBA 2R2IA 1CFDA 3OB2B 5FI7A 2WC6A 3BUWB 4MZJA 5FI2A 1S36A 2KAVA 3SS5A 2JTZA 4YGAA 5AFPA 2MLEC 2BL0B 2BL0C 2KSPA 5HKYA 1W7IB 1Y0VH 3CZ0A 3DD4A 3CR4X 3OBVA 1QATA 1BU3A 3CDNA 3VRQA 2JU0A 2Y4QA 3VRNA 1D1OA 2HQWA 1KK7Y 2M29A 1DTLA 2NZ0A 2KI6C 2PALA 1KSOA 1UHHA 3S0AA 4OKHA 4YGCB 3EVUA 3D77A 5D3OA 1A29A 5CPVA 3WHTB 1BR4B 1W7JB 2WCBA 3OX6A 1A75B 3F45A 4GFTA 4BY5A 4FTGA 3DY9A 3EVVA 4OVNF 1QWVA 1HQVA 2HETA 1OOJA 1OOHA 1SCVA 1C07A 1RFJA 3BUNB 3GK4X 3FS7A 2KNEA 4CFRA 5IBWA 2LVIA 1Z2CB 1YR5A 1K93D 1QV0A 2KDHA 2M7NA 1SRAA 1YUTA 2ZNEA 3BFBA 1K96A 2PYQA 3D73A 3QRXA 4WRIA 1XFRA 2LHLA 1BT6A 3I5HB 3D76A 3I5HC 1GM0A 2HQ8A 2ZKMX 5F6TA 2LUCA 4I5KA 5I2OA 1C7WA 1CTRA 3EK8A 2NLNA 5HL1A 4GNKB 4JWQA 3BUXB 3R1VA 1CKKA 4PE7A 1OQPA 1SKTA 4GGFA 3KEVA 5AERA 1JFJA 5ER4X 2K60A 5B8IB 2P6BB 1F71A 1VRKA 1XA5A 1XFVO 2JULA 4MZLA 4OZDA 4PHJA 3TDIA 1LXFC 2K0JA 1S5GY 2Q91A 1UHIA 1YVHA 1PVAA 2KBMA 2QACA 4PE4A 4TNCA 1A2XA 1B47A 1YVLA 1XFXO 1XK4A 2JC2A 2WCLA 1S1EA 1NWDA 1XFWO 4U8DA 1BF5A 4M2PA 1MF8B 1N0YA 5CSNA 1NX3A 2KGBC 2LVKA 1RWYA 1BODA 1B8RA 4F0ZB 1ZMZA 1DJYA 2M3WA 2LCPA 1UUSA 2JNFA 2L4IA 2HF5A 2L50A 3PSRA 4INXA 3IF7A 2AMIA 2BE6A 2G2BA 1J1DA 2H61C 2PASA 2Y1NA 3NSKA 2JT0A 3H4SE 2WC8A 3S0DA 1FPWA 4YI8A 4USLA 1TUZA 2F3YA 3L4AA 3BXKA 1RK9A 1QV1A 3JTDC 1EH2A 4JD9A 1A75A 1CM1A 4IL1A 2OS8C 2L98A 2LLUA 5KSZA 4PCWA 4N5XA 1Q80A 1H8BA 1YRTB 1YX7A 1BR1B 3DVMA 3SJSA 1NX1A 1JSAA 1DC1A 1DGVA 1K9PA 1V1FA 2RGIA 1YX8A 3RZSA 2ZRSA 1P28A 4JPZB 4FQOA 4MZKA 3JVTB 4M2OA 2QEHA 3JVTC 4AQIA 1TNXA 1SW8A 1JFKA 3A8RA 1ODBA 1B1GA 2LVVA 2WNDA 2ZNDA 1NUBA 1XFUO 1Y1AA 1SL9A 4MRXA 2BECA 3D78A 2M49B 1CLLA 4WQ3A 4NQGA 1QX7A 4HRHA 2LP2A 4UPGA 1JF2A 1MQ1A 2L4HA 2F2PA 3LK1A 2KBIA 1RJVA 3TZ1A 3O2PA 1IQ3A 2L2CA 4PDZA 1KWOC 2M8UA 2AUCA 3VGOA 4E68A 4CFQA 5TNCA 1KK7Z 1WLZA 2D8NA 2F3ZA 3DVJA 3GK2A 4N1GA 1YTZC 5D7FA 1AK8A 1CDPA 1QX5B 3WNXB 2BCBA 1E8AA 1QLSA 1OOGA 3PN7C 1XVJA 2GGMA 3PN7B 3BUOB 2CTNA 1XFZO 1B9AA 1ZOTB 3PM8A 1EG3A 1OMRA 3B6XA 5DKNA 4PHNA 1K90D 1SPYA 1CFCA 4NDDA 1F70A 1IRJA 1G4YR 2L5XB 5KU1A 5HKZA 2L5YA 3CZTX 3ZWHA 2H61A 4MEWA 4MSPA 1M46A 2BCXA 2BKHB 4PHKA 1CM4A 3EK4A 4GAOA 4YI9A 1J7PA 1XK4C 1JC2A 1DEKA 4DUQA 2F2OA 3HCMA 4F7FA 2JZIA 1YRUB 1KCYA 1Y6WA 2BCAA 1V1GA 2JXCA 1G8IA 2PRUA 3VB1A 2CBLA 2A4JA 2KI4B 2KI4C 1WRZA 4IJ7A 3FWCA 3O4XA 1IQ5A 1SY9A 2LE9B 3VROA 3NGVA 1ORGA 2NXQA 1CMGA 1IH0A 1WLMA 3DF0B 1UURA 2WOSA 4JKTA 1Z4HA 3NSLA 1J7OA 1S5GZ 2KQ6A 5HLOA 1LVCD 1M31A 1IJ5A 3AAKA 1TCFA 2LAPA 4CLNA 4MLWA 1L2OB 1KQMB 1L2OC 1KQMC 1PSBA 2KAXA 4DS7A 1QVIY 3DVKA 4OR9B 4YGEB 1JWDA 4GBAA 1TCOB 1RTP1 1ZFSA 2MAZA 1IKUA 3OGNA 1UWOA 1J55A 2LMVA 2PVBA 3M0WA 3LL8B 3O4YA 2P70A 1EG4A 2KGRA 1UHKA 3K21A 4QJ3B 1LINA 5HLVA 1CFFA 2JTTA 3DVEA 1QXPA
chains in the Genus database with same CATH topology
2CNPA 3PATA 1TTXA 5DKQA 1F4QA 1QS7A 2TN4A 3WXAA 1OE9B 1B8LA 2OPOA 2K2FA 2GV5A 4ZCVA 1NPQA 5I2QA 1B7TY 2BBNA 1JUOA 1M39A 2JQ6A 3VRPA 1F4OA 1S6CA 3RM1A 1CDNA 3CR5X 2EC6B 1NCYA 2EC6C 3VRRA 1JBAA 5AANA 2V53A 1MUXA 1OSAA 1CDLA 1S26D 2MBXA 4ETOA 3AAJA 1N2DA 1ALVA 5G08A 1J1EA 3OB1B 5PALA 2K7OA 3BQ3A 1SMGA 1B4CA 2LVJA 1YUSA 2K2AA 1SNLA 1A4PA 1Y1XA 2B1UA 1F55A 5FYXA 3SIAA 1PRWA 2K61A 2LP3A 1OZSA 2ZRTA 3BUMB 3C1VA 2COLB 3JTDB 5J3XA 3TDUA 5JJGA 4NDCA 1EXRA 3DF0A 4YGDB 2JOJA 2CT9A 4L9MA 2OS8B 2K8MB 1DJXA 1IG5A 1NCZA 2KYCA 1SCMB 4NDBA 1SCMC 1M63B 1MWNA 4DCKA 2MHHA 1J7QA 2SASA 4PALA 1EJ3A 3CS1A 1TOPA 2F8PA 2F33A 2LMTA 1ALWA 1DJGA 1GQMA 4C0LA 1CLBA 1XFYO 5GQQC 3CR2A 5D69A 4D1EA 2KYFA 2LC5A 1FF1A 3I5FB 1K9UA 3I5FC 3LCPC 1UHNA 1BG1A 2LHIA 3CWGA 1CMFA 1F54A 5CSFA 2KFGA 2KFFA 1K95A 1DJHA 2M9GA 1OZOA 3TUYC 1KWOB 1KFXL 2JRFA 1KFXS 2I94A 1A03A 1TNWA 4I5JA 4HSZA 3AKBA 5AXIA 1BOCA 1XYDA 3ZNIA 1SL8A 3KF9A 1DF0A 2FCEA 1TNPA 3SG7A 3NXAA 2K7CA 1QTXA 2KI6D 3OX5A 1FI5A 1Y1UA 3IQOA 2MRDA 4A4BA 3NSOA 1RECA 3KO0A 3MSEB 1K8UA 4GUKA 4I5LB 3OHMB 1MXLC 1QVIZ 1SL7A 4OV2A 3FIAA 4HRGA 2GGZA 1SK6D 4CPVA 2Y5IA 1QJTA 4MRYA 4BY4A 2HPSA 5CSIA 1U5IA 4XYNA 3BOWB 1TRFA 1N65A 1TNQA 2QPTA 1ZUZA 4QJ4B 4PE1A 1SR6B 1TN4A 1SR6C 3FWBA 2G9BA 4Q04A 2WCEA 1PULA 2BKIB 2JT3A 2L51A 4M2QA 2M97A 3D10A 2EGDA 2JWWA 3CGAA 1B7TZ 1NCXA 4MN0A 3TS5B 3I5GB 3TS5C 3I5GC 4AQJA 2JXLA 1CDMA 4MVFA 3WHUB 1DT7B 4I5NB 5HKWA 1SBJA 2KHNA 4YGBB 1CB1A 1QX2A 2Y1MA 3EKJA 4XJKB 2CCMA 3PALA 1PK0D 2KFHA 1FBVA 3CTNA 3D0YA 4MBEA 1IGVA 1KK8B 1QIWA 1KK8C 2I18A 2KQYA 1S6IA 2SCPA 1SYMA 4ICBA 3EKHA 1NYAA 1LA3A 1R2UA 3OP0A 4N1FA 1MXEA 3O78A 2L0PA 3SG2A 2ISDA 5CSJA 1WY9A 1AJ5A 1H4BA 1K9KA 1AVSA 5K89A 1K2HA 3EK7A 1UHJA 5I2LA 2WCFA 5KTYA 1AP4A 2LLTA 1NSHA 1X02A 3RLZA 2MJWB 3KHEA 1PALA 5ER5A 1CNPA 1DF0B 2FOTA 4C0JA 4YBHB 4ZCUA 2M1KB 1QASA 3LLEA 2PSRA 1FI6A 2LNKA 1PSRA 2VRGA 4WQ2A 3BOWA 4C0KA 1CLMA 1F8HA 2E6WA 4ORBB 2I7AA 2MA2A 1GGWA 1NX2A 3TDZA 2E30A 1M45A 1MHOA 1HT9A 2BBMA 4R1EA 1LA0A 4ORAB 1J7RA 2M7LA 1BJFA 3GOFA 2LUXA 1YURA 1JF0A 1U5IB 1OMDA 1PVBA 1GJYA 1K94A 2LM5A 2ZN8A 3O6BA 3SG5A 1WRLA 2JPTA 2MLFC 3GK1A 1NP8A 1XO5A 1DVIA 2OTGC 2OTGB 3IQQA 1WRKA 2WORA 4XJKA 1CFPA 1EL4A 1B8CA 4AOMA 2IS9A 2I2RE 5HYDA 4JQ0D 4PE0A 2AAOA 1MR8A 4DIRA 1RROA 2CXJA 4CIDA 2KAYA 4HREE 1S6JA 1DJWA 2ZFDA 2O60A 2ZN9A 1IWQA 3PFVA 1OMVA 2LANA 3E3RA 3A4UB 5DKRA 4QJ5B 3CLNA 3EVRA 1L7ZA 2M1UA 5BPJA 3TUYB 2K7DA 1FW4A 3SG6A 1DJIA 2DOQA 4DRWA 2Q4UA 4P5OE 5AEQA 3I5IB 3SIBA 3I5IC 3D0YB 1DMOA 1IJ6A 2BE4A 2EHBA 2H2KA 4OCIA 1BMOA 1UP5A 1KQVA 1G33A 4GGNA 1KFUL 3HX4A 1KSMA 1KFUS 4P2YB 2FJUB 2M0RA 2O5GA 3BYAA 3AKAA 4GPLB 1GGZA 2LMUA 2LV7A 1DGUA 1QIVA 1BLQA 1QLKA 3PLFB 1NX0A 3SG3A 2LLSA 4PHMA 4ORCB 1AJ4A 2PMYA 1R6PA 1C7VA 3NSIA 1LKJA 4YRUA 3SG4A 1ZACA 1AUIB 2FCDA 2K7BA 1WDCB 1WDCC 1S3PA 2JT8A 3LK0A 2JNXA 2NCOA 1TIZA 1DJZA 2L2EA 1NIWA 5JOLA 2NCPA 3KPXA 1AHRA 2KOTA 4GGFC 1YUUA 5I8NA 3ICBA 2R2IA 1CFDA 3OB2B 3BUWB 4MZJA 1S36A 2KAVA 2JTZA 4YGAA 5AFPA 2MLEC 2BL0B 2BL0C 2KSPA 5HKYA 1W7IB 1Y0VH 3DD4A 3CR4X 1QATA 1BU3A 3VRQA 2JU0A 2Y4QA 3VRNA 1D1OA 2HQWA 1KK7Y 2M29A 1DTLA 2NZ0A 2KI6C 2PALA 1KSOA 1UHHA 4OKHA 4YGCB 3EVUA 1A29A 5CPVA 3WHTB 1BR4B 1W7JB 2WCBA 3OX6A 1A75B 3F45A 4GFTA 4BY5A 4FTGA 3EVVA 4OVNF 1HQVA 2HETA 1OOJA 1SCVA 1C07A 1RFJA 3BUNB 3GK4X 3FS7A 2KNEA 4CFRA 5IBWA 2LVIA 1YR5A 1K93D 1QV0A 2KDHA 2M7NA 1SRAA 1YUTA 2ZNEA 3QRXA 1K96A 4WRIA 4A4CA 2LHLA 1BT6A 3I5HB 3I5HC 2HQ8A 2ZKMX 5F6TA 2LUCA 4I5KA 5I2OA 1C7WA 1CTRA 3EK8A 2NLNA 4GNKB 4JWQA 3BUXB 1CKKA 4PE7A 1OQPA 1SKTA 4GGFA 3KEVA 5AERA 1JFJA 5ER4X 5B8IB 2P6BB 1F71A 1VRKA 1XA5A 1XFVO 2JULA 4MZLA 4PHJA 3TDIA 1LXFC 2K0JA 1S5GY 2Q91A 1UHIA 1YVHA 1PVAA 2KBMA 2QACA 4PE4A 4TNCA 1A2XA 1B47A 1YVLA 1XFXO 1XK4A 2JC2A 1S1EA 1NWDA 1XFWO 4U8DA 1BF5A 4M2PA 1MF8B 1N0YA 5CSNA 1NX3A 2KGBC 2LVKA 1RWYA 1BODA 1B8RA 4F0ZB 1ZMZA 1DJYA 2M3WA 2LCPA 1UUSA 2JNFA 2L4IA 2HF5A 2L50A 3PSRA 3IF7A 2AMIA 2BE6A 2G2BA 1J1DA 2H61C 2PASA 2Y1NA 3NSKA 2JT0A 3H4SE 2WC8A 1FPWA 4YI8A 4USLA 2F3YA 3BXKA 1RK9A 1QV1A 3JTDC 1EH2A 1A75A 1CM1A 4IL1A 2OS8C 2L98A 2LLUA 5KSZA 4PCWA 4N5XA 1Q80A 1H8BA 1YRTB 1YX7A 1BR1B 3DVMA 3SJSA 1NX1A 1JSAA 1DGVA 1K9PA 1V1FA 2RGIA 1YX8A 2ZRSA 4JPZB 4FQOA 4MZKA 3JVTB 4M2OA 3JVTC 4AQIA 1TNXA 1SW8A 1JFKA 3A8RA 1ODBA 1B1GA 2LVVA 2WNDA 2ZNDA 1NUBA 1XFUO 1Y1AA 1SL9A 4MRXA 2BECA 4WQ3A 2M49B 1CLLA 4NQGA 1QX7A 4HRHA 2LP2A 4UPGA 1JF2A 1MQ1A 2L4HA 2F2PA 3LK1A 2KBIA 1RJVA 3TZ1A 3O2PA 1IQ3A 4PDZA 1KWOC 2M8UA 2AUCA 3VGOA 4E68A 4CFQA 5TNCA 1KK7Z 1WLZA 2D8NA 2F3ZA 3DVJA 3GK2A 4N1GA 1YTZC 5D7FA 1AK8A 1CDPA 1QX5B 3WNXB 2BCBA 1E8AA 1QLSA 3PN7C 3PN7B 1XVJA 2GGMA 3BUOB 2CTNA 1XFZO 1B9AA 1ZOTB 3PM8A 1EG3A 1OMRA 5DKNA 4PHNA 1K90D 1SPYA 1CFCA 4NDDA 1F70A 1IRJA 1G4YR 2L5XB 5KU1A 5HKZA 3CZTX 3ZWHA 2H61A 4MEWA 4MSPA 1M46A 2BCXA 2BKHB 4PHKA 1CM4A 3EK4A 4GAOA 4YI9A 1J7PA 1XK4C 1JC2A 4DUQA 2F2OA 3HCMA 2JZIA 1YRUB 1KCYA 1Y6WA 2BCAA 1V1GA 2JXCA 1G8IA 2PRUA 2CBLA 2A4JA 2KI4B 2KI4C 1WRZA 3FWCA 1IQ5A 1SY9A 2LE9B 3VROA 2NXQA 1CMGA 1IH0A 1WLMA 3DF0B 1UURA 2WOSA 3NSLA 1J7OA 1S5GZ 2KQ6A 5HLOA 1LVCD 1M31A 1IJ5A 3AAKA 1TCFA 2LAPA 4CLNA 4MLWA 1L2OB 1KQMB 1L2OC 1KQMC 1PSBA 2KAXA 4DS7A 1QVIY 3DVKA 4OR9B 4YGEB 1JWDA 4GBAA 1TCOB 1RTP1 1ZFSA 2MAZA 1IKUA 1UWOA 1J55A 2LMVA 2PVBA 3M0WA 3LL8B 3O4YA 1EG4A 2KGRA 1UHKA 3K21A 4QJ3B 1LINA 5HLVA 1CFFA 2JTTA 3DVEA 1QXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNP A;  3PAT A;  1TTX A;  5DKQ A;  1F4Q A;  1QS7 A;  2TN4 A;  3WXA A;  1OE9 B;  1B8L A;  2OPO A;  2K2F A;  2GV5 A;  4ZCV A;  1NPQ A;  5I2Q A;  1B7T Y;  2BBN A;  1JUO A;  1M39 A;  2JQ6 A;  3VRP A;  1F4O A;  1S6C A;  3RM1 A;  1CDN A;  3CR5 X;  2EC6 B;  1NCY A;  2EC6 C;  3VRR A;  1JBA A;  5AAN A;  2V53 A;  1MUX A;  1OSA A;  1CDL A;  1S26 D;  2MBX A;  4ETO A;  3AAJ A;  1N2D A;  1ALV A;  5G08 A;  1J1E A;  3OB1 B;  5PAL A;  2K7O A;  3BQ3 A;  1SMG A;  1B4C A;  2LVJ A;  1YUS A;  2K2A A;  1SNL A;  1A4P A;  1Y1X A;  2B1U A;  1F55 A;  5FYX A;  3SIA A;  1PRW A;  2K61 A;  2LP3 A;  1OZS A;  2ZRT A;  3BUM B;  3C1V A;  2COL B;  3JTD B;  5J3X A;  3TDU A;  5JJG A;  4NDC A;  1EXR A;  3DF0 A;  4YGD B;  2JOJ A;  2CT9 A;  4L9M A;  2OS8 B;  2K8M B;  1DJX A;  1IG5 A;  1NCZ A;  2KYC A;  1SCM B;  4NDB A;  1SCM C;  1M63 B;  1MWN A;  4DCK A;  2MHH A;  1J7Q A;  2SAS A;  4PAL A;  1EJ3 A;  3CS1 A;  1TOP A;  2F8P A;  2F33 A;  2LMT A;  1ALW A;  1DJG A;  1GQM A;  4C0L A;  1CLB A;  1XFY O;  5GQQ C;  3CR2 A;  5D69 A;  4D1E A;  2KYF A;  2LC5 A;  1FF1 A;  3I5F B;  1K9U A;  3I5F C;  3LCP C;  1UHN A;  1BG1 A;  2LHI A;  3CWG A;  1CMF A;  1F54 A;  5CSF A;  2KFG A;  2KFF A;  1K95 A;  1DJH A;  2M9G A;  1OZO A;  3TUY C;  1KWO B;  1KFX L;  2JRF A;  1KFX S;  2I94 A;  1A03 A;  1TNW A;  4I5J A;  4HSZ A;  3AKB A;  5AXI A;  1BOC A;  1XYD A;  3ZNI A;  1SL8 A;  3KF9 A;  1DF0 A;  2FCE A;  1TNP A;  3SG7 A;  3NXA A;  2K7C A;  1QTX A;  2KI6 D;  3OX5 A;  1FI5 A;  1Y1U A;  3IQO A;  2MRD A;  4A4B A;  3NSO A;  1REC A;  3KO0 A;  3MSE B;  1K8U A;  4GUK A;  4I5L B;  3OHM B;  1MXL C;  1QVI Z;  1SL7 A;  4OV2 A;  3FIA A;  4HRG A;  2GGZ A;  1SK6 D;  4CPV A;  2Y5I A;  1QJT A;  4MRY A;  4BY4 A;  2HPS A;  5CSI A;  1U5I A;  4XYN A;  3BOW B;  1TRF A;  1N65 A;  1TNQ A;  2QPT A;  1ZUZ A;  4QJ4 B;  4PE1 A;  1SR6 B;  1TN4 A;  1SR6 C;  3FWB A;  2G9B A;  4Q04 A;  2WCE A;  1PUL A;  2BKI B;  2JT3 A;  2L51 A;  4M2Q A;  2M97 A;  3D10 A;  2EGD A;  2JWW A;  3CGA A;  1B7T Z;  1NCX A;  4MN0 A;  3TS5 B;  3I5G B;  3TS5 C;  3I5G C;  4AQJ A;  2JXL A;  1CDM A;  4MVF A;  3WHU B;  1DT7 B;  4I5N B;  5HKW A;  1SBJ A;  2KHN A;  4YGB B;  1CB1 A;  1QX2 A;  2Y1M A;  3EKJ A;  4XJK B;  2CCM A;  3PAL A;  1PK0 D;  2KFH A;  1FBV A;  3CTN A;  3D0Y A;  4MBE A;  1IGV A;  1KK8 B;  1QIW A;  1KK8 C;  2I18 A;  2KQY A;  1S6I A;  2SCP A;  1SYM A;  4ICB A;  3EKH A;  1NYA A;  1LA3 A;  1R2U A;  3OP0 A;  4N1F A;  1MXE A;  3O78 A;  2L0P A;  3SG2 A;  2ISD A;  5CSJ A;  1WY9 A;  1AJ5 A;  1H4B A;  1K9K A;  1AVS A;  5K89 A;  1K2H A;  3EK7 A;  1UHJ A;  5I2L A;  2WCF A;  5KTY A;  1AP4 A;  2LLT A;  1NSH A;  1X02 A;  3RLZ A;  2MJW B;  3KHE A;  1PAL A;  5ER5 A;  1CNP A;  1DF0 B;  2FOT A;  4C0J A;  4YBH B;  4ZCU A;  2M1K B;  1QAS A;  3LLE A;  2PSR A;  1FI6 A;  2LNK A;  1PSR A;  2VRG A;  4WQ2 A;  3BOW A;  4C0K A;  1CLM A;  1F8H A;  2E6W A;  4ORB B;  2I7A A;  2MA2 A;  1GGW A;  1NX2 A;  3TDZ A;  2E30 A;  1M45 A;  1MHO A;  1HT9 A;  2BBM A;  4R1E A;  1LA0 A;  4ORA B;  1J7R A;  2M7L A;  1BJF A;  3GOF A;  2LUX A;  1YUR A;  1JF0 A;  1U5I B;  1OMD A;  1PVB A;  1GJY A;  1K94 A;  2LM5 A;  2ZN8 A;  3O6B A;  3SG5 A;  1WRL A;  2JPT A;  2MLF C;  3GK1 A;  1NP8 A;  1XO5 A;  1DVI A;  2OTG C;  2OTG B;  3IQQ A;  1WRK A;  2WOR A;  4XJK A;  1CFP A;  1EL4 A;  1B8C A;  4AOM A;  2IS9 A;  2I2R E;  5HYD A;  4JQ0 D;  4PE0 A;  2AAO A;  1MR8 A;  4DIR A;  1RRO A;  2CXJ A;  4CID A;  2KAY A;  4HRE E;  1S6J A;  1DJW A;  2ZFD A;  2O60 A;  2ZN9 A;  1IWQ A;  3PFV A;  1OMV A;  2LAN A;  3E3R A;  3A4U B;  5DKR A;  4QJ5 B;  3CLN A;  3EVR A;  1L7Z A;  2M1U A;  5BPJ A;  3TUY B;  2K7D A;  1FW4 A;  3SG6 A;  1DJI A;  2DOQ A;  4DRW A;  2Q4U A;  4P5O E;  5AEQ A;  3I5I B;  3SIB A;  3I5I C;  3D0Y B;  1DMO A;  1IJ6 A;  2BE4 A;  2EHB A;  2H2K A;  4OCI A;  1BMO A;  1UP5 A;  1KQV A;  1G33 A;  4GGN A;  1KFU L;  3HX4 A;  1KSM A;  1KFU S;  4P2Y B;  2FJU B;  2M0R A;  2O5G A;  3BYA A;  3AKA A;  4GPL B;  1GGZ A;  2LMU A;  2LV7 A;  1DGU A;  1QIV A;  1BLQ A;  1QLK A;  3PLF B;  1NX0 A;  3SG3 A;  2LLS A;  4PHM A;  4ORC B;  1AJ4 A;  2PMY A;  1R6P A;  1C7V A;  3NSI A;  1LKJ A;  4YRU A;  3SG4 A;  1ZAC A;  1AUI B;  2FCD A;  2K7B A;  1WDC B;  1WDC C;  1S3P A;  2JT8 A;  3LK0 A;  2JNX A;  2NCO A;  1TIZ A;  1DJZ A;  2L2E A;  1NIW A;  5JOL A;  2NCP A;  3KPX A;  1AHR A;  2KOT A;  4GGF C;  1YUU A;  5I8N A;  3ICB A;  2R2I A;  1CFD A;  3OB2 B;  3BUW B;  4MZJ A;  1S36 A;  2KAV A;  2JTZ A;  4YGA A;  5AFP A;  2MLE C;  2BL0 B;  2BL0 C;  2KSP A;  5HKY A;  1W7I B;  1Y0V H;  3DD4 A;  3CR4 X;  1QAT A;  1BU3 A;  3VRQ A;  2JU0 A;  2Y4Q A;  3VRN A;  1D1O A;  2HQW A;  1KK7 Y;  2M29 A;  1DTL A;  2NZ0 A;  2KI6 C;  2PAL A;  1KSO A;  1UHH A;  4OKH A;  4YGC B;  3EVU A;  1A29 A;  5CPV A;  3WHT B;  1BR4 B;  1W7J B;  2WCB A;  3OX6 A;  1A75 B;  3F45 A;  4GFT A;  4BY5 A;  4FTG A;  3EVV A;  4OVN F;  1HQV A;  2HET A;  1OOJ A;  1SCV A;  1C07 A;  1RFJ A;  3BUN B;  3GK4 X;  3FS7 A;  2KNE A;  4CFR A;  5IBW A;  2LVI A;  1YR5 A;  1K93 D;  1QV0 A;  2KDH A;  2M7N A;  1SRA A;  1YUT A;  2ZNE A;  3QRX A;  1K96 A;  4WRI A;  4A4C A;  2LHL A;  1BT6 A;  3I5H B;  3I5H C;  2HQ8 A;  2ZKM X;  5F6T A;  2LUC A;  4I5K A;  5I2O A;  1C7W A;  1CTR A;  3EK8 A;  2NLN A;  4GNK B;  4JWQ A;  3BUX B;  1CKK A;  4PE7 A;  1OQP A;  1SKT A;  4GGF A;  3KEV A;  5AER A;  1JFJ A;  5ER4 X;  5B8I B;  2P6B B;  1F71 A;  1VRK A;  1XA5 A;  1XFV O;  2JUL A;  4MZL A;  4PHJ A;  3TDI A;  1LXF C;  2K0J A;  1S5G Y;  2Q91 A;  1UHI A;  1YVH A;  1PVA A;  2KBM A;  2QAC A;  4PE4 A;  4TNC A;  1A2X A;  1B47 A;  1YVL A;  1XFX O;  1XK4 A;  2JC2 A;  1S1E A;  1NWD A;  1XFW O;  4U8D A;  1BF5 A;  4M2P A;  1MF8 B;  1N0Y A;  5CSN A;  1NX3 A;  2KGB C;  2LVK A;  1RWY A;  1BOD A;  1B8R A;  4F0Z B;  1ZMZ A;  1DJY A;  2M3W A;  2LCP A;  1UUS A;  2JNF A;  2L4I A;  2HF5 A;  2L50 A;  3PSR A;  3IF7 A;  2AMI A;  2BE6 A;  2G2B A;  1J1D A;  2H61 C;  2PAS A;  2Y1N A;  3NSK A;  2JT0 A;  3H4S E;  2WC8 A;  1FPW A;  4YI8 A;  4USL A;  2F3Y A;  3BXK A;  1RK9 A;  1QV1 A;  3JTD C;  1EH2 A;  1A75 A;  1CM1 A;  4IL1 A;  2OS8 C;  2L98 A;  2LLU A;  5KSZ A;  4PCW A;  4N5X A;  1Q80 A;  1H8B A;  1YRT B;  1YX7 A;  1BR1 B;  3DVM A;  3SJS A;  1NX1 A;  1JSA A;  1DGV A;  1K9P A;  1V1F A;  2RGI A;  1YX8 A;  2ZRS A;  4JPZ B;  4FQO A;  4MZK A;  3JVT B;  4M2O A;  3JVT C;  4AQI A;  1TNX A;  1SW8 A;  1JFK A;  3A8R A;  1ODB A;  1B1G A;  2LVV A;  2WND A;  2ZND A;  1NUB A;  1XFU O;  1Y1A A;  1SL9 A;  4MRX A;  2BEC A;  4WQ3 A;  2M49 B;  1CLL A;  4NQG A;  1QX7 A;  4HRH A;  2LP2 A;  4UPG A;  1JF2 A;  1MQ1 A;  2L4H A;  2F2P A;  3LK1 A;  2KBI A;  1RJV A;  3TZ1 A;  3O2P A;  1IQ3 A;  4PDZ A;  1KWO C;  2M8U A;  2AUC A;  3VGO A;  4E68 A;  4CFQ A;  5TNC A;  1KK7 Z;  1WLZ A;  2D8N A;  2F3Z A;  3DVJ A;  3GK2 A;  4N1G A;  1YTZ C;  5D7F A;  1AK8 A;  1CDP A;  1QX5 B;  3WNX B;  2BCB A;  1E8A A;  1QLS A;  3PN7 C;  3PN7 B;  1XVJ A;  2GGM A;  3BUO B;  2CTN A;  1XFZ O;  1B9A A;  1ZOT B;  3PM8 A;  1EG3 A;  1OMR A;  5DKN A;  4PHN A;  1K90 D;  1SPY A;  1CFC A;  4NDD A;  1F70 A;  1IRJ A;  1G4Y R;  2L5X B;  5KU1 A;  5HKZ A;  3CZT X;  3ZWH A;  2H61 A;  4MEW A;  4MSP A;  1M46 A;  2BCX A;  2BKH B;  4PHK A;  1CM4 A;  3EK4 A;  4GAO A;  4YI9 A;  1J7P A;  1XK4 C;  1JC2 A;  4DUQ A;  2F2O A;  3HCM A;  2JZI A;  1YRU B;  1KCY A;  1Y6W A;  2BCA A;  1V1G A;  2JXC A;  1G8I A;  2PRU A;  2CBL A;  2A4J A;  2KI4 B;  2KI4 C;  1WRZ A;  3FWC A;  1IQ5 A;  1SY9 A;  2LE9 B;  3VRO A;  2NXQ A;  1CMG A;  1IH0 A;  1WLM A;  3DF0 B;  1UUR A;  2WOS A;  3NSL A;  1J7O A;  1S5G Z;  2KQ6 A;  5HLO A;  1LVC D;  1M31 A;  1IJ5 A;  3AAK A;  1TCF A;  2LAP A;  4CLN A;  4MLW A;  1L2O B;  1KQM B;  1L2O C;  1KQM C;  1PSB A;  2KAX A;  4DS7 A;  1QVI Y;  3DVK A;  4OR9 B;  4YGE B;  1JWD A;  4GBA A;  1TCO B;  1RTP 1;  1ZFS A;  2MAZ A;  1IKU A;  1UWO A;  1J55 A;  2LMV A;  2PVB A;  3M0W A;  3LL8 B;  3O4Y A;  1EG4 A;  2KGR A;  1UHK A;  3K21 A;  4QJ3 B;  1LIN A;  5HLV A;  1CFF A;  2JTT A;  3DVE A;  1QXP A; 
#chains in the Genus database with same CATH topology
 2CNP A;  3PAT A;  1TTX A;  5DKQ A;  1F4Q A;  1QS7 A;  2TN4 A;  2QEB A;  3WXA A;  1OE9 B;  1B8L A;  2OPO A;  5I94 A;  2K2F A;  2WCK A;  3S0E A;  2GV5 A;  4ZCV A;  1NPQ A;  5I2Q A;  1B7T Y;  2BBN A;  1JUO A;  1M39 A;  2JQ6 A;  3IVT A;  3VRP A;  1F4O A;  1S6C A;  3RM1 A;  1CDN A;  3CR5 X;  2EC6 B;  1NCY A;  2EC6 C;  1LS8 A;  3VRR A;  1JBA A;  5AAN A;  2V53 A;  1MUX A;  1OSA A;  1CDL A;  1S26 D;  2MBX A;  4ETO A;  3AAJ A;  1N2D A;  1ALV A;  5G08 A;  1J1E A;  2BAP A;  3OB1 B;  5PAL A;  2K7O A;  3BQ3 A;  1SMG A;  3NHT A;  1B4C A;  2LVJ A;  1YUS A;  2K2A A;  1SNL A;  1A4P A;  2WCJ A;  1Y1X A;  2B1U A;  3R1O A;  5FYX A;  1F55 A;  3SIA A;  1PRW A;  2K61 A;  2LP3 A;  1OZS A;  2ZRT A;  3BUM B;  3C1V A;  2COL B;  3JTD B;  3PM2 A;  5J3X A;  3TDU A;  4NDC A;  1EXR A;  3DF0 A;  4YGD B;  2JOJ A;  2CT9 A;  4L9M A;  2OS8 B;  2K8M B;  1DJX A;  1IG5 A;  1NCZ A;  2KYC A;  1SCM B;  4NDB A;  1SCM C;  1M63 B;  1OOI X;  1MWN A;  3CAB A;  4DCK A;  1TUJ A;  2MHH A;  1J7Q A;  2SAS A;  3S0F A;  4PAL A;  1EJ3 A;  3CS1 A;  1TOP A;  1TWO A;  2F8P A;  2F33 A;  2QEO A;  2LMT A;  1ALW A;  1DJG A;  1GQM A;  4C0L A;  3D75 A;  1XFY O;  5GQQ C;  3L4L A;  3CR2 A;  5D69 A;  4D1E A;  2KYF A;  1CLB A;  2LC5 A;  1FF1 A;  3FE6 A;  3I5F B;  1K9U A;  3I5F C;  3LCP C;  1UHN A;  1BG1 A;  2LHI A;  3CWG A;  3QME A;  1CMF A;  1F54 A;  5CSF A;  2KFG A;  2KFF A;  3Q8I A;  1K95 A;  4KYN A;  1DJH A;  2M9G A;  1OZO A;  3TUY C;  1KWO B;  1KFX L;  2JRF A;  1KFX S;  2I94 A;  1A03 A;  1TNW A;  4I5J A;  4HSZ A;  3AKB A;  5AXI A;  1BOC A;  1XYD A;  3ZNI A;  1SL8 A;  3KF9 A;  1DF0 A;  2FCE A;  1TNP A;  3SS3 A;  3SG7 A;  3NXA A;  3CZ2 A;  2K7C A;  1QTX A;  2KI6 D;  3OX5 A;  1FI5 A;  1Y1U A;  3IQO A;  2MRD A;  4A4B A;  1C3Y A;  2WC5 A;  3NSO A;  1REC A;  3KO0 A;  3MSE B;  1K8U A;  2BNX A;  3DYE A;  4GUK A;  4INW A;  4I5L B;  3CZ1 A;  3OHM B;  1MXL C;  1QVI Z;  1SL7 A;  4OV2 A;  3FIA A;  4HRG A;  2GGZ A;  1SK6 D;  4CPV A;  2Y5I A;  1QJT A;  4MRY A;  4BY4 A;  2QEV A;  2HPS A;  5CSI A;  1U5I A;  4XYN A;  3B86 A;  3UNW A;  3BOW B;  2GTE A;  1OOF A;  1TRF A;  1N65 A;  1TNQ A;  2QPT A;  1ZUZ A;  4QJ4 B;  4PE1 A;  1SR6 B;  1TN4 A;  1SR6 C;  3FWB A;  2G9B A;  4Q04 A;  2WCE A;  1PUL A;  2BKI B;  2JT3 A;  2L51 A;  4M2Q A;  3BFH A;  2M97 A;  3D10 A;  2EGD A;  2JWW A;  3CGA A;  1B7T Z;  1C3Z A;  1NCX A;  4MN0 A;  3TS5 B;  3I5G B;  3TS5 C;  3I5G C;  4AQJ A;  2JXL A;  3B88 A;  1CDM A;  4MVF A;  3WHU B;  1DT7 B;  4I5N B;  5HKW A;  1SBJ A;  2KHN A;  4YGB B;  3S0G A;  1CB1 A;  3V2L A;  2KLE A;  2H8V A;  1QX2 A;  2Y1M A;  3EKJ A;  4XJK B;  2CCM A;  3PAL A;  1PK0 D;  2KFH A;  3PJI A;  1FBV A;  3CTN A;  2KPH A;  2ERB A;  3D0Y A;  4MBE A;  1IGV A;  1KK8 B;  1QIW A;  1KK8 C;  2I18 A;  2KQY A;  1S6I A;  2SCP A;  1SYM A;  3EG5 B;  4PT1 A;  4ICB A;  3EKH A;  1NYA A;  1LA3 A;  1R2U A;  3OP0 A;  4N1F A;  1DEL A;  1MXE A;  2L0P A;  3O78 A;  3SG2 A;  2ISD A;  5CSJ A;  1WY9 A;  1AJ5 A;  1H4B A;  1K9K A;  1AVS A;  5K89 A;  2PQL A;  1K2H A;  3EK7 A;  1UHJ A;  5I2L A;  2P71 A;  2WCF A;  3N7H A;  5JJG A;  5KTY A;  1AP4 A;  5FI6 A;  3R1P A;  2LLT A;  1NSH A;  1X02 A;  3RLZ A;  2MJW B;  3KHE A;  1PAL A;  5ER5 A;  1CNP A;  1DF0 B;  2FOT A;  4C0J A;  4YBH B;  4ZCU A;  2M1K B;  1QAS A;  3LLE A;  2WCH A;  2PSR A;  1FI6 A;  2LNK A;  3S0B A;  1PSR A;  2VRG A;  4WQ2 A;  3BOW A;  4C0K A;  1CLM A;  1F8H A;  2E6W A;  4ORB B;  3UO9 A;  2I7A A;  2MA2 A;  1GGW A;  1DQE A;  1NX2 A;  1T14 A;  2E30 A;  3TDZ A;  1M45 A;  1MHO A;  3B87 A;  1HT9 A;  2BBM A;  4R1E A;  1LA0 A;  4ORA B;  1J7R A;  2M7L A;  1BJF A;  3GOF A;  3DZT A;  2LUX A;  1YUR A;  1JF0 A;  1U5I B;  1OMD A;  1PVB A;  1GJY A;  1K94 A;  2LM5 A;  2ZN8 A;  3O6B A;  3FE8 A;  3SG5 A;  1WRL A;  2JPT A;  2MLF C;  3GK1 A;  1NP8 A;  2WCM A;  1XO5 A;  1DVI A;  2OTG C;  2OTG B;  3IQQ A;  1WRK A;  2WOR A;  4XJK A;  1W9Z A;  3SS4 A;  1CFP A;  1EL4 A;  1B8C A;  4AOM A;  2IS9 A;  2I2R E;  5HYD A;  4JQ0 D;  4PE0 A;  2AAO A;  1MR8 A;  4DIR A;  1RRO A;  4FQT A;  2CXJ A;  4CID A;  2KAY A;  4HRE E;  1S6J A;  1DJW A;  2ZFD A;  2O60 A;  2ZN9 A;  1IIO A;  1IWQ A;  2YGU A;  3BFA A;  3PFV A;  1OMV A;  2LAN A;  3E3R A;  3A4U B;  5DKR A;  4QJ5 B;  3CLN A;  3EVR A;  3D74 A;  1L7Z A;  2JPO A;  2M1U A;  5EL2 A;  2QDI A;  3TUY B;  5BPJ A;  2K7D A;  3NHI A;  1FW4 A;  3SG6 A;  1DJI A;  2DOQ A;  4DRW A;  2Q4U A;  4P5O E;  5AEQ A;  3I5I B;  3SIB A;  3I5I C;  1OW4 A;  3D0Y B;  1DMO A;  1IJ6 A;  2BE4 A;  2EHB A;  2H2K A;  4OCI A;  1BMO A;  1SSE B;  1UP5 A;  3FE9 A;  1KQV A;  1G33 A;  3BJH A;  5DIC A;  4GGN A;  1KFU L;  3HX4 A;  1KSM A;  1KFU S;  4P2Y B;  3CYZ A;  2FJU B;  2KLD A;  2M0R A;  2O5G A;  3AKA A;  3BYA A;  3K1E A;  1GGZ A;  4GPL B;  2LMU A;  2LV7 A;  1DGU A;  1QIV A;  1BLQ A;  1QLK A;  3PLF B;  1NX0 A;  3SG3 A;  2LLS A;  3L47 A;  4ORC B;  4PHM A;  1AJ4 A;  2PMY A;  1R6P A;  1C7V A;  3NSI A;  3DXL A;  1LKJ A;  4YRU A;  3SG4 A;  1ZAC A;  3R72 A;  4A4C A;  1AUI B;  2FCD A;  2K7B A;  1WDC B;  3B7A A;  1WDC C;  1S3P A;  2FJY A;  2JT8 A;  3LK0 A;  2JNX A;  2NCO A;  1TIZ A;  1DJZ A;  2L2E A;  1NIW A;  5JOL A;  2NCP A;  3KPX A;  1AHR A;  2KOT A;  4GGF C;  1YUU A;  5I8N A;  3ICB A;  2R2I A;  1CFD A;  3OB2 B;  5FI7 A;  2WC6 A;  3BUW B;  4MZJ A;  5FI2 A;  1S36 A;  2KAV A;  3SS5 A;  2JTZ A;  4YGA A;  5AFP A;  2MLE C;  2BL0 B;  2BL0 C;  2KSP A;  5HKY A;  1W7I B;  1Y0V H;  3CZ0 A;  3DD4 A;  3CR4 X;  3OBV A;  1QAT A;  1BU3 A;  3CDN A;  3VRQ A;  2JU0 A;  2Y4Q A;  3VRN A;  1D1O A;  2HQW A;  1KK7 Y;  2M29 A;  1DTL A;  2NZ0 A;  2KI6 C;  2PAL A;  1KSO A;  1UHH A;  3S0A A;  4OKH A;  4YGC B;  3EVU A;  3D77 A;  5D3O A;  1A29 A;  5CPV A;  3WHT B;  1BR4 B;  1W7J B;  2WCB A;  3OX6 A;  1A75 B;  3F45 A;  4GFT A;  4BY5 A;  4FTG A;  3DY9 A;  3EVV A;  4OVN F;  1QWV A;  1HQV A;  2HET A;  1OOJ A;  1OOH A;  1SCV A;  1C07 A;  1RFJ A;  3BUN B;  3GK4 X;  3FS7 A;  2KNE A;  4CFR A;  5IBW A;  2LVI A;  1Z2C B;  1YR5 A;  1K93 D;  1QV0 A;  2KDH A;  2M7N A;  1SRA A;  1YUT A;  2ZNE A;  3BFB A;  1K96 A;  2PYQ A;  3D73 A;  3QRX A;  4WRI A;  1XFR A;  2LHL A;  1BT6 A;  3I5H B;  3D76 A;  3I5H C;  1GM0 A;  2HQ8 A;  2ZKM X;  5F6T A;  2LUC A;  4I5K A;  5I2O A;  1C7W A;  1CTR A;  3EK8 A;  2NLN A;  5HL1 A;  4GNK B;  4JWQ A;  3BUX B;  3R1V A;  1CKK A;  4PE7 A;  1OQP A;  1SKT A;  4GGF A;  3KEV A;  5AER A;  1JFJ A;  5ER4 X;  2K60 A;  5B8I B;  2P6B B;  1F71 A;  1VRK A;  1XA5 A;  1XFV O;  2JUL A;  4MZL A;  4OZD A;  4PHJ A;  3TDI A;  1LXF C;  2K0J A;  1S5G Y;  2Q91 A;  1UHI A;  1YVH A;  1PVA A;  2KBM A;  2QAC A;  4PE4 A;  4TNC A;  1A2X A;  1B47 A;  1YVL A;  1XFX O;  1XK4 A;  2JC2 A;  2WCL A;  1S1E A;  1NWD A;  1XFW O;  4U8D A;  1BF5 A;  4M2P A;  1MF8 B;  1N0Y A;  5CSN A;  1NX3 A;  2KGB C;  2LVK A;  1RWY A;  1BOD A;  1B8R A;  4F0Z B;  1ZMZ A;  1DJY A;  2M3W A;  2LCP A;  1UUS A;  2JNF A;  2L4I A;  2HF5 A;  2L50 A;  3PSR A;  4INX A;  3IF7 A;  2AMI A;  2BE6 A;  2G2B A;  1J1D A;  2H61 C;  2PAS A;  2Y1N A;  3NSK A;  2JT0 A;  3H4S E;  2WC8 A;  3S0D A;  1FPW A;  4YI8 A;  4USL A;  1TUZ A;  2F3Y A;  3L4A A;  3BXK A;  1RK9 A;  1QV1 A;  3JTD C;  1EH2 A;  4JD9 A;  1A75 A;  1CM1 A;  4IL1 A;  2OS8 C;  2L98 A;  2LLU A;  5KSZ A;  4PCW A;  4N5X A;  1Q80 A;  1H8B A;  1YRT B;  1YX7 A;  1BR1 B;  3DVM A;  3SJS A;  1NX1 A;  1JSA A;  1DC1 A;  1DGV A;  1K9P A;  1V1F A;  2RGI A;  1YX8 A;  3RZS A;  2ZRS A;  1P28 A;  4JPZ B;  4FQO A;  4MZK A;  3JVT B;  4M2O A;  2QEH A;  3JVT C;  4AQI A;  1TNX A;  1SW8 A;  1JFK A;  3A8R A;  1ODB A;  1B1G A;  2LVV A;  2WND A;  2ZND A;  1NUB A;  1XFU O;  1Y1A A;  1SL9 A;  4MRX A;  2BEC A;  3D78 A;  2M49 B;  1CLL A;  4WQ3 A;  4NQG A;  1QX7 A;  4HRH A;  2LP2 A;  4UPG A;  1JF2 A;  1MQ1 A;  2L4H A;  2F2P A;  3LK1 A;  2KBI A;  1RJV A;  3TZ1 A;  3O2P A;  1IQ3 A;  2L2C A;  4PDZ A;  1KWO C;  2M8U A;  2AUC A;  3VGO A;  4E68 A;  4CFQ A;  5TNC A;  1KK7 Z;  1WLZ A;  2D8N A;  2F3Z A;  3DVJ A;  3GK2 A;  4N1G A;  1YTZ C;  5D7F A;  1AK8 A;  1CDP A;  1QX5 B;  3WNX B;  2BCB A;  1E8A A;  1QLS A;  1OOG A;  3PN7 C;  1XVJ A;  2GGM A;  3PN7 B;  3BUO B;  2CTN A;  1XFZ O;  1B9A A;  1ZOT B;  3PM8 A;  1EG3 A;  1OMR A;  3B6X A;  5DKN A;  4PHN A;  1K90 D;  1SPY A;  1CFC A;  4NDD A;  1F70 A;  1IRJ A;  1G4Y R;  2L5X B;  5KU1 A;  5HKZ A;  2L5Y A;  3CZT X;  3ZWH A;  2H61 A;  4MEW A;  4MSP A;  1M46 A;  2BCX A;  2BKH B;  4PHK A;  1CM4 A;  3EK4 A;  4GAO A;  4YI9 A;  1J7P A;  1XK4 C;  1JC2 A;  1DEK A;  4DUQ A;  2F2O A;  3HCM A;  4F7F A;  2JZI A;  1YRU B;  1KCY A;  1Y6W A;  2BCA A;  1V1G A;  2JXC A;  1G8I A;  2PRU A;  3VB1 A;  2CBL A;  2A4J A;  2KI4 B;  2KI4 C;  1WRZ A;  4IJ7 A;  3FWC A;  3O4X A;  1IQ5 A;  1SY9 A;  2LE9 B;  3VRO A;  3NGV A;  1ORG A;  2NXQ A;  1CMG A;  1IH0 A;  1WLM A;  3DF0 B;  1UUR A;  2WOS A;  4JKT A;  1Z4H A;  3NSL A;  1J7O A;  1S5G Z;  2KQ6 A;  5HLO A;  1LVC D;  1M31 A;  1IJ5 A;  3AAK A;  1TCF A;  2LAP A;  4CLN A;  4MLW A;  1L2O B;  1KQM B;  1L2O C;  1KQM C;  1PSB A;  2KAX A;  4DS7 A;  1QVI Y;  3DVK A;  4OR9 B;  4YGE B;  1JWD A;  4GBA A;  1TCO B;  1RTP 1;  1ZFS A;  2MAZ A;  1IKU A;  3OGN A;  1UWO A;  1J55 A;  2LMV A;  2PVB A;  3M0W A;  3LL8 B;  3O4Y A;  2P70 A;  1EG4 A;  2KGR A;  1UHK A;  3K21 A;  4QJ3 B;  1LIN A;  5HLV A;  1CFF A;  2JTT A;  3DVE A;  1QXP A; 
#chains in the Genus database with same CATH homology
 2CNP A;  3PAT A;  1TTX A;  5DKQ A;  1F4Q A;  1QS7 A;  2TN4 A;  3WXA A;  1OE9 B;  1B8L A;  2OPO A;  2K2F A;  2GV5 A;  4ZCV A;  1NPQ A;  5I2Q A;  1B7T Y;  2BBN A;  1JUO A;  1M39 A;  2JQ6 A;  3VRP A;  1F4O A;  1S6C A;  3RM1 A;  1CDN A;  3CR5 X;  2EC6 B;  1NCY A;  2EC6 C;  3VRR A;  1JBA A;  5AAN A;  2V53 A;  1MUX A;  1OSA A;  1CDL A;  1S26 D;  2MBX A;  4ETO A;  3AAJ A;  1N2D A;  1ALV A;  5G08 A;  1J1E A;  3OB1 B;  5PAL A;  2K7O A;  3BQ3 A;  1SMG A;  1B4C A;  2LVJ A;  1YUS A;  2K2A A;  1SNL A;  1A4P A;  1Y1X A;  2B1U A;  1F55 A;  5FYX A;  3SIA A;  1PRW A;  2K61 A;  2LP3 A;  1OZS A;  2ZRT A;  3BUM B;  3C1V A;  2COL B;  3JTD B;  5J3X A;  3TDU A;  5JJG A;  4NDC A;  1EXR A;  3DF0 A;  4YGD B;  2JOJ A;  2CT9 A;  4L9M A;  2OS8 B;  2K8M B;  1DJX A;  1IG5 A;  1NCZ A;  2KYC A;  1SCM B;  4NDB A;  1SCM C;  1M63 B;  1MWN A;  4DCK A;  2MHH A;  1J7Q A;  2SAS A;  4PAL A;  1EJ3 A;  3CS1 A;  1TOP A;  2F8P A;  2F33 A;  2LMT A;  1ALW A;  1DJG A;  1GQM A;  4C0L A;  1CLB A;  1XFY O;  5GQQ C;  3CR2 A;  5D69 A;  4D1E A;  2KYF A;  2LC5 A;  1FF1 A;  3I5F B;  1K9U A;  3I5F C;  3LCP C;  1UHN A;  1BG1 A;  2LHI A;  3CWG A;  1CMF A;  1F54 A;  5CSF A;  2KFG A;  2KFF A;  1K95 A;  1DJH A;  2M9G A;  1OZO A;  3TUY C;  1KWO B;  1KFX L;  2JRF A;  1KFX S;  2I94 A;  1A03 A;  1TNW A;  4I5J A;  4HSZ A;  3AKB A;  5AXI A;  1BOC A;  1XYD A;  3ZNI A;  1SL8 A;  3KF9 A;  1DF0 A;  2FCE A;  1TNP A;  3SG7 A;  3NXA A;  2K7C A;  1QTX A;  2KI6 D;  3OX5 A;  1FI5 A;  1Y1U A;  3IQO A;  2MRD A;  4A4B A;  3NSO A;  1REC A;  3KO0 A;  3MSE B;  1K8U A;  4GUK A;  4I5L B;  3OHM B;  1MXL C;  1QVI Z;  1SL7 A;  4OV2 A;  3FIA A;  4HRG A;  2GGZ A;  1SK6 D;  4CPV A;  2Y5I A;  1QJT A;  4MRY A;  4BY4 A;  2HPS A;  5CSI A;  1U5I A;  4XYN A;  3BOW B;  1TRF A;  1N65 A;  1TNQ A;  2QPT A;  1ZUZ A;  4QJ4 B;  4PE1 A;  1SR6 B;  1TN4 A;  1SR6 C;  3FWB A;  2G9B A;  4Q04 A;  2WCE A;  1PUL A;  2BKI B;  2JT3 A;  2L51 A;  4M2Q A;  2M97 A;  3D10 A;  2EGD A;  2JWW A;  3CGA A;  1B7T Z;  1NCX A;  4MN0 A;  3TS5 B;  3I5G B;  3TS5 C;  3I5G C;  4AQJ A;  2JXL A;  1CDM A;  4MVF A;  3WHU B;  1DT7 B;  4I5N B;  5HKW A;  1SBJ A;  2KHN A;  4YGB B;  1CB1 A;  1QX2 A;  2Y1M A;  3EKJ A;  4XJK B;  2CCM A;  3PAL A;  1PK0 D;  2KFH A;  1FBV A;  3CTN A;  3D0Y A;  4MBE A;  1IGV A;  1KK8 B;  1QIW A;  1KK8 C;  2I18 A;  2KQY A;  1S6I A;  2SCP A;  1SYM A;  4ICB A;  3EKH A;  1NYA A;  1LA3 A;  1R2U A;  3OP0 A;  4N1F A;  1MXE A;  3O78 A;  2L0P A;  3SG2 A;  2ISD A;  5CSJ A;  1WY9 A;  1AJ5 A;  1H4B A;  1K9K A;  1AVS A;  5K89 A;  1K2H A;  3EK7 A;  1UHJ A;  5I2L A;  2WCF A;  5KTY A;  1AP4 A;  2LLT A;  1NSH A;  1X02 A;  3RLZ A;  2MJW B;  3KHE A;  1PAL A;  5ER5 A;  1CNP A;  1DF0 B;  2FOT A;  4C0J A;  4YBH B;  4ZCU A;  2M1K B;  1QAS A;  3LLE A;  2PSR A;  1FI6 A;  2LNK A;  1PSR A;  2VRG A;  4WQ2 A;  3BOW A;  4C0K A;  1CLM A;  1F8H A;  2E6W A;  4ORB B;  2I7A A;  2MA2 A;  1GGW A;  1NX2 A;  3TDZ A;  2E30 A;  1M45 A;  1MHO A;  1HT9 A;  2BBM A;  4R1E A;  1LA0 A;  4ORA B;  1J7R A;  2M7L A;  1BJF A;  3GOF A;  2LUX A;  1YUR A;  1JF0 A;  1U5I B;  1OMD A;  1PVB A;  1GJY A;  1K94 A;  2LM5 A;  2ZN8 A;  3O6B A;  3SG5 A;  1WRL A;  2JPT A;  2MLF C;  3GK1 A;  1NP8 A;  1XO5 A;  1DVI A;  2OTG C;  2OTG B;  3IQQ A;  1WRK A;  2WOR A;  4XJK A;  1CFP A;  1EL4 A;  1B8C A;  4AOM A;  2IS9 A;  2I2R E;  5HYD A;  4JQ0 D;  4PE0 A;  2AAO A;  1MR8 A;  4DIR A;  1RRO A;  2CXJ A;  4CID A;  2KAY A;  4HRE E;  1S6J A;  1DJW A;  2ZFD A;  2O60 A;  2ZN9 A;  1IWQ A;  3PFV A;  1OMV A;  2LAN A;  3E3R A;  3A4U B;  5DKR A;  4QJ5 B;  3CLN A;  3EVR A;  1L7Z A;  2M1U A;  5BPJ A;  3TUY B;  2K7D A;  1FW4 A;  3SG6 A;  1DJI A;  2DOQ A;  4DRW A;  2Q4U A;  4P5O E;  5AEQ A;  3I5I B;  3SIB A;  3I5I C;  3D0Y B;  1DMO A;  1IJ6 A;  2BE4 A;  2EHB A;  2H2K A;  4OCI A;  1BMO A;  1UP5 A;  1KQV A;  1G33 A;  4GGN A;  1KFU L;  3HX4 A;  1KSM A;  1KFU S;  4P2Y B;  2FJU B;  2M0R A;  2O5G A;  3BYA A;  3AKA A;  4GPL B;  1GGZ A;  2LMU A;  2LV7 A;  1DGU A;  1QIV A;  1BLQ A;  1QLK A;  3PLF B;  1NX0 A;  3SG3 A;  2LLS A;  4PHM A;  4ORC B;  1AJ4 A;  2PMY A;  1R6P A;  1C7V A;  3NSI A;  1LKJ A;  4YRU A;  3SG4 A;  1ZAC A;  1AUI B;  2FCD A;  2K7B A;  1WDC B;  1WDC C;  1S3P A;  2JT8 A;  3LK0 A;  2JNX A;  2NCO A;  1TIZ A;  1DJZ A;  2L2E A;  1NIW A;  5JOL A;  2NCP A;  3KPX A;  1AHR A;  2KOT A;  4GGF C;  1YUU A;  5I8N A;  3ICB A;  2R2I A;  1CFD A;  3OB2 B;  3BUW B;  4MZJ A;  1S36 A;  2KAV A;  2JTZ A;  4YGA A;  5AFP A;  2MLE C;  2BL0 B;  2BL0 C;  2KSP A;  5HKY A;  1W7I B;  1Y0V H;  3DD4 A;  3CR4 X;  1QAT A;  1BU3 A;  3VRQ A;  2JU0 A;  2Y4Q A;  3VRN A;  1D1O A;  2HQW A;  1KK7 Y;  2M29 A;  1DTL A;  2NZ0 A;  2KI6 C;  2PAL A;  1KSO A;  1UHH A;  4OKH A;  4YGC B;  3EVU A;  1A29 A;  5CPV A;  3WHT B;  1BR4 B;  1W7J B;  2WCB A;  3OX6 A;  1A75 B;  3F45 A;  4GFT A;  4BY5 A;  4FTG A;  3EVV A;  4OVN F;  1HQV A;  2HET A;  1OOJ A;  1SCV A;  1C07 A;  1RFJ A;  3BUN B;  3GK4 X;  3FS7 A;  2KNE A;  4CFR A;  5IBW A;  2LVI A;  1YR5 A;  1K93 D;  1QV0 A;  2KDH A;  2M7N A;  1SRA A;  1YUT A;  2ZNE A;  3QRX A;  1K96 A;  4WRI A;  4A4C A;  2LHL A;  1BT6 A;  3I5H B;  3I5H C;  2HQ8 A;  2ZKM X;  5F6T A;  2LUC A;  4I5K A;  5I2O A;  1C7W A;  1CTR A;  3EK8 A;  2NLN A;  4GNK B;  4JWQ A;  3BUX B;  1CKK A;  4PE7 A;  1OQP A;  1SKT A;  4GGF A;  3KEV A;  5AER A;  1JFJ A;  5ER4 X;  5B8I B;  2P6B B;  1F71 A;  1VRK A;  1XA5 A;  1XFV O;  2JUL A;  4MZL A;  4PHJ A;  3TDI A;  1LXF C;  2K0J A;  1S5G Y;  2Q91 A;  1UHI A;  1YVH A;  1PVA A;  2KBM A;  2QAC A;  4PE4 A;  4TNC A;  1A2X A;  1B47 A;  1YVL A;  1XFX O;  1XK4 A;  2JC2 A;  1S1E A;  1NWD A;  1XFW O;  4U8D A;  1BF5 A;  4M2P A;  1MF8 B;  1N0Y A;  5CSN A;  1NX3 A;  2KGB C;  2LVK A;  1RWY A;  1BOD A;  1B8R A;  4F0Z B;  1ZMZ A;  1DJY A;  2M3W A;  2LCP A;  1UUS A;  2JNF A;  2L4I A;  2HF5 A;  2L50 A;  3PSR A;  3IF7 A;  2AMI A;  2BE6 A;  2G2B A;  1J1D A;  2H61 C;  2PAS A;  2Y1N A;  3NSK A;  2JT0 A;  3H4S E;  2WC8 A;  1FPW A;  4YI8 A;  4USL A;  2F3Y A;  3BXK A;  1RK9 A;  1QV1 A;  3JTD C;  1EH2 A;  1A75 A;  1CM1 A;  4IL1 A;  2OS8 C;  2L98 A;  2LLU A;  5KSZ A;  4PCW A;  4N5X A;  1Q80 A;  1H8B A;  1YRT B;  1YX7 A;  1BR1 B;  3DVM A;  3SJS A;  1NX1 A;  1JSA A;  1DGV A;  1K9P A;  1V1F A;  2RGI A;  1YX8 A;  2ZRS A;  4JPZ B;  4FQO A;  4MZK A;  3JVT B;  4M2O A;  3JVT C;  4AQI A;  1TNX A;  1SW8 A;  1JFK A;  3A8R A;  1ODB A;  1B1G A;  2LVV A;  2WND A;  2ZND A;  1NUB A;  1XFU O;  1Y1A A;  1SL9 A;  4MRX A;  2BEC A;  4WQ3 A;  2M49 B;  1CLL A;  4NQG A;  1QX7 A;  4HRH A;  2LP2 A;  4UPG A;  1JF2 A;  1MQ1 A;  2L4H A;  2F2P A;  3LK1 A;  2KBI A;  1RJV A;  3TZ1 A;  3O2P A;  1IQ3 A;  4PDZ A;  1KWO C;  2M8U A;  2AUC A;  3VGO A;  4E68 A;  4CFQ A;  5TNC A;  1KK7 Z;  1WLZ A;  2D8N A;  2F3Z A;  3DVJ A;  3GK2 A;  4N1G A;  1YTZ C;  5D7F A;  1AK8 A;  1CDP A;  1QX5 B;  3WNX B;  2BCB A;  1E8A A;  1QLS A;  3PN7 C;  3PN7 B;  1XVJ A;  2GGM A;  3BUO B;  2CTN A;  1XFZ O;  1B9A A;  1ZOT B;  3PM8 A;  1EG3 A;  1OMR A;  5DKN A;  4PHN A;  1K90 D;  1SPY A;  1CFC A;  4NDD A;  1F70 A;  1IRJ A;  1G4Y R;  2L5X B;  5KU1 A;  5HKZ A;  3CZT X;  3ZWH A;  2H61 A;  4MEW A;  4MSP A;  1M46 A;  2BCX A;  2BKH B;  4PHK A;  1CM4 A;  3EK4 A;  4GAO A;  4YI9 A;  1J7P A;  1XK4 C;  1JC2 A;  4DUQ A;  2F2O A;  3HCM A;  2JZI A;  1YRU B;  1KCY A;  1Y6W A;  2BCA A;  1V1G A;  2JXC A;  1G8I A;  2PRU A;  2CBL A;  2A4J A;  2KI4 B;  2KI4 C;  1WRZ A;  3FWC A;  1IQ5 A;  1SY9 A;  2LE9 B;  3VRO A;  2NXQ A;  1CMG A;  1IH0 A;  1WLM A;  3DF0 B;  1UUR A;  2WOS A;  3NSL A;  1J7O A;  1S5G Z;  2KQ6 A;  5HLO A;  1LVC D;  1M31 A;  1IJ5 A;  3AAK A;  1TCF A;  2LAP A;  4CLN A;  4MLW A;  1L2O B;  1KQM B;  1L2O C;  1KQM C;  1PSB A;  2KAX A;  4DS7 A;  1QVI Y;  3DVK A;  4OR9 B;  4YGE B;  1JWD A;  4GBA A;  1TCO B;  1RTP 1;  1ZFS A;  2MAZ A;  1IKU A;  1UWO A;  1J55 A;  2LMV A;  2PVB A;  3M0W A;  3LL8 B;  3O4Y A;  1EG4 A;  2KGR A;  1UHK A;  3K21 A;  4QJ3 B;  1LIN A;  5HLV A;  1CFF A;  2JTT A;  3DVE A;  1QXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...