3M0WA

Structure of s100a4 with pcp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A4
publication title Structure of S100A4 with PCP
rcsb
source organism Homo sapiens
molecule tags Calcium binding protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3m0wA00
1K9UA 4HRGA 1YVHA 2JT8A 2JTZA 3BOWB 1ZOTB 5K89A 1K94A 3CR2A 1XVJA 4E68A 2QPTA 1DJXA 3GK4X 2D8NA 3BUOB 1MWNA 4I5LB 2ZKMX 1BR1B 1F4QA 2M97A 1KFXS 4P2YB 5FYXA 4A4BA 4C0KA 1YRUB 1CM1A 3GK1A 4NDDA 3IF7A 4ORBB 4QJ5B 1IH0A 4MZKA 3NXAA 2WCEA 3EKJA 3AAKA 1AJ4A 2WC8A 1Y6WA 3I5HB 3SG2A 4YI9A 3LLEA 4DRWA 1BU3A 1JF0A 2HF5A 3ICBA 1H8BA 1QX7A 4PHNA 2ISDA 2GGMA 1YURA 2K7BA 1G4YR 1XO5A 2GV5A 1RFJA 2K7OA 2KGRA 4XYNA 5I8NA 1G33A 4D1EA 4MRYA 1LA0A 1SCMB 1KFUS 1BLQA 4USLA 4YGBB 3BUWB 1M39A 1B8CA 3WHTB 1A03A 2OPOA 2LC5A 1KSOA 3HX4A 1DGVA 3PN7B 2F2PA 3ZWHA 3BXKA 2BKIB 2ZN8A 3EK4A 1UHNA 1J1EA 2RGIA 1GGZA 2BCBA 3SG5A 2M1KB 5AXIA 1YX7A 4NQGA 1TNPA 4MSPA 3SIBA 5AANA 1CB1A 3VGOA 1BF5A 5TNCA 1TCFA 2COLB 1CFPA 1LVCD 2M1UA 1YTZC 3FIAA 1TIZA 2IS9A 4PE4A 5KTYA 1SMGA 3IQOA 2L4HA 1WDCC 2LLUA 3VRRA 3WHUB 5HYDA 4ORAB 2KI4B 3I5GC 1K95A 3A8RA 1C7VA 3VRPA 1K90D 1SL9A 1TRFA 1FF1A 2KBMA 4GAOA 4PCWA 2LHIA 2LMVA 1AVSA 2KOTA 2QACA 4U8DA 1FI5A 2JT0A 2Y5IA 3LL8B 1MR8A 2BKHB 5GQQC 1OQPA 1J7QA 3PATA 1NX1A 5ER5A 2LP2A 4GPLB 1SRAA 1LINA 2BE6A 3AKBA 1M63B 3I5HC 3WXAA 1IJ5A 1AUIB 2LUXA 2JZIA 3TUYB 4CFQA 4UPGA 4WQ2A 2KYFA 1K96A 2JQ6A 3CWGA 3KF9A 4DIRA 1E8AA 3SG7A 1CFCA 1UP5A 1TNXA 3PN7C 4I5NB 1IQ5A 1IRJA 4M2OA 5CSIA 1F71A 2G9BA 1MUXA 3EVRA 1B7TZ 1QV1A 5KSZA 1S3PA 1EL4A 4M2PA 1MXLC 1PK0D 4I5KA 1FI6A 1OOJA 1J7RA 1M45A 3RM1A 2F2OA 1DGUA 4PE1A 1QX2A 3CZTX 4BY5A 1J7OA 1ODBA 1UHKA 1AK8A 4ZCVA 2K0JA 1JSAA 2JTTA 1K8UA 2KFFA 1ALVA 2NXQA 1Q80A 2PSRA 2KYCA 3BYAA 1ALWA 1IG5A 1PSRA 1PVAA 4OR9B 4ETOA 2EC6B 1SKTA 1DT7B 1TNWA 2BECA 1DMOA 2KI4C 4YGAA 1SY9A 1KQMB 2CTNA 1YUUA 2WCBA 2LM5A 5CSJA 1KK7Z 1WRKA 3DVJA 2A4JA 4L9MA 2M3WA 3EVUA 3M0WA 4TNCA 1F54A 3PLFB 3DVEA 1TNQA 3NSIA 2LHLA 5HKYA 1PALA 1RK9A 4XJKB 1M46A 1N2DA 1QVIZ 2KI6C 1YUTA 2AAOA 1B4CA 3DF0B 3DD4A 1DJIA 2OS8B 3I5FC 2KGBC 5B8IB 2KFGA 1CMGA 1V1FA 4ZCUA 5AERA 1U5IA 2K2FA 3IQQA 2L2EA 2OTGB 2CBLA 1WRLA 2BCXA 1Y1UA 3TUYC 2TN4A 2LVKA 3FWBA 5AFPA 1JWDA 3EK8A 1B1GA 3CGAA 3BOWA 5AEQA 1BG1A 2FJUB 1CLLA 4XJKA 3TZ1A 1WRZA 4YI8A 2O5GA 1MQ1A 5HLVA 3DF0A 1XFYO 1NUBA 2JXLA 3VRNA 2BL0B 3O4YA 1GGWA 4QJ3B 2MHHA 3LK0A 5G08A 1B7TY 3CS1A 4YGCB 1IKUA 3TDUA 4FQOA 2ZNDA 4ORCB 1LXFC 4YGEB 4C0LA 5HLOA 1BR4B 2M49B 1QX5B 1JF2A 1FPWA 2AUCA 2JC2A 2KI6D 2M29A 1S6JA 3CR5X 4JQ0D 4OVNF 3KEVA 3MSEB 4HRHA 2EGDA 2PVBA 3AKAA 2JT3A 3DVMA 3PSRA 1UWOA 2M9GA 2EHBA 3OHMB 5D7FA 1TTXA 3CR4X 1K93D 5DKNA 2O60A 3JVTB 1SR6B 2BCAA 2KAYA 4MEWA 4M2QA 1OE9B 4MBEA 3DVKA 2ZNEA 1CMFA 2WORA 2FOTA 1OSAA 1R2UA 3BUMB 2H61A 1ZMZA 2E6WA 2JOJA 1DJGA 2LP3A 1Y1AA 1R6PA 1UHHA 1KQMC 1KK7Y 1NPQA 1QXPA 3BQ3A 3FS7A 4PHJA 4DS7A 1JFKA 5ER4X 3VROA 2JU0A 1CFDA 3H4SE 1SNLA 4R1EA 3VRQA 2KHNA 2Y1MA 3LCPC 3A4UB 1QVIY 2KAVA 3TS5B 1NYAA 1UHIA 4MZLA 4NDCA 5CSFA 1IGVA 1SK6D 1B47A 2OS8C 1K9PA 1BT6A 4GNKB 1QIVA 3O78A 4OV2A 1NSHA 1KQVA 4JPZB 1JC2A 2OTGC 2I94A 4MLWA 1OZSA 1BOCA 4NDBA 1C07A 3OP0A 2KBIA 1TOPA 1J1DA 2CNPA 1KSMA 1NCZA 1ZUZA 1HQVA 2PMYA 3NSLA 2BL0C 4GBAA 1SCMC 3CTNA 4CIDA 2ZFDA 2MAZA 1JFJA 1G8IA 1SYMA 1SPYA 2H61C 1NP8A 1S26D 3F45A 2MBXA 2VRGA 3GOFA 1CDLA 2E30A 3LK1A 3HCMA 1DVIA 1K9KA 1FW4A 1BODA 1WLMA 1SL7A 3JVTC 2BE4A 2M7LA 1SR6C 2KQ6A 4PHMA 5CSNA 4YRUA 1F8HA 1CLMA 2KQYA 2JULA 3JTDB 1B9AA 2MLEC 1MXEA 1XA5A 1LA3A 5CPVA 1A4PA 1FBVA 1DTLA 2LLSA 2CCMA 1YR5A 1KCYA 2SCPA 1A75B 1TN4A 4N1FA 2ZN9A 1CTRA 2SASA 2LCPA 1NX3A 2Y4QA 1S6CA 3QRXA 1UHJA 5DKQA 2MA2A 2F3ZA 2MJWB 1JBAA 3SG4A 2FCDA 2LNKA 1CDPA 1OMVA 1RROA 1N65A 1NCXA 2BBMA 2JXCA 1AHRA 1F70A 4QJ4B 1DJHA 2GGZA 1H4BA 1F4OA 2HQ8A 4N5XA 4C0JA 2F3YA 4N1GA 1SCVA 1A75A 2LMUA 1CLBA 1LKJA 2K8MB 2M7NA 2NZ0A 4JWQA 4WRIA 2I2RE 4DCKA 4MVFA 3KPXA 2K7DA 1NX0A 5HKWA 3GK2A 4WQ3A 3D10A 1DJYA 3SJSA 2K7CA 1MF8B 1D1OA 2ZRTA 5KU1A 1F55A 2R2IA 2JNXA 1B8LA 2NCOA 1GQMA 1EG4A 1BMOA 2LV7A 4ICBA 4OCIA 3WNXB 1CDNA 4AQIA 4MZJA 1RTP1 4DUQA 1NIWA 1K2HA 3EVVA 3SG6A 2MLFC 4A4CA 1A29A 3OX5A 1JUOA 4GUKA 1EG3A 1M31A 1QASA 3PALA 4F0ZB 2V53A 4YGDB 2LE9B 2MRDA 1V1GA 3AAJA 1C7WA 1J55A 1CFFA 1KK8B 1S1EA 4P5OE 2WOSA 1S5GZ 4PDZA 1AP4A 3EKHA 1N0YA 2LVIA 3ZNIA 1L2OB 1CKKA 4GGFA 3OB2B 1SW8A 1CM4A 5I2LA 1UUSA 1RWYA 3NSOA 2KSPA 1QIWA 3JTDC 1RECA 3I5IB 2PRUA 3FWCA 2CXJA 2LLTA 2LVVA 2EC6C 1YUSA 5JOLA 1S6IA 1QJTA 1CDMA 3TDIA 1HT9A 2NCPA 1TCOB 1XFVO 1NCYA 1QV0A 4I5JA 2NLNA 4CFRA 1KWOB 1J7PA 1YVLA 2L51A 1IJ6A 1W7JB 1A2XA 3BUNB 2K2AA 2L50A 4GGNA 2I7AA 2DOQA 1OZOA 2Y1NA 4GFTA 1WLZA 4BY4A 5F6TA 1W7IB 4MN0A 1YX8A 2PALA 1NWDA 5PALA 2JRFA 5BPJA 1MHOA 2BBNA 1L7ZA 2WCFA 2Q91A 4HREE 4AOMA 5HKZA 2Q4UA 1DJWA 1EJ3A 1XFUO 3OB1B 4GGFC 2H2KA 2KDHA 2P6BB 1BJFA 3SIAA 2JNFA 2HQWA 4HSZA 2KNEA 2LANA 2WNDA 3PM8A 1XK4A 4PE0A 5IBWA 1QS7A 1PVBA 2F8PA 3E3RA 4IL1A 3CLNA 3O6BA 2B1UA 2K61A 1S36A 3C1VA 4MRXA 4AQJA 1XFWO 1PRWA 1S5GY 1VRKA 3EK7A 1KK8C 1KFXL 1XYDA 4YBHB 1PULA 4FTGA 1X02A 3SG3A 1L2OC 3I5FB 5D69A 1GJYA 2L4IA 5JJGA 2JWWA 1SL8A 2G2BA 1NX2A 3I5IC 2FCEA 2HETA 3KHEA 4CLNA 5I2OA 2AMIA 3NSKA 3K21A 1KFUL 2ZRSA 2L98A 3PFVA 1EH2A 3TDZA 4PALA 4CPVA 1XFXO 1IQ3A 1KWOC 1B8RA 1QATA 1IWQA 1WY9A 1ZACA 1OMRA 1ZFSA 1CNPA 1QLKA 2KAXA 2PASA 2CT9A 2JPTA 1QTXA 3RLZA 2L0PA 3TS5C 1EXRA 1XK4C 1Y1XA 2F33A 4PE7A 1DF0B 1PSBA 2L5XB 3D0YB 1AJ5A 2M8UA 3O2PA 2LMTA 4PHKA 1XFZO 2I18A 2HPSA 1OMDA 1DJZA 2LAPA 2LVJA 1RJVA 3KO0A 1YRTB 3BUXB 2M0RA 2KFHA 5DKRA 3OX6A 2LUCA 1Y0VH 1SBJA 1U5IB 1WDCB 1DF0A 1QLSA 3I5GB 5J3XA 4OKHA 5I2QA 1UURA 4Q04A 3D0YA
chains in the Genus database with same CATH superfamily
1K9UA 4HRGA 1YVHA 2JT8A 2JTZA 3BOWB 1ZOTB 4PT1A 5K89A 1K94A 3CR2A 1XVJA 4E68A 2QPTA 1DJXA 3GK4X 2D8NA 3BUOB 1MWNA 3OBVA 4I5LB 2FJYA 1BR1B 2ZKMX 1OW4A 1F4QA 2M97A 1KFXS 4P2YB 2P71A 5FYXA 1IIOA 2ERBA 4A4BA 1YRUB 1CM1A 3GK1A 4NDDA 3IF7A 4ORBB 4C0KA 4QJ5B 1IH0A 4MZKA 3NXAA 2WCEA 3EKJA 2P70A 3AAKA 1AJ4A 2WC8A 1Y6WA 3I5HB 3SG2A 4YI9A 2QEOA 3LLEA 4DRWA 1BU3A 1JF0A 2HF5A 3ICBA 1H8BA 3DYEA 1QX7A 4PHNA 2ISDA 2GGMA 1YURA 2K7BA 1G4YR 1XO5A 2GV5A 1RFJA 2K7OA 2KGRA 4XYNA 1DEKA 5I8NA 1G33A 4D1EA 4MRYA 1LA0A 1SCMB 3DY9A 1KFUS 1BLQA 4USLA 4YGBB 3BUWB 1M39A 1B8CA 3WHTB 1A03A 2OPOA 2LC5A 1KSOA 3HX4A 1DGVA 3PN7B 2F2PA 3ZWHA 3BXKA 1OOHA 2BKIB 2ZN8A 3EK4A 5D3OA 1UHNA 1J1EA 2RGIA 1GGZA 2BCBA 3SG5A 2M1KB 5AXIA 1YX7A 4NQGA 1TNPA 1DQEA 3CABA 4MSPA 3SIBA 5AANA 1CB1A 3VGOA 1BF5A 5TNCA 1TCFA 2COLB 1CFPA 1LVCD 3CZ0A 2M1UA 1YTZC 3FIAA 1TIZA 2IS9A 4PE4A 5KTYA 1SMGA 3IQOA 2L4HA 1WDCC 2LLUA 3VRRA 3WHUB 5HYDA 4ORAB 2KI4B 3I5GC 1K95A 3A8RA 1C7VA 3VRPA 1K90D 1SL9A 1TRFA 1FF1A 2KBMA 4GAOA 4PCWA 2LHIA 2LMVA 1AVSA 2KOTA 2QACA 4U8DA 1FI5A 2JT0A 2Y5IA 3B6XA 2WCMA 3S0DA 3LL8B 1MR8A 2BKHB 5GQQC 1OQPA 1OOFA 1J7QA 3L47A 1NX1A 3PATA 5ER5A 2LP2A 4GPLB 1SRAA 1LINA 2BE6A 3AKBA 1M63B 3I5HC 3D76A 2KPHA 3WXAA 1IJ5A 2WCHA 1AUIB 3NGVA 2LUXA 3BFAA 2JZIA 3TUYB 1Z4HA 4CFQA 2K60A 4UPGA 4WQ2A 2KYFA 2PYQA 1K96A 2JQ6A 3CWGA 5FI7A 3KF9A 4DIRA 1E8AA 3SG7A 1CFCA 1UP5A 1TNXA 3PN7C 4I5NB 1IQ5A 1IRJA 4M2OA 5CSIA 1F71A 2G9BA 1MUXA 3EVRA 1B7TZ 1QV1A 5KSZA 1S3PA 1EL4A 4M2PA 1MXLC 1PK0D 4I5KA 1FI6A 1OOJA 1J7RA 1M45A 3RM1A 3IVTA 1XFRA 2F2OA 1DGUA 4PE1A 1W9ZA 1QX2A 3CZTX 4BY5A 1J7OA 1ODBA 1UHKA 1AK8A 4ZCVA 2K0JA 1JSAA 2JTTA 1K8UA 2KFFA 1ALVA 2NXQA 1Q80A 2PSRA 2KYCA 1OOIX 3BYAA 1ALWA 1IG5A 3S0FA 1PSRA 1PVAA 4OR9B 3V2LA 2WCKA 3BFBA 4ETOA 2EC6B 1SKTA 2YGUA 1DT7B 3CZ1A 1TNWA 2BECA 1DMOA 2KI4C 4YGAA 1SY9A 1KQMB 2CTNA 1YUUA 2WCBA 2LM5A 2L5YA 3NHTA 5CSJA 1KK7Z 1WRKA 3DVJA 2A4JA 4L9MA 2M3WA 3EVUA 3M0WA 4TNCA 1F54A 2KLDA 3PLFB 3DVEA 1TNQA 3NSIA 2LHLA 5HKYA 1PALA 1RK9A 2BNXA 4XJKB 1M46A 1N2DA 1QVIZ 2KI6C 1YUTA 2AAOA 1B4CA 3DF0B 3DD4A 1DJIA 2OS8B 3NHIA 3I5FC 3B86A 2KGBC 5B8IB 2KFGA 2PQLA 1CMGA 1V1FA 4ZCUA 5AERA 1U5IA 2K2FA 3IQQA 2L2EA 2OTGB 2CBLA 1WRLA 2BCXA 3VB1A 3S0AA 1Y1UA 4JD9A 3TUYC 2TN4A 2LVKA 3FWBA 5AFPA 1JWDA 3EK8A 1B1GA 3CGAA 3BOWA 5AEQA 1BG1A 2FJUB 1CLLA 4XJKA 3TZ1A 1WRZA 4YI8A 2O5GA 1MQ1A 3R1PA 3DF0A 5HLVA 1XFYO 1NUBA 2JXLA 3VRNA 2BL0B 3D78A 3O4YA 1GGWA 4QJ3B 2MHHA 3LK0A 5G08A 1B7TY 3CS1A 4YGCB 1IKUA 3TDUA 4FQOA 2ZNDA 4ORCB 1LXFC 4YGEB 4C0LA 5HLOA 1BR4B 2M49B 1QX5B 1JF2A 1FPWA 2AUCA 2JC2A 2KI6D 2M29A 1S6JA 3CR5X 3D0YA 4JQ0D 3KEVA 3MSEB 4HRHA 2EGDA 2PVBA 4OVNF 3AKAA 2JT3A 3DVMA 3PSRA 1UWOA 2M9GA 2EHBA 3CDNA 3OHMB 5D7FA 1TTXA 3CR4X 4JKTA 1K93D 5DKNA 2O60A 3L4LA 3JVTB 1SR6B 2BCAA 2KAYA 2QEHA 4MEWA 4M2QA 1OE9B 4MBEA 3DVKA 2ZNEA 1CMFA 2WORA 2FOTA 1OSAA 1R2UA 3BUMB 2H61A 1ZMZA 2E6WA 2JOJA 1DJGA 3SS5A 4INXA 2LP3A 1Y1AA 1R6PA 1UHHA 1KQMC 1KK7Y 1NPQA 1QXPA 1P28A 3BQ3A 3FS7A 4PHJA 1JFKA 5ER4X 3VROA 4DS7A 1DC1A 2JU0A 1CFDA 3H4SE 1SNLA 4R1EA 3RZSA 3VRQA 1C3ZA 2KHNA 2Y1MA 3LCPC 3A4UB 3B87A 1QVIY 1TUJA 2KAVA 3TS5B 1NYAA 1UHIA 4MZLA 4NDCA 5CSFA 1IGVA 1OOGA 1B47A 1SK6D 2OS8C 1K9PA 4IJ7A 1BT6A 4GNKB 1QIVA 3O78A 4OV2A 1NSHA 1KQVA 4JPZB 1JC2A 2OTGC 2I94A 5FI2A 4MLWA 1OZSA 1BOCA 4NDBA 1C07A 2WCJA 3OP0A 2KBIA 1TOPA 1J1DA 2CNPA 1KSMA 1NCZA 1ZUZA 1HQVA 2PMYA 3NSLA 2BL0C 4GBAA 1SCMC 3CTNA 4CIDA 2QDIA 2ZFDA 2MAZA 1JFJA 1G8IA 1SYMA 1SPYA 2H61C 1NP8A 1S26D 3F45A 2MBXA 2VRGA 3GOFA 1CDLA 3OGNA 2E30A 3LK1A 3HCMA 1DVIA 1K9KA 5HL1A 1FW4A 1BODA 1WLMA 3D74A 1SL7A 3JVTC 2BE4A 2M7LA 1SR6C 2KQ6A 4PHMA 2WCLA 3FE6A 5CSNA 4YRUA 1F8HA 4INWA 1CLMA 2KQYA 2JULA 5I94A 3JTDB 1B9AA 2MLEC 1MXEA 1XA5A 1LA3A 5CPVA 1A4PA 1FBVA 1DTLA 2LLSA 2CCMA 1YR5A 1KCYA 2SCPA 1A75B 1TN4A 4N1FA 2ZN9A 1CTRA 2SASA 2LCPA 1NX3A 3N7HA 2Y4QA 1S6CA 3QRXA 1Z2CB 1UHJA 5DKQA 2MA2A 2F3ZA 2MJWB 1JBAA 3SG4A 2FCDA 2LNKA 3R1VA 1LS8A 1CDPA 1OMVA 1RROA 1N65A 1NCXA 2BBMA 2JXCA 1AHRA 1F70A 4QJ4B 1C3YA 1DJHA 2GGZA 1H4BA 3UO9A 2L2CA 1F4OA 2WC6A 2HQ8A 4N5XA 4C0JA 2F3YA 4N1GA 1SCVA 1A75A 2LMUA 1CLBA 1LKJA 3S0EA 1GM0A 2K8MB 2M7NA 2NZ0A 4JWQA 4WRIA 2I2RE 4DCKA 4MVFA 3KPXA 5DICA 2K7DA 1NX0A 3S0BA 5HKWA 3GK2A 4WQ3A 3D10A 1DJYA 3SJSA 2K7CA 1MF8B 2QEBA 2ZRTA 1D1OA 5KU1A 1F55A 2R2IA 2JNXA 1B8LA 2NCOA 1GQMA 1EG4A 1BMOA 2LV7A 4ICBA 4OCIA 3WNXB 1CDNA 4AQIA 4MZJA 1RTP1 4DUQA 1NIWA 1K2HA 3EVVA 3SG6A 2MLFC 4A4CA 1A29A 3OX5A 1JUOA 4GUKA 1EG3A 1M31A 3L4AA 1QASA 3PALA 2KLEA 2V53A 3D75A 4YGDB 2LE9B 3UNWA 4F0ZB 2MRDA 1V1GA 3AAJA 1C7WA 1J55A 1CFFA 1KK8B 1S1EA 4P5OE 2WOSA 1S5GZ 4PDZA 1AP4A 3EKHA 1N0YA 2LVIA 3BJHA 3ZNIA 1L2OB 1CKKA 4GGFA 3OB2B 1SW8A 1CM4A 3DZTA 5I2LA 1UUSA 1RWYA 3NSOA 2KSPA 1QIWA 3JTDC 1RECA 3O4XA 3I5IB 2PRUA 3FE8A 3FWCA 2CXJA 2LLTA 2LVVA 2EC6C 1YUSA 5JOLA 1S6IA 1QJTA 1CDMA 3TDIA 1HT9A 2NCPA 1TCOB 1XFVO 1NCYA 1QV0A 2JPOA 4I5JA 3FE9A 2NLNA 4CFRA 1KWOB 1J7PA 1YVLA 2L51A 1IJ6A 1W7JB 1A2XA 3BUNB 2K2AA 2L50A 4GGNA 5FI6A 2I7AA 2DOQA 1OZOA 2Y1NA 4GFTA 1WLZA 4BY4A 5F6TA 1W7IB 1ORGA 4MN0A 3R1OA 1YX8A 2PALA 1NWDA 3Q8IA 5PALA 3SS4A 2JRFA 3PM2A 5BPJA 3QMEA 1MHOA 2BBNA 1L7ZA 2WCFA 2Q91A 4HREE 4AOMA 1T14A 3EG5B 3S0GA 5HKZA 2WC5A 2Q4UA 1DJWA 1EJ3A 1XFUO 3OB1B 4GGFC 2H2KA 2KDHA 2P6BB 1BJFA 3SIAA 2JNFA 3D73A 2HQWA 4HSZA 2KNEA 2LANA 2WNDA 3PM8A 1XK4A 4KYNA 4PE0A 1QS7A 5IBWA 1PVBA 2F8PA 3E3RA 4IL1A 3CLNA 3O6BA 2B1UA 2K61A 1S36A 3C1VA 4MRXA 4AQJA 1XFWO 1PRWA 2GTEA 1S5GY 4FQTA 1VRKA 3EK7A 1KK8C 1KFXL 1XYDA 4YBHB 1PULA 3CZ2A 4FTGA 1X02A 3SG3A 1L2OC 3I5FB 4F7FA 5D69A 1GJYA 2L4IA 3B7AA 5JJGA 2JWWA 1SL8A 2G2BA 1NX2A 1DELA 3I5IC 1TWOA 2FCEA 2HETA 1TUZA 3KHEA 4CLNA 5I2OA 2AMIA 3NSKA 3CYZA 3K21A 1KFUL 2ZRSA 2L98A 3PFVA 1EH2A 3TDZA 4PALA 4CPVA 1XFXO 3PJIA 1IQ3A 1KWOC 1B8RA 1QATA 1IWQA 1WY9A 1ZACA 1OMRA 1ZFSA 1CNPA 1QLKA 3B88A 2KAXA 2PASA 2CT9A 2JPTA 4OZDA 1QTXA 3D77A 3RLZA 2L0PA 3TS5C 3DXLA 1EXRA 1XK4C 1Y1XA 2F33A 3K1EA 4PE7A 1DF0B 1PSBA 2L5XB 3D0YB 3SS3A 1AJ5A 5EL2A 2M8UA 3O2PA 2LMTA 4PHKA 1XFZO 2I18A 2HPSA 1OMDA 1DJZA 2LAPA 2LVJA 3BFHA 2BAPA 1RJVA 3KO0A 1YRTB 3BUXB 1QWVA 2M0RA 2KFHA 5DKRA 3OX6A 2LUCA 1Y0VH 1SBJA 1U5IB 1WDCB 2QEVA 1SSEB 3R72A 1DF0A 1QLSA 3I5GB 5J3XA 4OKHA 5I2QA 1UURA 4Q04A 2H8VA
chains in the Genus database with same CATH topology
1K9UA 4HRGA 1YVHA 2JT8A 2JTZA 3BOWB 1ZOTB 5K89A 1K94A 3CR2A 1XVJA 4E68A 2QPTA 1DJXA 3GK4X 2D8NA 3BUOB 1MWNA 4I5LB 2ZKMX 1BR1B 1F4QA 2M97A 1KFXS 4P2YB 5FYXA 4A4BA 4C0KA 1YRUB 1CM1A 3GK1A 4NDDA 3IF7A 4ORBB 4QJ5B 1IH0A 4MZKA 3NXAA 2WCEA 3EKJA 3AAKA 1AJ4A 2WC8A 1Y6WA 3I5HB 3SG2A 4YI9A 3LLEA 4DRWA 1BU3A 1JF0A 2HF5A 3ICBA 1H8BA 1QX7A 4PHNA 2ISDA 2GGMA 1YURA 2K7BA 1G4YR 1XO5A 2GV5A 1RFJA 2K7OA 2KGRA 4XYNA 5I8NA 1G33A 4D1EA 4MRYA 1LA0A 1SCMB 1KFUS 1BLQA 4USLA 4YGBB 3BUWB 1M39A 1B8CA 3WHTB 1A03A 2OPOA 2LC5A 1KSOA 3HX4A 1DGVA 3PN7B 2F2PA 3ZWHA 3BXKA 2BKIB 2ZN8A 3EK4A 1UHNA 1J1EA 2RGIA 1GGZA 2BCBA 3SG5A 2M1KB 5AXIA 1YX7A 4NQGA 1TNPA 4MSPA 3SIBA 5AANA 1CB1A 3VGOA 1BF5A 5TNCA 1TCFA 2COLB 1CFPA 1LVCD 2M1UA 1YTZC 3FIAA 1TIZA 2IS9A 4PE4A 5KTYA 1SMGA 3IQOA 2L4HA 1WDCC 2LLUA 3VRRA 3WHUB 5HYDA 4ORAB 2KI4B 3I5GC 1K95A 3A8RA 1C7VA 3VRPA 1K90D 1SL9A 1TRFA 1FF1A 2KBMA 4GAOA 4PCWA 2LHIA 2LMVA 1AVSA 2KOTA 2QACA 4U8DA 1FI5A 2JT0A 2Y5IA 3LL8B 1MR8A 2BKHB 5GQQC 1OQPA 1J7QA 3PATA 1NX1A 5ER5A 2LP2A 4GPLB 1SRAA 1LINA 2BE6A 3AKBA 1M63B 3I5HC 3WXAA 1IJ5A 1AUIB 2LUXA 2JZIA 3TUYB 4CFQA 4UPGA 4WQ2A 2KYFA 1K96A 2JQ6A 3CWGA 3KF9A 4DIRA 1E8AA 3SG7A 1CFCA 1UP5A 1TNXA 3PN7C 4I5NB 1IQ5A 1IRJA 4M2OA 5CSIA 1F71A 2G9BA 1MUXA 3EVRA 1B7TZ 1QV1A 5KSZA 1S3PA 1EL4A 4M2PA 1MXLC 1PK0D 4I5KA 1FI6A 1OOJA 1J7RA 1M45A 3RM1A 2F2OA 1DGUA 4PE1A 1QX2A 3CZTX 4BY5A 1J7OA 1ODBA 1UHKA 1AK8A 4ZCVA 2K0JA 1JSAA 2JTTA 1K8UA 2KFFA 1ALVA 2NXQA 1Q80A 2PSRA 2KYCA 3BYAA 1ALWA 1IG5A 1PSRA 1PVAA 4OR9B 4ETOA 2EC6B 1SKTA 1DT7B 1TNWA 2BECA 1DMOA 2KI4C 4YGAA 1SY9A 1KQMB 2CTNA 1YUUA 2WCBA 2LM5A 5CSJA 1KK7Z 1WRKA 3DVJA 2A4JA 4L9MA 2M3WA 3EVUA 3M0WA 4TNCA 1F54A 3PLFB 3DVEA 1TNQA 3NSIA 2LHLA 5HKYA 1PALA 1RK9A 4XJKB 1M46A 1N2DA 1QVIZ 2KI6C 1YUTA 2AAOA 1B4CA 3DF0B 3DD4A 1DJIA 2OS8B 3I5FC 2KGBC 5B8IB 2KFGA 1CMGA 1V1FA 4ZCUA 5AERA 1U5IA 2K2FA 3IQQA 2L2EA 2OTGB 2CBLA 1WRLA 2BCXA 1Y1UA 3TUYC 2TN4A 2LVKA 3FWBA 5AFPA 1JWDA 3EK8A 1B1GA 3CGAA 3BOWA 5AEQA 1BG1A 2FJUB 1CLLA 4XJKA 3TZ1A 1WRZA 4YI8A 2O5GA 1MQ1A 5HLVA 3DF0A 1XFYO 1NUBA 2JXLA 3VRNA 2BL0B 3O4YA 1GGWA 4QJ3B 2MHHA 3LK0A 5G08A 1B7TY 3CS1A 4YGCB 1IKUA 3TDUA 4FQOA 2ZNDA 4ORCB 1LXFC 4YGEB 4C0LA 5HLOA 1BR4B 2M49B 1QX5B 1JF2A 1FPWA 2AUCA 2JC2A 2KI6D 2M29A 1S6JA 3CR5X 4JQ0D 4OVNF 3KEVA 3MSEB 4HRHA 2EGDA 2PVBA 3AKAA 2JT3A 3DVMA 3PSRA 1UWOA 2M9GA 2EHBA 3OHMB 5D7FA 1TTXA 3CR4X 1K93D 5DKNA 2O60A 3JVTB 1SR6B 2BCAA 2KAYA 4MEWA 4M2QA 1OE9B 4MBEA 3DVKA 2ZNEA 1CMFA 2WORA 2FOTA 1OSAA 1R2UA 3BUMB 2H61A 1ZMZA 2E6WA 2JOJA 1DJGA 2LP3A 1Y1AA 1R6PA 1UHHA 1KQMC 1KK7Y 1NPQA 1QXPA 3BQ3A 3FS7A 4PHJA 4DS7A 1JFKA 5ER4X 3VROA 2JU0A 1CFDA 3H4SE 1SNLA 4R1EA 3VRQA 2KHNA 2Y1MA 3LCPC 3A4UB 1QVIY 2KAVA 3TS5B 1NYAA 1UHIA 4MZLA 4NDCA 5CSFA 1IGVA 1SK6D 1B47A 2OS8C 1K9PA 1BT6A 4GNKB 1QIVA 3O78A 4OV2A 1NSHA 1KQVA 4JPZB 1JC2A 2OTGC 2I94A 4MLWA 1OZSA 1BOCA 4NDBA 1C07A 3OP0A 2KBIA 1TOPA 1J1DA 2CNPA 1KSMA 1NCZA 1ZUZA 1HQVA 2PMYA 3NSLA 2BL0C 4GBAA 1SCMC 3CTNA 4CIDA 2ZFDA 2MAZA 1JFJA 1G8IA 1SYMA 1SPYA 2H61C 1NP8A 1S26D 3F45A 2MBXA 2VRGA 3GOFA 1CDLA 2E30A 3LK1A 3HCMA 1DVIA 1K9KA 1FW4A 1BODA 1WLMA 1SL7A 3JVTC 2BE4A 2M7LA 1SR6C 2KQ6A 4PHMA 5CSNA 4YRUA 1F8HA 1CLMA 2KQYA 2JULA 3JTDB 1B9AA 2MLEC 1MXEA 1XA5A 1LA3A 5CPVA 1A4PA 1FBVA 1DTLA 2LLSA 2CCMA 1YR5A 1KCYA 2SCPA 1A75B 1TN4A 4N1FA 2ZN9A 1CTRA 2SASA 2LCPA 1NX3A 2Y4QA 1S6CA 3QRXA 1UHJA 5DKQA 2MA2A 2F3ZA 2MJWB 1JBAA 3SG4A 2FCDA 2LNKA 1CDPA 1OMVA 1RROA 1N65A 1NCXA 2BBMA 2JXCA 1AHRA 1F70A 4QJ4B 1DJHA 2GGZA 1H4BA 1F4OA 2HQ8A 4N5XA 4C0JA 2F3YA 4N1GA 1SCVA 1A75A 2LMUA 1CLBA 1LKJA 2K8MB 2M7NA 2NZ0A 4JWQA 4WRIA 2I2RE 4DCKA 4MVFA 3KPXA 2K7DA 1NX0A 5HKWA 3GK2A 4WQ3A 3D10A 1DJYA 3SJSA 2K7CA 1MF8B 1D1OA 2ZRTA 5KU1A 1F55A 2R2IA 2JNXA 1B8LA 2NCOA 1GQMA 1EG4A 1BMOA 2LV7A 4ICBA 4OCIA 3WNXB 1CDNA 4AQIA 4MZJA 1RTP1 4DUQA 1NIWA 1K2HA 3EVVA 3SG6A 2MLFC 4A4CA 1A29A 3OX5A 1JUOA 4GUKA 1EG3A 1M31A 1QASA 3PALA 4F0ZB 2V53A 4YGDB 2LE9B 2MRDA 1V1GA 3AAJA 1C7WA 1J55A 1CFFA 1KK8B 1S1EA 4P5OE 2WOSA 1S5GZ 4PDZA 1AP4A 3EKHA 1N0YA 2LVIA 3ZNIA 1L2OB 1CKKA 4GGFA 3OB2B 1SW8A 1CM4A 5I2LA 1UUSA 1RWYA 3NSOA 2KSPA 1QIWA 3JTDC 1RECA 3I5IB 2PRUA 3FWCA 2CXJA 2LLTA 2LVVA 2EC6C 1YUSA 5JOLA 1S6IA 1QJTA 1CDMA 3TDIA 1HT9A 2NCPA 1TCOB 1XFVO 1NCYA 1QV0A 4I5JA 2NLNA 4CFRA 1KWOB 1J7PA 1YVLA 2L51A 1IJ6A 1W7JB 1A2XA 3BUNB 2K2AA 2L50A 4GGNA 2I7AA 2DOQA 1OZOA 2Y1NA 4GFTA 1WLZA 4BY4A 5F6TA 1W7IB 4MN0A 1YX8A 2PALA 1NWDA 5PALA 2JRFA 5BPJA 1MHOA 2BBNA 1L7ZA 2WCFA 2Q91A 4HREE 4AOMA 5HKZA 2Q4UA 1DJWA 1EJ3A 1XFUO 3OB1B 4GGFC 2H2KA 2KDHA 2P6BB 1BJFA 3SIAA 2JNFA 2HQWA 4HSZA 2KNEA 2LANA 2WNDA 3PM8A 1XK4A 4PE0A 5IBWA 1QS7A 1PVBA 2F8PA 3E3RA 4IL1A 3CLNA 3O6BA 2B1UA 2K61A 1S36A 3C1VA 4MRXA 4AQJA 1XFWO 1PRWA 1S5GY 1VRKA 3EK7A 1KK8C 1KFXL 1XYDA 4YBHB 1PULA 4FTGA 1X02A 3SG3A 1L2OC 3I5FB 5D69A 1GJYA 2L4IA 5JJGA 2JWWA 1SL8A 2G2BA 1NX2A 3I5IC 2FCEA 2HETA 3KHEA 4CLNA 5I2OA 2AMIA 3NSKA 3K21A 1KFUL 2ZRSA 2L98A 3PFVA 1EH2A 3TDZA 4PALA 4CPVA 1XFXO 1IQ3A 1KWOC 1B8RA 1QATA 1IWQA 1WY9A 1ZACA 1OMRA 1ZFSA 1CNPA 1QLKA 2KAXA 2PASA 2CT9A 2JPTA 1QTXA 3RLZA 2L0PA 3TS5C 1EXRA 1XK4C 1Y1XA 2F33A 4PE7A 1DF0B 1PSBA 2L5XB 3D0YB 1AJ5A 2M8UA 3O2PA 2LMTA 4PHKA 1XFZO 2I18A 2HPSA 1OMDA 1DJZA 2LAPA 2LVJA 1RJVA 3KO0A 1YRTB 3BUXB 2M0RA 2KFHA 5DKRA 3OX6A 2LUCA 1Y0VH 1SBJA 1U5IB 1WDCB 1DF0A 1QLSA 3I5GB 5J3XA 4OKHA 5I2QA 1UURA 4Q04A 3D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9U A;  4HRG A;  1YVH A;  2JT8 A;  2JTZ A;  3BOW B;  1ZOT B;  5K89 A;  1K94 A;  3CR2 A;  1XVJ A;  4E68 A;  2QPT A;  1DJX A;  3GK4 X;  2D8N A;  3BUO B;  1MWN A;  4I5L B;  2ZKM X;  1BR1 B;  1F4Q A;  2M97 A;  1KFX S;  4P2Y B;  5FYX A;  4A4B A;  4C0K A;  1YRU B;  1CM1 A;  3GK1 A;  4NDD A;  3IF7 A;  4ORB B;  4QJ5 B;  1IH0 A;  4MZK A;  3NXA A;  2WCE A;  3EKJ A;  3AAK A;  1AJ4 A;  2WC8 A;  1Y6W A;  3I5H B;  3SG2 A;  4YI9 A;  3LLE A;  4DRW A;  1BU3 A;  1JF0 A;  2HF5 A;  3ICB A;  1H8B A;  1QX7 A;  4PHN A;  2ISD A;  2GGM A;  1YUR A;  2K7B A;  1G4Y R;  1XO5 A;  2GV5 A;  1RFJ A;  2K7O A;  2KGR A;  4XYN A;  5I8N A;  1G33 A;  4D1E A;  4MRY A;  1LA0 A;  1SCM B;  1KFU S;  1BLQ A;  4USL A;  4YGB B;  3BUW B;  1M39 A;  1B8C A;  3WHT B;  1A03 A;  2OPO A;  2LC5 A;  1KSO A;  3HX4 A;  1DGV A;  3PN7 B;  2F2P A;  3ZWH A;  3BXK A;  2BKI B;  2ZN8 A;  3EK4 A;  1UHN A;  1J1E A;  2RGI A;  1GGZ A;  2BCB A;  3SG5 A;  2M1K B;  5AXI A;  1YX7 A;  4NQG A;  1TNP A;  4MSP A;  3SIB A;  5AAN A;  1CB1 A;  3VGO A;  1BF5 A;  5TNC A;  1TCF A;  2COL B;  1CFP A;  1LVC D;  2M1U A;  1YTZ C;  3FIA A;  1TIZ A;  2IS9 A;  4PE4 A;  5KTY A;  1SMG A;  3IQO A;  2L4H A;  1WDC C;  2LLU A;  3VRR A;  3WHU B;  5HYD A;  4ORA B;  2KI4 B;  3I5G C;  1K95 A;  3A8R A;  1C7V A;  3VRP A;  1K90 D;  1SL9 A;  1TRF A;  1FF1 A;  2KBM A;  4GAO A;  4PCW A;  2LHI A;  2LMV A;  1AVS A;  2KOT A;  2QAC A;  4U8D A;  1FI5 A;  2JT0 A;  2Y5I A;  3LL8 B;  1MR8 A;  2BKH B;  5GQQ C;  1OQP A;  1J7Q A;  3PAT A;  1NX1 A;  5ER5 A;  2LP2 A;  4GPL B;  1SRA A;  1LIN A;  2BE6 A;  3AKB A;  1M63 B;  3I5H C;  3WXA A;  1IJ5 A;  1AUI B;  2LUX A;  2JZI A;  3TUY B;  4CFQ A;  4UPG A;  4WQ2 A;  2KYF A;  1K96 A;  2JQ6 A;  3CWG A;  3KF9 A;  4DIR A;  1E8A A;  3SG7 A;  1CFC A;  1UP5 A;  1TNX A;  3PN7 C;  4I5N B;  1IQ5 A;  1IRJ A;  4M2O A;  5CSI A;  1F71 A;  2G9B A;  1MUX A;  3EVR A;  1B7T Z;  1QV1 A;  5KSZ A;  1S3P A;  1EL4 A;  4M2P A;  1MXL C;  1PK0 D;  4I5K A;  1FI6 A;  1OOJ A;  1J7R A;  1M45 A;  3RM1 A;  2F2O A;  1DGU A;  4PE1 A;  1QX2 A;  3CZT X;  4BY5 A;  1J7O A;  1ODB A;  1UHK A;  1AK8 A;  4ZCV A;  2K0J A;  1JSA A;  2JTT A;  1K8U A;  2KFF A;  1ALV A;  2NXQ A;  1Q80 A;  2PSR A;  2KYC A;  3BYA A;  1ALW A;  1IG5 A;  1PSR A;  1PVA A;  4OR9 B;  4ETO A;  2EC6 B;  1SKT A;  1DT7 B;  1TNW A;  2BEC A;  1DMO A;  2KI4 C;  4YGA A;  1SY9 A;  1KQM B;  2CTN A;  1YUU A;  2WCB A;  2LM5 A;  5CSJ A;  1KK7 Z;  1WRK A;  3DVJ A;  2A4J A;  4L9M A;  2M3W A;  3EVU A;  3M0W A;  4TNC A;  1F54 A;  3PLF B;  3DVE A;  1TNQ A;  3NSI A;  2LHL A;  5HKY A;  1PAL A;  1RK9 A;  4XJK B;  1M46 A;  1N2D A;  1QVI Z;  2KI6 C;  1YUT A;  2AAO A;  1B4C A;  3DF0 B;  3DD4 A;  1DJI A;  2OS8 B;  3I5F C;  2KGB C;  5B8I B;  2KFG A;  1CMG A;  1V1F A;  4ZCU A;  5AER A;  1U5I A;  2K2F A;  3IQQ A;  2L2E A;  2OTG B;  2CBL A;  1WRL A;  2BCX A;  1Y1U A;  3TUY C;  2TN4 A;  2LVK A;  3FWB A;  5AFP A;  1JWD A;  3EK8 A;  1B1G A;  3CGA A;  3BOW A;  5AEQ A;  1BG1 A;  2FJU B;  1CLL A;  4XJK A;  3TZ1 A;  1WRZ A;  4YI8 A;  2O5G A;  1MQ1 A;  5HLV A;  3DF0 A;  1XFY O;  1NUB A;  2JXL A;  3VRN A;  2BL0 B;  3O4Y A;  1GGW A;  4QJ3 B;  2MHH A;  3LK0 A;  5G08 A;  1B7T Y;  3CS1 A;  4YGC B;  1IKU A;  3TDU A;  4FQO A;  2ZND A;  4ORC B;  1LXF C;  4YGE B;  4C0L A;  5HLO A;  1BR4 B;  2M49 B;  1QX5 B;  1JF2 A;  1FPW A;  2AUC A;  2JC2 A;  2KI6 D;  2M29 A;  1S6J A;  3CR5 X;  4JQ0 D;  4OVN F;  3KEV A;  3MSE B;  4HRH A;  2EGD A;  2PVB A;  3AKA A;  2JT3 A;  3DVM A;  3PSR A;  1UWO A;  2M9G A;  2EHB A;  3OHM B;  5D7F A;  1TTX A;  3CR4 X;  1K93 D;  5DKN A;  2O60 A;  3JVT B;  1SR6 B;  2BCA A;  2KAY A;  4MEW A;  4M2Q A;  1OE9 B;  4MBE A;  3DVK A;  2ZNE A;  1CMF A;  2WOR A;  2FOT A;  1OSA A;  1R2U A;  3BUM B;  2H61 A;  1ZMZ A;  2E6W A;  2JOJ A;  1DJG A;  2LP3 A;  1Y1A A;  1R6P A;  1UHH A;  1KQM C;  1KK7 Y;  1NPQ A;  1QXP A;  3BQ3 A;  3FS7 A;  4PHJ A;  4DS7 A;  1JFK A;  5ER4 X;  3VRO A;  2JU0 A;  1CFD A;  3H4S E;  1SNL A;  4R1E A;  3VRQ A;  2KHN A;  2Y1M A;  3LCP C;  3A4U B;  1QVI Y;  2KAV A;  3TS5 B;  1NYA A;  1UHI A;  4MZL A;  4NDC A;  5CSF A;  1IGV A;  1SK6 D;  1B47 A;  2OS8 C;  1K9P A;  1BT6 A;  4GNK B;  1QIV A;  3O78 A;  4OV2 A;  1NSH A;  1KQV A;  4JPZ B;  1JC2 A;  2OTG C;  2I94 A;  4MLW A;  1OZS A;  1BOC A;  4NDB A;  1C07 A;  3OP0 A;  2KBI A;  1TOP A;  1J1D A;  2CNP A;  1KSM A;  1NCZ A;  1ZUZ A;  1HQV A;  2PMY A;  3NSL A;  2BL0 C;  4GBA A;  1SCM C;  3CTN A;  4CID A;  2ZFD A;  2MAZ A;  1JFJ A;  1G8I A;  1SYM A;  1SPY A;  2H61 C;  1NP8 A;  1S26 D;  3F45 A;  2MBX A;  2VRG A;  3GOF A;  1CDL A;  2E30 A;  3LK1 A;  3HCM A;  1DVI A;  1K9K A;  1FW4 A;  1BOD A;  1WLM A;  1SL7 A;  3JVT C;  2BE4 A;  2M7L A;  1SR6 C;  2KQ6 A;  4PHM A;  5CSN A;  4YRU A;  1F8H A;  1CLM A;  2KQY A;  2JUL A;  3JTD B;  1B9A A;  2MLE C;  1MXE A;  1XA5 A;  1LA3 A;  5CPV A;  1A4P A;  1FBV A;  1DTL A;  2LLS A;  2CCM A;  1YR5 A;  1KCY A;  2SCP A;  1A75 B;  1TN4 A;  4N1F A;  2ZN9 A;  1CTR A;  2SAS A;  2LCP A;  1NX3 A;  2Y4Q A;  1S6C A;  3QRX A;  1UHJ A;  5DKQ A;  2MA2 A;  2F3Z A;  2MJW B;  1JBA A;  3SG4 A;  2FCD A;  2LNK A;  1CDP A;  1OMV A;  1RRO A;  1N65 A;  1NCX A;  2BBM A;  2JXC A;  1AHR A;  1F70 A;  4QJ4 B;  1DJH A;  2GGZ A;  1H4B A;  1F4O A;  2HQ8 A;  4N5X A;  4C0J A;  2F3Y A;  4N1G A;  1SCV A;  1A75 A;  2LMU A;  1CLB A;  1LKJ A;  2K8M B;  2M7N A;  2NZ0 A;  4JWQ A;  4WRI A;  2I2R E;  4DCK A;  4MVF A;  3KPX A;  2K7D A;  1NX0 A;  5HKW A;  3GK2 A;  4WQ3 A;  3D10 A;  1DJY A;  3SJS A;  2K7C A;  1MF8 B;  1D1O A;  2ZRT A;  5KU1 A;  1F55 A;  2R2I A;  2JNX A;  1B8L A;  2NCO A;  1GQM A;  1EG4 A;  1BMO A;  2LV7 A;  4ICB A;  4OCI A;  3WNX B;  1CDN A;  4AQI A;  4MZJ A;  1RTP 1;  4DUQ A;  1NIW A;  1K2H A;  3EVV A;  3SG6 A;  2MLF C;  4A4C A;  1A29 A;  3OX5 A;  1JUO A;  4GUK A;  1EG3 A;  1M31 A;  1QAS A;  3PAL A;  4F0Z B;  2V53 A;  4YGD B;  2LE9 B;  2MRD A;  1V1G A;  3AAJ A;  1C7W A;  1J55 A;  1CFF A;  1KK8 B;  1S1E A;  4P5O E;  2WOS A;  1S5G Z;  4PDZ A;  1AP4 A;  3EKH A;  1N0Y A;  2LVI A;  3ZNI A;  1L2O B;  1CKK A;  4GGF A;  3OB2 B;  1SW8 A;  1CM4 A;  5I2L A;  1UUS A;  1RWY A;  3NSO A;  2KSP A;  1QIW A;  3JTD C;  1REC A;  3I5I B;  2PRU A;  3FWC A;  2CXJ A;  2LLT A;  2LVV A;  2EC6 C;  1YUS A;  5JOL A;  1S6I A;  1QJT A;  1CDM A;  3TDI A;  1HT9 A;  2NCP A;  1TCO B;  1XFV O;  1NCY A;  1QV0 A;  4I5J A;  2NLN A;  4CFR A;  1KWO B;  1J7P A;  1YVL A;  2L51 A;  1IJ6 A;  1W7J B;  1A2X A;  3BUN B;  2K2A A;  2L50 A;  4GGN A;  2I7A A;  2DOQ A;  1OZO A;  2Y1N A;  4GFT A;  1WLZ A;  4BY4 A;  5F6T A;  1W7I B;  4MN0 A;  1YX8 A;  2PAL A;  1NWD A;  5PAL A;  2JRF A;  5BPJ A;  1MHO A;  2BBN A;  1L7Z A;  2WCF A;  2Q91 A;  4HRE E;  4AOM A;  5HKZ A;  2Q4U A;  1DJW A;  1EJ3 A;  1XFU O;  3OB1 B;  4GGF C;  2H2K A;  2KDH A;  2P6B B;  1BJF A;  3SIA A;  2JNF A;  2HQW A;  4HSZ A;  2KNE A;  2LAN A;  2WND A;  3PM8 A;  1XK4 A;  4PE0 A;  5IBW A;  1QS7 A;  1PVB A;  2F8P A;  3E3R A;  4IL1 A;  3CLN A;  3O6B A;  2B1U A;  2K61 A;  1S36 A;  3C1V A;  4MRX A;  4AQJ A;  1XFW O;  1PRW A;  1S5G Y;  1VRK A;  3EK7 A;  1KK8 C;  1KFX L;  1XYD A;  4YBH B;  1PUL A;  4FTG A;  1X02 A;  3SG3 A;  1L2O C;  3I5F B;  5D69 A;  1GJY A;  2L4I A;  5JJG A;  2JWW A;  1SL8 A;  2G2B A;  1NX2 A;  3I5I C;  2FCE A;  2HET A;  3KHE A;  4CLN A;  5I2O A;  2AMI A;  3NSK A;  3K21 A;  1KFU L;  2ZRS A;  2L98 A;  3PFV A;  1EH2 A;  3TDZ A;  4PAL A;  4CPV A;  1XFX O;  1IQ3 A;  1KWO C;  1B8R A;  1QAT A;  1IWQ A;  1WY9 A;  1ZAC A;  1OMR A;  1ZFS A;  1CNP A;  1QLK A;  2KAX A;  2PAS A;  2CT9 A;  2JPT A;  1QTX A;  3RLZ A;  2L0P A;  3TS5 C;  1EXR A;  1XK4 C;  1Y1X A;  2F33 A;  4PE7 A;  1DF0 B;  1PSB A;  2L5X B;  3D0Y B;  1AJ5 A;  2M8U A;  3O2P A;  2LMT A;  4PHK A;  1XFZ O;  2I18 A;  2HPS A;  1OMD A;  1DJZ A;  2LAP A;  2LVJ A;  1RJV A;  3KO0 A;  1YRT B;  3BUX B;  2M0R A;  2KFH A;  5DKR A;  3OX6 A;  2LUC A;  1Y0V H;  1SBJ A;  1U5I B;  1WDC B;  1DF0 A;  1QLS A;  3I5G B;  5J3X A;  4OKH A;  5I2Q A;  1UUR A;  4Q04 A;  3D0Y A; 
#chains in the Genus database with same CATH topology
 1K9U A;  4HRG A;  1YVH A;  2JT8 A;  2JTZ A;  3BOW B;  1ZOT B;  4PT1 A;  5K89 A;  1K94 A;  3CR2 A;  1XVJ A;  4E68 A;  2QPT A;  1DJX A;  3GK4 X;  2D8N A;  3BUO B;  1MWN A;  3OBV A;  4I5L B;  2FJY A;  1BR1 B;  2ZKM X;  1OW4 A;  1F4Q A;  2M97 A;  1KFX S;  4P2Y B;  2P71 A;  5FYX A;  1IIO A;  2ERB A;  4A4B A;  1YRU B;  1CM1 A;  3GK1 A;  4NDD A;  3IF7 A;  4ORB B;  4C0K A;  4QJ5 B;  1IH0 A;  4MZK A;  3NXA A;  2WCE A;  3EKJ A;  2P70 A;  3AAK A;  1AJ4 A;  2WC8 A;  1Y6W A;  3I5H B;  3SG2 A;  4YI9 A;  2QEO A;  3LLE A;  4DRW A;  1BU3 A;  1JF0 A;  2HF5 A;  3ICB A;  1H8B A;  3DYE A;  1QX7 A;  4PHN A;  2ISD A;  2GGM A;  1YUR A;  2K7B A;  1G4Y R;  1XO5 A;  2GV5 A;  1RFJ A;  2K7O A;  2KGR A;  4XYN A;  1DEK A;  5I8N A;  1G33 A;  4D1E A;  4MRY A;  1LA0 A;  1SCM B;  3DY9 A;  1KFU S;  1BLQ A;  4USL A;  4YGB B;  3BUW B;  1M39 A;  1B8C A;  3WHT B;  1A03 A;  2OPO A;  2LC5 A;  1KSO A;  3HX4 A;  1DGV A;  3PN7 B;  2F2P A;  3ZWH A;  3BXK A;  1OOH A;  2BKI B;  2ZN8 A;  3EK4 A;  5D3O A;  1UHN A;  1J1E A;  2RGI A;  1GGZ A;  2BCB A;  3SG5 A;  2M1K B;  5AXI A;  1YX7 A;  4NQG A;  1TNP A;  1DQE A;  3CAB A;  4MSP A;  3SIB A;  5AAN A;  1CB1 A;  3VGO A;  1BF5 A;  5TNC A;  1TCF A;  2COL B;  1CFP A;  1LVC D;  3CZ0 A;  2M1U A;  1YTZ C;  3FIA A;  1TIZ A;  2IS9 A;  4PE4 A;  5KTY A;  1SMG A;  3IQO A;  2L4H A;  1WDC C;  2LLU A;  3VRR A;  3WHU B;  5HYD A;  4ORA B;  2KI4 B;  3I5G C;  1K95 A;  3A8R A;  1C7V A;  3VRP A;  1K90 D;  1SL9 A;  1TRF A;  1FF1 A;  2KBM A;  4GAO A;  4PCW A;  2LHI A;  2LMV A;  1AVS A;  2KOT A;  2QAC A;  4U8D A;  1FI5 A;  2JT0 A;  2Y5I A;  3B6X A;  2WCM A;  3S0D A;  3LL8 B;  1MR8 A;  2BKH B;  5GQQ C;  1OQP A;  1OOF A;  1J7Q A;  3L47 A;  1NX1 A;  3PAT A;  5ER5 A;  2LP2 A;  4GPL B;  1SRA A;  1LIN A;  2BE6 A;  3AKB A;  1M63 B;  3I5H C;  3D76 A;  2KPH A;  3WXA A;  1IJ5 A;  2WCH A;  1AUI B;  3NGV A;  2LUX A;  3BFA A;  2JZI A;  3TUY B;  1Z4H A;  4CFQ A;  2K60 A;  4UPG A;  4WQ2 A;  2KYF A;  2PYQ A;  1K96 A;  2JQ6 A;  3CWG A;  5FI7 A;  3KF9 A;  4DIR A;  1E8A A;  3SG7 A;  1CFC A;  1UP5 A;  1TNX A;  3PN7 C;  4I5N B;  1IQ5 A;  1IRJ A;  4M2O A;  5CSI A;  1F71 A;  2G9B A;  1MUX A;  3EVR A;  1B7T Z;  1QV1 A;  5KSZ A;  1S3P A;  1EL4 A;  4M2P A;  1MXL C;  1PK0 D;  4I5K A;  1FI6 A;  1OOJ A;  1J7R A;  1M45 A;  3RM1 A;  3IVT A;  1XFR A;  2F2O A;  1DGU A;  4PE1 A;  1W9Z A;  1QX2 A;  3CZT X;  4BY5 A;  1J7O A;  1ODB A;  1UHK A;  1AK8 A;  4ZCV A;  2K0J A;  1JSA A;  2JTT A;  1K8U A;  2KFF A;  1ALV A;  2NXQ A;  1Q80 A;  2PSR A;  2KYC A;  1OOI X;  3BYA A;  1ALW A;  1IG5 A;  3S0F A;  1PSR A;  1PVA A;  4OR9 B;  3V2L A;  2WCK A;  3BFB A;  4ETO A;  2EC6 B;  1SKT A;  2YGU A;  1DT7 B;  3CZ1 A;  1TNW A;  2BEC A;  1DMO A;  2KI4 C;  4YGA A;  1SY9 A;  1KQM B;  2CTN A;  1YUU A;  2WCB A;  2LM5 A;  2L5Y A;  3NHT A;  5CSJ A;  1KK7 Z;  1WRK A;  3DVJ A;  2A4J A;  4L9M A;  2M3W A;  3EVU A;  3M0W A;  4TNC A;  1F54 A;  2KLD A;  3PLF B;  3DVE A;  1TNQ A;  3NSI A;  2LHL A;  5HKY A;  1PAL A;  1RK9 A;  2BNX A;  4XJK B;  1M46 A;  1N2D A;  1QVI Z;  2KI6 C;  1YUT A;  2AAO A;  1B4C A;  3DF0 B;  3DD4 A;  1DJI A;  2OS8 B;  3NHI A;  3I5F C;  3B86 A;  2KGB C;  5B8I B;  2KFG A;  2PQL A;  1CMG A;  1V1F A;  4ZCU A;  5AER A;  1U5I A;  2K2F A;  3IQQ A;  2L2E A;  2OTG B;  2CBL A;  1WRL A;  2BCX A;  3VB1 A;  3S0A A;  1Y1U A;  4JD9 A;  3TUY C;  2TN4 A;  2LVK A;  3FWB A;  5AFP A;  1JWD A;  3EK8 A;  1B1G A;  3CGA A;  3BOW A;  5AEQ A;  1BG1 A;  2FJU B;  1CLL A;  4XJK A;  3TZ1 A;  1WRZ A;  4YI8 A;  2O5G A;  1MQ1 A;  3R1P A;  3DF0 A;  5HLV A;  1XFY O;  1NUB A;  2JXL A;  3VRN A;  2BL0 B;  3D78 A;  3O4Y A;  1GGW A;  4QJ3 B;  2MHH A;  3LK0 A;  5G08 A;  1B7T Y;  3CS1 A;  4YGC B;  1IKU A;  3TDU A;  4FQO A;  2ZND A;  4ORC B;  1LXF C;  4YGE B;  4C0L A;  5HLO A;  1BR4 B;  2M49 B;  1QX5 B;  1JF2 A;  1FPW A;  2AUC A;  2JC2 A;  2KI6 D;  2M29 A;  1S6J A;  3CR5 X;  3D0Y A;  4JQ0 D;  3KEV A;  3MSE B;  4HRH A;  2EGD A;  2PVB A;  4OVN F;  3AKA A;  2JT3 A;  3DVM A;  3PSR A;  1UWO A;  2M9G A;  2EHB A;  3CDN A;  3OHM B;  5D7F A;  1TTX A;  3CR4 X;  4JKT A;  1K93 D;  5DKN A;  2O60 A;  3L4L A;  3JVT B;  1SR6 B;  2BCA A;  2KAY A;  2QEH A;  4MEW A;  4M2Q A;  1OE9 B;  4MBE A;  3DVK A;  2ZNE A;  1CMF A;  2WOR A;  2FOT A;  1OSA A;  1R2U A;  3BUM B;  2H61 A;  1ZMZ A;  2E6W A;  2JOJ A;  1DJG A;  3SS5 A;  4INX A;  2LP3 A;  1Y1A A;  1R6P A;  1UHH A;  1KQM C;  1KK7 Y;  1NPQ A;  1QXP A;  1P28 A;  3BQ3 A;  3FS7 A;  4PHJ A;  1JFK A;  5ER4 X;  3VRO A;  4DS7 A;  1DC1 A;  2JU0 A;  1CFD A;  3H4S E;  1SNL A;  4R1E A;  3RZS A;  3VRQ A;  1C3Z A;  2KHN A;  2Y1M A;  3LCP C;  3A4U B;  3B87 A;  1QVI Y;  1TUJ A;  2KAV A;  3TS5 B;  1NYA A;  1UHI A;  4MZL A;  4NDC A;  5CSF A;  1IGV A;  1OOG A;  1B47 A;  1SK6 D;  2OS8 C;  1K9P A;  4IJ7 A;  1BT6 A;  4GNK B;  1QIV A;  3O78 A;  4OV2 A;  1NSH A;  1KQV A;  4JPZ B;  1JC2 A;  2OTG C;  2I94 A;  5FI2 A;  4MLW A;  1OZS A;  1BOC A;  4NDB A;  1C07 A;  2WCJ A;  3OP0 A;  2KBI A;  1TOP A;  1J1D A;  2CNP A;  1KSM A;  1NCZ A;  1ZUZ A;  1HQV A;  2PMY A;  3NSL A;  2BL0 C;  4GBA A;  1SCM C;  3CTN A;  4CID A;  2QDI A;  2ZFD A;  2MAZ A;  1JFJ A;  1G8I A;  1SYM A;  1SPY A;  2H61 C;  1NP8 A;  1S26 D;  3F45 A;  2MBX A;  2VRG A;  3GOF A;  1CDL A;  3OGN A;  2E30 A;  3LK1 A;  3HCM A;  1DVI A;  1K9K A;  5HL1 A;  1FW4 A;  1BOD A;  1WLM A;  3D74 A;  1SL7 A;  3JVT C;  2BE4 A;  2M7L A;  1SR6 C;  2KQ6 A;  4PHM A;  2WCL A;  3FE6 A;  5CSN A;  4YRU A;  1F8H A;  4INW A;  1CLM A;  2KQY A;  2JUL A;  5I94 A;  3JTD B;  1B9A A;  2MLE C;  1MXE A;  1XA5 A;  1LA3 A;  5CPV A;  1A4P A;  1FBV A;  1DTL A;  2LLS A;  2CCM A;  1YR5 A;  1KCY A;  2SCP A;  1A75 B;  1TN4 A;  4N1F A;  2ZN9 A;  1CTR A;  2SAS A;  2LCP A;  1NX3 A;  3N7H A;  2Y4Q A;  1S6C A;  3QRX A;  1Z2C B;  1UHJ A;  5DKQ A;  2MA2 A;  2F3Z A;  2MJW B;  1JBA A;  3SG4 A;  2FCD A;  2LNK A;  3R1V A;  1LS8 A;  1CDP A;  1OMV A;  1RRO A;  1N65 A;  1NCX A;  2BBM A;  2JXC A;  1AHR A;  1F70 A;  4QJ4 B;  1C3Y A;  1DJH A;  2GGZ A;  1H4B A;  3UO9 A;  2L2C A;  1F4O A;  2WC6 A;  2HQ8 A;  4N5X A;  4C0J A;  2F3Y A;  4N1G A;  1SCV A;  1A75 A;  2LMU A;  1CLB A;  1LKJ A;  3S0E A;  1GM0 A;  2K8M B;  2M7N A;  2NZ0 A;  4JWQ A;  4WRI A;  2I2R E;  4DCK A;  4MVF A;  3KPX A;  5DIC A;  2K7D A;  1NX0 A;  3S0B A;  5HKW A;  3GK2 A;  4WQ3 A;  3D10 A;  1DJY A;  3SJS A;  2K7C A;  1MF8 B;  2QEB A;  2ZRT A;  1D1O A;  5KU1 A;  1F55 A;  2R2I A;  2JNX A;  1B8L A;  2NCO A;  1GQM A;  1EG4 A;  1BMO A;  2LV7 A;  4ICB A;  4OCI A;  3WNX B;  1CDN A;  4AQI A;  4MZJ A;  1RTP 1;  4DUQ A;  1NIW A;  1K2H A;  3EVV A;  3SG6 A;  2MLF C;  4A4C A;  1A29 A;  3OX5 A;  1JUO A;  4GUK A;  1EG3 A;  1M31 A;  3L4A A;  1QAS A;  3PAL A;  2KLE A;  2V53 A;  3D75 A;  4YGD B;  2LE9 B;  3UNW A;  4F0Z B;  2MRD A;  1V1G A;  3AAJ A;  1C7W A;  1J55 A;  1CFF A;  1KK8 B;  1S1E A;  4P5O E;  2WOS A;  1S5G Z;  4PDZ A;  1AP4 A;  3EKH A;  1N0Y A;  2LVI A;  3BJH A;  3ZNI A;  1L2O B;  1CKK A;  4GGF A;  3OB2 B;  1SW8 A;  1CM4 A;  3DZT A;  5I2L A;  1UUS A;  1RWY A;  3NSO A;  2KSP A;  1QIW A;  3JTD C;  1REC A;  3O4X A;  3I5I B;  2PRU A;  3FE8 A;  3FWC A;  2CXJ A;  2LLT A;  2LVV A;  2EC6 C;  1YUS A;  5JOL A;  1S6I A;  1QJT A;  1CDM A;  3TDI A;  1HT9 A;  2NCP A;  1TCO B;  1XFV O;  1NCY A;  1QV0 A;  2JPO A;  4I5J A;  3FE9 A;  2NLN A;  4CFR A;  1KWO B;  1J7P A;  1YVL A;  2L51 A;  1IJ6 A;  1W7J B;  1A2X A;  3BUN B;  2K2A A;  2L50 A;  4GGN A;  5FI6 A;  2I7A A;  2DOQ A;  1OZO A;  2Y1N A;  4GFT A;  1WLZ A;  4BY4 A;  5F6T A;  1W7I B;  1ORG A;  4MN0 A;  3R1O A;  1YX8 A;  2PAL A;  1NWD A;  3Q8I A;  5PAL A;  3SS4 A;  2JRF A;  3PM2 A;  5BPJ A;  3QME A;  1MHO A;  2BBN A;  1L7Z A;  2WCF A;  2Q91 A;  4HRE E;  4AOM A;  1T14 A;  3EG5 B;  3S0G A;  5HKZ A;  2WC5 A;  2Q4U A;  1DJW A;  1EJ3 A;  1XFU O;  3OB1 B;  4GGF C;  2H2K A;  2KDH A;  2P6B B;  1BJF A;  3SIA A;  2JNF A;  3D73 A;  2HQW A;  4HSZ A;  2KNE A;  2LAN A;  2WND A;  3PM8 A;  1XK4 A;  4KYN A;  4PE0 A;  1QS7 A;  5IBW A;  1PVB A;  2F8P A;  3E3R A;  4IL1 A;  3CLN A;  3O6B A;  2B1U A;  2K61 A;  1S36 A;  3C1V A;  4MRX A;  4AQJ A;  1XFW O;  1PRW A;  2GTE A;  1S5G Y;  4FQT A;  1VRK A;  3EK7 A;  1KK8 C;  1KFX L;  1XYD A;  4YBH B;  1PUL A;  3CZ2 A;  4FTG A;  1X02 A;  3SG3 A;  1L2O C;  3I5F B;  4F7F A;  5D69 A;  1GJY A;  2L4I A;  3B7A A;  5JJG A;  2JWW A;  1SL8 A;  2G2B A;  1NX2 A;  1DEL A;  3I5I C;  1TWO A;  2FCE A;  2HET A;  1TUZ A;  3KHE A;  4CLN A;  5I2O A;  2AMI A;  3NSK A;  3CYZ A;  3K21 A;  1KFU L;  2ZRS A;  2L98 A;  3PFV A;  1EH2 A;  3TDZ A;  4PAL A;  4CPV A;  1XFX O;  3PJI A;  1IQ3 A;  1KWO C;  1B8R A;  1QAT A;  1IWQ A;  1WY9 A;  1ZAC A;  1OMR A;  1ZFS A;  1CNP A;  1QLK A;  3B88 A;  2KAX A;  2PAS A;  2CT9 A;  2JPT A;  4OZD A;  1QTX A;  3D77 A;  3RLZ A;  2L0P A;  3TS5 C;  3DXL A;  1EXR A;  1XK4 C;  1Y1X A;  2F33 A;  3K1E A;  4PE7 A;  1DF0 B;  1PSB A;  2L5X B;  3D0Y B;  3SS3 A;  1AJ5 A;  5EL2 A;  2M8U A;  3O2P A;  2LMT A;  4PHK A;  1XFZ O;  2I18 A;  2HPS A;  1OMD A;  1DJZ A;  2LAP A;  2LVJ A;  3BFH A;  2BAP A;  1RJV A;  3KO0 A;  1YRT B;  3BUX B;  1QWV A;  2M0R A;  2KFH A;  5DKR A;  3OX6 A;  2LUC A;  1Y0V H;  1SBJ A;  1U5I B;  1WDC B;  2QEV A;  1SSE B;  3R72 A;  1DF0 A;  1QLS A;  3I5G B;  5J3X A;  4OKH A;  5I2Q A;  1UUR A;  4Q04 A;  2H8V A; 
#chains in the Genus database with same CATH homology
 1K9U A;  4HRG A;  1YVH A;  2JT8 A;  2JTZ A;  3BOW B;  1ZOT B;  5K89 A;  1K94 A;  3CR2 A;  1XVJ A;  4E68 A;  2QPT A;  1DJX A;  3GK4 X;  2D8N A;  3BUO B;  1MWN A;  4I5L B;  2ZKM X;  1BR1 B;  1F4Q A;  2M97 A;  1KFX S;  4P2Y B;  5FYX A;  4A4B A;  4C0K A;  1YRU B;  1CM1 A;  3GK1 A;  4NDD A;  3IF7 A;  4ORB B;  4QJ5 B;  1IH0 A;  4MZK A;  3NXA A;  2WCE A;  3EKJ A;  3AAK A;  1AJ4 A;  2WC8 A;  1Y6W A;  3I5H B;  3SG2 A;  4YI9 A;  3LLE A;  4DRW A;  1BU3 A;  1JF0 A;  2HF5 A;  3ICB A;  1H8B A;  1QX7 A;  4PHN A;  2ISD A;  2GGM A;  1YUR A;  2K7B A;  1G4Y R;  1XO5 A;  2GV5 A;  1RFJ A;  2K7O A;  2KGR A;  4XYN A;  5I8N A;  1G33 A;  4D1E A;  4MRY A;  1LA0 A;  1SCM B;  1KFU S;  1BLQ A;  4USL A;  4YGB B;  3BUW B;  1M39 A;  1B8C A;  3WHT B;  1A03 A;  2OPO A;  2LC5 A;  1KSO A;  3HX4 A;  1DGV A;  3PN7 B;  2F2P A;  3ZWH A;  3BXK A;  2BKI B;  2ZN8 A;  3EK4 A;  1UHN A;  1J1E A;  2RGI A;  1GGZ A;  2BCB A;  3SG5 A;  2M1K B;  5AXI A;  1YX7 A;  4NQG A;  1TNP A;  4MSP A;  3SIB A;  5AAN A;  1CB1 A;  3VGO A;  1BF5 A;  5TNC A;  1TCF A;  2COL B;  1CFP A;  1LVC D;  2M1U A;  1YTZ C;  3FIA A;  1TIZ A;  2IS9 A;  4PE4 A;  5KTY A;  1SMG A;  3IQO A;  2L4H A;  1WDC C;  2LLU A;  3VRR A;  3WHU B;  5HYD A;  4ORA B;  2KI4 B;  3I5G C;  1K95 A;  3A8R A;  1C7V A;  3VRP A;  1K90 D;  1SL9 A;  1TRF A;  1FF1 A;  2KBM A;  4GAO A;  4PCW A;  2LHI A;  2LMV A;  1AVS A;  2KOT A;  2QAC A;  4U8D A;  1FI5 A;  2JT0 A;  2Y5I A;  3LL8 B;  1MR8 A;  2BKH B;  5GQQ C;  1OQP A;  1J7Q A;  3PAT A;  1NX1 A;  5ER5 A;  2LP2 A;  4GPL B;  1SRA A;  1LIN A;  2BE6 A;  3AKB A;  1M63 B;  3I5H C;  3WXA A;  1IJ5 A;  1AUI B;  2LUX A;  2JZI A;  3TUY B;  4CFQ A;  4UPG A;  4WQ2 A;  2KYF A;  1K96 A;  2JQ6 A;  3CWG A;  3KF9 A;  4DIR A;  1E8A A;  3SG7 A;  1CFC A;  1UP5 A;  1TNX A;  3PN7 C;  4I5N B;  1IQ5 A;  1IRJ A;  4M2O A;  5CSI A;  1F71 A;  2G9B A;  1MUX A;  3EVR A;  1B7T Z;  1QV1 A;  5KSZ A;  1S3P A;  1EL4 A;  4M2P A;  1MXL C;  1PK0 D;  4I5K A;  1FI6 A;  1OOJ A;  1J7R A;  1M45 A;  3RM1 A;  2F2O A;  1DGU A;  4PE1 A;  1QX2 A;  3CZT X;  4BY5 A;  1J7O A;  1ODB A;  1UHK A;  1AK8 A;  4ZCV A;  2K0J A;  1JSA A;  2JTT A;  1K8U A;  2KFF A;  1ALV A;  2NXQ A;  1Q80 A;  2PSR A;  2KYC A;  3BYA A;  1ALW A;  1IG5 A;  1PSR A;  1PVA A;  4OR9 B;  4ETO A;  2EC6 B;  1SKT A;  1DT7 B;  1TNW A;  2BEC A;  1DMO A;  2KI4 C;  4YGA A;  1SY9 A;  1KQM B;  2CTN A;  1YUU A;  2WCB A;  2LM5 A;  5CSJ A;  1KK7 Z;  1WRK A;  3DVJ A;  2A4J A;  4L9M A;  2M3W A;  3EVU A;  3M0W A;  4TNC A;  1F54 A;  3PLF B;  3DVE A;  1TNQ A;  3NSI A;  2LHL A;  5HKY A;  1PAL A;  1RK9 A;  4XJK B;  1M46 A;  1N2D A;  1QVI Z;  2KI6 C;  1YUT A;  2AAO A;  1B4C A;  3DF0 B;  3DD4 A;  1DJI A;  2OS8 B;  3I5F C;  2KGB C;  5B8I B;  2KFG A;  1CMG A;  1V1F A;  4ZCU A;  5AER A;  1U5I A;  2K2F A;  3IQQ A;  2L2E A;  2OTG B;  2CBL A;  1WRL A;  2BCX A;  1Y1U A;  3TUY C;  2TN4 A;  2LVK A;  3FWB A;  5AFP A;  1JWD A;  3EK8 A;  1B1G A;  3CGA A;  3BOW A;  5AEQ A;  1BG1 A;  2FJU B;  1CLL A;  4XJK A;  3TZ1 A;  1WRZ A;  4YI8 A;  2O5G A;  1MQ1 A;  5HLV A;  3DF0 A;  1XFY O;  1NUB A;  2JXL A;  3VRN A;  2BL0 B;  3O4Y A;  1GGW A;  4QJ3 B;  2MHH A;  3LK0 A;  5G08 A;  1B7T Y;  3CS1 A;  4YGC B;  1IKU A;  3TDU A;  4FQO A;  2ZND A;  4ORC B;  1LXF C;  4YGE B;  4C0L A;  5HLO A;  1BR4 B;  2M49 B;  1QX5 B;  1JF2 A;  1FPW A;  2AUC A;  2JC2 A;  2KI6 D;  2M29 A;  1S6J A;  3CR5 X;  4JQ0 D;  4OVN F;  3KEV A;  3MSE B;  4HRH A;  2EGD A;  2PVB A;  3AKA A;  2JT3 A;  3DVM A;  3PSR A;  1UWO A;  2M9G A;  2EHB A;  3OHM B;  5D7F A;  1TTX A;  3CR4 X;  1K93 D;  5DKN A;  2O60 A;  3JVT B;  1SR6 B;  2BCA A;  2KAY A;  4MEW A;  4M2Q A;  1OE9 B;  4MBE A;  3DVK A;  2ZNE A;  1CMF A;  2WOR A;  2FOT A;  1OSA A;  1R2U A;  3BUM B;  2H61 A;  1ZMZ A;  2E6W A;  2JOJ A;  1DJG A;  2LP3 A;  1Y1A A;  1R6P A;  1UHH A;  1KQM C;  1KK7 Y;  1NPQ A;  1QXP A;  3BQ3 A;  3FS7 A;  4PHJ A;  4DS7 A;  1JFK A;  5ER4 X;  3VRO A;  2JU0 A;  1CFD A;  3H4S E;  1SNL A;  4R1E A;  3VRQ A;  2KHN A;  2Y1M A;  3LCP C;  3A4U B;  1QVI Y;  2KAV A;  3TS5 B;  1NYA A;  1UHI A;  4MZL A;  4NDC A;  5CSF A;  1IGV A;  1SK6 D;  1B47 A;  2OS8 C;  1K9P A;  1BT6 A;  4GNK B;  1QIV A;  3O78 A;  4OV2 A;  1NSH A;  1KQV A;  4JPZ B;  1JC2 A;  2OTG C;  2I94 A;  4MLW A;  1OZS A;  1BOC A;  4NDB A;  1C07 A;  3OP0 A;  2KBI A;  1TOP A;  1J1D A;  2CNP A;  1KSM A;  1NCZ A;  1ZUZ A;  1HQV A;  2PMY A;  3NSL A;  2BL0 C;  4GBA A;  1SCM C;  3CTN A;  4CID A;  2ZFD A;  2MAZ A;  1JFJ A;  1G8I A;  1SYM A;  1SPY A;  2H61 C;  1NP8 A;  1S26 D;  3F45 A;  2MBX A;  2VRG A;  3GOF A;  1CDL A;  2E30 A;  3LK1 A;  3HCM A;  1DVI A;  1K9K A;  1FW4 A;  1BOD A;  1WLM A;  1SL7 A;  3JVT C;  2BE4 A;  2M7L A;  1SR6 C;  2KQ6 A;  4PHM A;  5CSN A;  4YRU A;  1F8H A;  1CLM A;  2KQY A;  2JUL A;  3JTD B;  1B9A A;  2MLE C;  1MXE A;  1XA5 A;  1LA3 A;  5CPV A;  1A4P A;  1FBV A;  1DTL A;  2LLS A;  2CCM A;  1YR5 A;  1KCY A;  2SCP A;  1A75 B;  1TN4 A;  4N1F A;  2ZN9 A;  1CTR A;  2SAS A;  2LCP A;  1NX3 A;  2Y4Q A;  1S6C A;  3QRX A;  1UHJ A;  5DKQ A;  2MA2 A;  2F3Z A;  2MJW B;  1JBA A;  3SG4 A;  2FCD A;  2LNK A;  1CDP A;  1OMV A;  1RRO A;  1N65 A;  1NCX A;  2BBM A;  2JXC A;  1AHR A;  1F70 A;  4QJ4 B;  1DJH A;  2GGZ A;  1H4B A;  1F4O A;  2HQ8 A;  4N5X A;  4C0J A;  2F3Y A;  4N1G A;  1SCV A;  1A75 A;  2LMU A;  1CLB A;  1LKJ A;  2K8M B;  2M7N A;  2NZ0 A;  4JWQ A;  4WRI A;  2I2R E;  4DCK A;  4MVF A;  3KPX A;  2K7D A;  1NX0 A;  5HKW A;  3GK2 A;  4WQ3 A;  3D10 A;  1DJY A;  3SJS A;  2K7C A;  1MF8 B;  1D1O A;  2ZRT A;  5KU1 A;  1F55 A;  2R2I A;  2JNX A;  1B8L A;  2NCO A;  1GQM A;  1EG4 A;  1BMO A;  2LV7 A;  4ICB A;  4OCI A;  3WNX B;  1CDN A;  4AQI A;  4MZJ A;  1RTP 1;  4DUQ A;  1NIW A;  1K2H A;  3EVV A;  3SG6 A;  2MLF C;  4A4C A;  1A29 A;  3OX5 A;  1JUO A;  4GUK A;  1EG3 A;  1M31 A;  1QAS A;  3PAL A;  4F0Z B;  2V53 A;  4YGD B;  2LE9 B;  2MRD A;  1V1G A;  3AAJ A;  1C7W A;  1J55 A;  1CFF A;  1KK8 B;  1S1E A;  4P5O E;  2WOS A;  1S5G Z;  4PDZ A;  1AP4 A;  3EKH A;  1N0Y A;  2LVI A;  3ZNI A;  1L2O B;  1CKK A;  4GGF A;  3OB2 B;  1SW8 A;  1CM4 A;  5I2L A;  1UUS A;  1RWY A;  3NSO A;  2KSP A;  1QIW A;  3JTD C;  1REC A;  3I5I B;  2PRU A;  3FWC A;  2CXJ A;  2LLT A;  2LVV A;  2EC6 C;  1YUS A;  5JOL A;  1S6I A;  1QJT A;  1CDM A;  3TDI A;  1HT9 A;  2NCP A;  1TCO B;  1XFV O;  1NCY A;  1QV0 A;  4I5J A;  2NLN A;  4CFR A;  1KWO B;  1J7P A;  1YVL A;  2L51 A;  1IJ6 A;  1W7J B;  1A2X A;  3BUN B;  2K2A A;  2L50 A;  4GGN A;  2I7A A;  2DOQ A;  1OZO A;  2Y1N A;  4GFT A;  1WLZ A;  4BY4 A;  5F6T A;  1W7I B;  4MN0 A;  1YX8 A;  2PAL A;  1NWD A;  5PAL A;  2JRF A;  5BPJ A;  1MHO A;  2BBN A;  1L7Z A;  2WCF A;  2Q91 A;  4HRE E;  4AOM A;  5HKZ A;  2Q4U A;  1DJW A;  1EJ3 A;  1XFU O;  3OB1 B;  4GGF C;  2H2K A;  2KDH A;  2P6B B;  1BJF A;  3SIA A;  2JNF A;  2HQW A;  4HSZ A;  2KNE A;  2LAN A;  2WND A;  3PM8 A;  1XK4 A;  4PE0 A;  5IBW A;  1QS7 A;  1PVB A;  2F8P A;  3E3R A;  4IL1 A;  3CLN A;  3O6B A;  2B1U A;  2K61 A;  1S36 A;  3C1V A;  4MRX A;  4AQJ A;  1XFW O;  1PRW A;  1S5G Y;  1VRK A;  3EK7 A;  1KK8 C;  1KFX L;  1XYD A;  4YBH B;  1PUL A;  4FTG A;  1X02 A;  3SG3 A;  1L2O C;  3I5F B;  5D69 A;  1GJY A;  2L4I A;  5JJG A;  2JWW A;  1SL8 A;  2G2B A;  1NX2 A;  3I5I C;  2FCE A;  2HET A;  3KHE A;  4CLN A;  5I2O A;  2AMI A;  3NSK A;  3K21 A;  1KFU L;  2ZRS A;  2L98 A;  3PFV A;  1EH2 A;  3TDZ A;  4PAL A;  4CPV A;  1XFX O;  1IQ3 A;  1KWO C;  1B8R A;  1QAT A;  1IWQ A;  1WY9 A;  1ZAC A;  1OMR A;  1ZFS A;  1CNP A;  1QLK A;  2KAX A;  2PAS A;  2CT9 A;  2JPT A;  1QTX A;  3RLZ A;  2L0P A;  3TS5 C;  1EXR A;  1XK4 C;  1Y1X A;  2F33 A;  4PE7 A;  1DF0 B;  1PSB A;  2L5X B;  3D0Y B;  1AJ5 A;  2M8U A;  3O2P A;  2LMT A;  4PHK A;  1XFZ O;  2I18 A;  2HPS A;  1OMD A;  1DJZ A;  2LAP A;  2LVJ A;  1RJV A;  3KO0 A;  1YRT B;  3BUX B;  2M0R A;  2KFH A;  5DKR A;  3OX6 A;  2LUC A;  1Y0V H;  1SBJ A;  1U5I B;  1WDC B;  1DF0 A;  1QLS A;  3I5G B;  5J3X A;  4OKH A;  5I2Q A;  1UUR A;  4Q04 A;  3D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...