3M0WA

Structure of s100a4 with pcp
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding protein
molecule keywords Protein S100-A4
publication title Structure of S100A4 with PCP
rcsb
source organism Homo sapiens
total genus 30
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3m0wA00
1K9PA 2KYCA 1L2OB 2BKIB 5F6TA 5AANA 4USLA 1M39A 2JXCA 1AJ5A 1IWQA 1CLLA 1K95A 1DJWA 2LMUA 3PLFB 3IQQA 3TS5C 2OS8B 1ALVA 1JWDA 1YVHA 2KGRA 2V53A 2MHHA 2LCPA 1JSAA 2JULA 2KAYA 1EL4A 1YR5A 3NSLA 2L51A 2LMTA 5CSNA 1OSAA 1DGVA 1QIWA 3NSKA 5I2OA 1XK4A 2E30A 2K2FA 2Q4UA 3FIAA 4PHKA 1YVLA 1MXLC 1OMRA 4GBAA 4OCIA 3I5IB 2MJWB 2BE6A 2LLSA 3PALA 3BUOB 1MQ1A 2KBIA 3LK1A 4P5OE 3RM1A 1A4PA 5HYDA 2Y1NA 4PE7A 4N5XA 1KSOA 3D0YA 5D7FA 4MVFA 1A75A 4N1GA 4A4CA 3BUWB 3IF7A 1MWNA 2OS8C 3BQ3A 1BODA 4YI9A 2BBMA 3VRRA 1JC2A 3D0YB 1A75B 4XYNA 1WRKA 1GGWA 3CTNA 1XFYO 1S6JA 2M1UA 5I8NA 3PM8A 3WHTB 1K93D 5IBWA 2L50A 2ISDA 4HRHA 1Y6WA 2F8PA 2KHNA 3OHMB 1U5IA 2MBXA 1MXEA 3I5IC 1OMVA 1Y1UA 4HRGA 2Q91A 1QLSA 1B1GA 1M45A 1HT9A 4WRIA 4Q04A 4QJ5B 1U5IB 2FJUB 2JNFA 4MLWA 2WC8A 1MUXA 1J7QA 1QX5B 1SL9A 1IQ5A 1E8AA 1QV1A 1C7VA 2GGZA 2JT0A 2LHLA 1JBAA 1AJ4A 1DJIA 1UHNA 1UP5A 5ER4X 3FWCA 1BG1A 1NCYA 2F3ZA 3GOFA 2WNDA 2P6BB 2M29A 1M31A 2KGBC 3LL8B 1BU3A 1ZMZA 3KEVA 4CPVA 1K96A 1SMGA 1BOCA 3WNXB 4CFQA 1WY9A 2Y1MA 2M7LA 4DUQA 2Y4QA 3O6BA 1PALA 1J7OA 1IGVA 1QASA 3LK0A 3VRPA 5JJGA 3AKBA 3IQOA 3NSOA 2PMYA 2AAOA 1NX1A 2KAVA 2KI6C 4L9MA 4ZCVA 1PSRA 4MRYA 1VRKA 2F3YA 3A4UB 2K7OA 4NDCA 2JT8A 2NZ0A 2LVKA 1YRTB 1S5GY 1B8CA 2LANA 3JVTC 1AHRA 2KI6D 1DF0A 4A4BA 1SNLA 1NWDA 1V1FA 4E68A 1S6CA 1TCFA 1MHOA 4MZKA 4FQOA 1KQMB 1JF0A 1RTP1 4PHMA 2LV7A 1XYDA 2M97A 5DKNA 4ICBA 1DF0B 2CT9A 1IRJA 3I5HB 2NCPA 2LP3A 3VROA 1J7PA 4GAOA 5KU1A 4NQGA 2SCPA 1UHIA 1ODBA 2KDHA 2LLUA 3BUXB 4GGFA 1QVIY 4FTGA 4YI8A 1QJTA 1NSHA 5ER5A 3SG5A 2LUCA 3KPXA 5AXIA 1SPYA 4PALA 4XJKA 3WHUB 1TNWA 2F33A 1AK8A 4PE1A 4YGCB 1B7TZ 1XVJA 1DJGA 4PE0A 1QV0A 5I2LA 1MF8B 4N1FA 2PALA 3KO0A 1KQMC 1X02A 1KK8B 1EG4A 4XJKB 4DS7A 1B8LA 4JQ0D 4YRUA 1YX8A 2H61C 1KFXL 3LLEA 2OPOA 1CDPA 2ZRSA 4BY5A 1DJZA 2TN4A 2FCEA 3DVKA 2B1UA 1IJ5A 2I7AA 4DIRA 4QJ3B 1S3PA 3I5GB 1JF2A 2L4IA 1K9UA 2AMIA 3PN7B 2LVVA 1DMOA 1FI5A 2KFFA 3CR4X 4HSZA 4AQIA 1WRLA 3ZWHA 1NYAA 1XO5A 2L5XB 1PVAA 4UPGA 3TDUA 1QLKA 4GGFC 1H8BA 1NP8A 2FCDA 2ZFDA 4CIDA 1CM1A 1WDCB 2ZKMX 1CM4A 2O5GA 3CS1A 1F71A 1F55A 1L2OC 5KSZA 1B9AA 1CDMA 1KK8C 2K61A 1SCMB 1WLZA 1IG5A 2JZIA 3FS7A 1SR6B 1YTZC 2BL0B 2K7BA 2OTGB 2SASA 2G2BA 3GK1A 4I5LB 3NSIA 1FPWA 1BMOA 2K8MB 2LC5A 1UURA 2ZNEA 1M46A 2CTNA 3OX5A 2HPSA 4PHNA 1RK9A 3I5GC 4DRWA 4CFRA 2GV5A 2MAZA 1NX3A 3OX6A 1R6PA 4I5KA 3RLZA 1IQ3A 2JOJA 1CNPA 3AAJA 3SIAA 3PN7C 1YUTA 1OZSA 4MSPA 3WXAA 1NX2A 2HQ8A 2KQ6A 1CFPA 1XFWO 1D1OA 3JTDB 1Y0VH 3HX4A 1KFUL 1C07A 5TNCA 1BLQA 1KSMA 1QATA 1R2UA 1J1DA 2MLEC 2I18A 1WDCC 1A29A 1KFXS 4JWQA 1XK4C 2KAXA 1LINA 1N2DA 1TNQA 3CR2A 3H4SE 1RROA 3CLNA 5KTYA 1QX2A 3HCMA 4WQ2A 3E3RA 5CSIA 4M2OA 5JOLA 1SR6C 2OTGC 2BL0C 1Y1AA 4OKHA 5DKQA 2JXLA 2KQYA 3F45A 5PALA 4MZJA 3TDZA 2JWWA 3SG2A 1RWYA 3SG7A 1YRUB 4TNCA 1IH0A 2QPTA 1B8RA 1XA5A 1S36A 5HKYA 5AEQA 1LA0A 1C7WA 2R2IA 1LXFC 1XFVO 2COLB 1TIZA 1TNXA 4MEWA 3TUYB 1S26D 2L2EA 1SL8A 1NIWA 3BOWA 4C0JA 5CPVA 3BUMB 2QACA 2LVIA 1KCYA 3TDIA 1MR8A 1SY9A 3SJSA 1LA3A 4MRXA 4QJ4B 1CKKA 3BOWB 3BUNB 4JPZB 1TTXA 1W7IB 2NCOA 2WOSA 4PE4A 3KHEA 3BYAA 2M3WA 5CSFA 1N0YA 1OZOA 1ZOTB 5B8IB 1XFZO 4AOMA 1BR4B 3AKAA 4HREE 3EK8A 1UWOA 1SL7A 2E6WA 2K2AA 1ZACA 1KFUS 1Y1XA 5AERA 1CMGA 3DVEA 2H2KA 3KF9A 1KK7Z 3VGOA 2LVJA 1G4YR 4PDZA 1DJYA 4F0ZB 4OV2A 1A03A 1LKJA 2BE4A 2O60A 2CCMA 2NLNA 1K2HA 1GJYA 4NDDA 4GNKB 5D69A 5G08A 2RGIA 3CGAA 3QRXA 4ORAB 1DTLA 5GQQC 2MLFC 1EJ3A 2EC6B 1K8UA 1PK0D 1RFJA 5FYXA 4AQJA 1YX7A 1IJ6A 1OMDA 2BCBA 1TNPA 3OB1B 4WQ3A 2G9BA 3CR5X 3EKJA 1J1EA 3MSEB 1NCXA 1J7RA 3DVMA 5I2QA 1Q80A 2PSRA 3PATA 4I5NB 1SYMA 1DJHA 1K94A 2JT3A 3SG6A 1HQVA 2JQ6A 1NX0A 1YUUA 2L4HA 1K90D 1DJXA 3I5HC 3PSRA 1CFCA 4MN0A 4BY4A 4YGDB 5HKWA 1CMFA 2HQWA 2M0RA 3CWGA 2MRDA 2KYFA 2KI4B 3K21A 1K9KA 3O4YA 2EC6C 2HF5A 2LUXA 2HETA 1NCZA 2M7NA 1F54A 1OOJA 4U8DA 5K89A 2WCBA 2JPTA 1TN4A 5CSJA 1N65A 5AFPA 1QIVA 4ORBB 1JFJA 1SW8A 1EG3A 3LCPC 1UUSA 3SG3A 1BJFA 4MZLA 3DF0A 1ALWA 1FW4A 2WCFA 2ZN9A 1B7TY 4R1EA 3EVRA 2DOQA 3EKHA 1TRFA 4OVNF 1YURA 2L98A 1CFDA 1KWOB 3DF0B 2F2OA 5BPJA 1DGUA 3GK4X 1G8IA 2KI4C 4M2QA 2JRFA 1RJVA 2CNPA 2L0PA 1SBJA 2PRUA 1CLBA 2M9GA 1QTXA 3C1VA 1L7ZA 1NUBA 1S6IA 2JTZA 1QS7A 4P2YB 4ORCB 1ZUZA 2KFHA 1W7JB 2ZRTA 1FI6A 2EGDA 1XFUO 1SKTA 2NXQA 1AVSA 2K7DA 1SCMC 2VRGA 2KFGA 2M8UA 1SCVA 1F4OA 1FBVA 3I5FB 1JFKA 1S1EA 1DVIA 3VRNA 4ETOA 1KWOC 1B4CA 1J55A 4GUKA 1TCOB 4C0KA 1BR1B 1IKUA 2D8NA 2GGMA 2ZN8A 5DKRA 3ZNIA 2WORA 4GPLB 1S5GZ 3OB2B 1YUSA 3JTDC 3PFVA 5HLVA 3VRQA 2MA2A 1V1GA 1BT6A 4M2PA 3M0WA 2KOTA 2LM5A 3AAKA 4IL1A 1WLMA 3JVTB 2F2PA 3D10A 3BXKA 1LVCD 1B47A 1A2XA 2CBLA 5HLOA 4D1EA 1PRWA 2LE9B 3NXAA 3I5FC 2AUCA 1QVIZ 4GFTA 1GGZA 1M63B 3TZ1A 4DCKA 1FF1A 3O2PA 2LNKA 1KQVA 2M1KB 4PHJA 1PSBA 3A8RA 2LMVA 2BKHB 2LP2A 1CDLA 4CLNA 1NPQA 4C0LA 1CTRA 1JUOA 3EVVA 2JTTA 2K7CA 3EK4A 4I5JA 1AUIB 4YBHB 1OQPA 1F4QA 3TUYC 1RECA 1F8HA 3OP0A 4ZCUA 1CDNA 3CZTX 4PCWA 1CLMA 2I94A 1PULA 2M49B 2PASA 3DVJA 2Y5IA 2H61A 3FWBA 5HKZA 1XFXO 3SIBA 2BCXA 1H4BA 1QX7A 2LAPA 2WCEA 1CB1A 1PVBA 2BBNA 2BECA 4YGEB 1ZFSA 2KNEA 2LHIA 2I2RE 1EXRA 3EK7A 2K0JA 2JNXA 4MBEA 2FOTA 2KBMA 1WRZA 3TS5B 1QXPA 4GGNA 2LLTA 4NDBA 2JU0A 1GQMA 1BF5A 2A4JA 4OR9B 5J3XA 1OE9B 1G33A 2PVBA 2EHBA 2ZNDA 1F70A 4YGAA 4YGBB 2BCAA 3EVUA 1AP4A 3O78A 3GK2A 1SK6D 1UHKA 1UHJA 2KSPA 1CFFA 3ICBA 1KK7Y 2JC2A 1DT7B 1UHHA 1SRAA 1TOPA 2CXJA 3SG4A 2IS9A 1EH2A 3DD4A
chains in the Genus database with same CATH superfamily
1K9PA 1P28A 1L2OB 2BKIB 2KYCA 5F6TA 5AANA 4USLA 1M39A 2JXCA 1AJ5A 1IWQA 1CLLA 1K95A 3S0FA 1DJWA 2LMUA 3PLFB 3IQQA 3TS5C 2OS8B 1ALVA 1SSEB 1JWDA 1YVHA 2KGRA 2V53A 2MHHA 2LCPA 1JSAA 2JULA 2L2CA 2KAYA 1EL4A 1YR5A 3NSLA 2L51A 2LMTA 5CSNA 1OSAA 1DGVA 1QIWA 3NSKA 3L4LA 5I2OA 1XK4A 2E30A 3D75A 2K2FA 2Q4UA 3FIAA 4PHKA 1YVLA 1MXLC 1OMRA 4GBAA 4OCIA 3I5IB 2MJWB 2BE6A 2LLSA 3PALA 3BUOB 1MQ1A 1DEKA 2KBIA 3LK1A 3NHIA 4P5OE 1A4PA 3RM1A 2Y1NA 4PE7A 4N5XA 5HYDA 1KSOA 3D0YA 5D7FA 4MVFA 1A75A 4N1GA 2YGUA 4A4CA 1W9ZA 3BUWB 3IF7A 1MWNA 2OS8C 2QEHA 3BQ3A 1BODA 4YI9A 2BBMA 3VRRA 1JC2A 3S0DA 3D0YB 1A75B 3L47A 4XYNA 1WRKA 1OOFA 5HL1A 1GGWA 3PM2A 3CTNA 1XFYO 1S6JA 2M1UA 5I8NA 3PM8A 3WHTB 1K93D 5IBWA 2L50A 2ISDA 4HRHA 3R72A 1Y6WA 2F8PA 2KHNA 3OHMB 1U5IA 2MBXA 1MXEA 3I5IC 3PJIA 1OMVA 1Y1UA 4HRGA 3DYEA 2Q91A 1QLSA 3D78A 1M45A 1B1GA 1HT9A 3D77A 4WRIA 4Q04A 3CABA 4QJ5B 1U5IB 2FJUB 2JNFA 4MLWA 1DC1A 3DY9A 2WC8A 1MUXA 1J7QA 1QX5B 3BFAA 1SL9A 1IQ5A 1E8AA 1QV1A 1OOGA 1C7VA 2GGZA 2JT0A 2LHLA 1JBAA 1AJ4A 1DJIA 1UHNA 1UP5A 5ER4X 3FWCA 2PQLA 1BG1A 1NCYA 2F3ZA 3GOFA 2WNDA 2P6BB 2M29A 1DELA 1M31A 1QWVA 2KGBC 3LL8B 1BU3A 1ZMZA 3KEVA 4CPVA 1K96A 1SMGA 1BOCA 3WNXB 4CFQA 1WY9A 2Y1MA 2M7LA 4DUQA 2Y4QA 3S0GA 3O6BA 1PALA 1J7OA 1IGVA 1QASA 3LK0A 3VRPA 5JJGA 3AKBA 3IQOA 3NSOA 2PMYA 2AAOA 1NX1A 2KAVA 2KI6C 4L9MA 4ZCVA 1PSRA 3OBVA 4MRYA 1VRKA 2F3YA 3A4UB 2K7OA 4NDCA 2JT8A 2NZ0A 2LVKA 5FI2A 1YRTB 1S5GY 1B8CA 2LANA 3JVTC 2WCJA 1AHRA 2KI6D 2KPHA 4JKTA 1DF0A 4A4BA 1SNLA 1NWDA 1V1FA 4E68A 1S6CA 1TCFA 1MHOA 4MZKA 4FQOA 1KQMB 1JF0A 1RTP1 4PHMA 2LV7A 1XYDA 2M97A 2K60A 5DKNA 2H8VA 4ICBA 1DF0B 2CT9A 1IRJA 3I5HB 2NCPA 2LP3A 3CZ1A 3VROA 1J7PA 4GAOA 5KU1A 4NQGA 2SCPA 1UHIA 1ODBA 2KDHA 2LLUA 3BUXB 4GGFA 1QVIY 4FTGA 4YI8A 1QJTA 1TUZA 1NSHA 5ER5A 3SG5A 2KLEA 2LUCA 3FE9A 3KPXA 5AXIA 1SPYA 4PALA 4XJKA 3WHUB 1TNWA 2F33A 3R1OA 1AK8A 4PE1A 4YGCB 1B7TZ 1XVJA 1DJGA 4PE0A 1QV0A 5I2LA 1MF8B 4N1FA 2PALA 3KO0A 1KQMC 1X02A 1KK8B 1EG4A 3R1VA 4XJKB 4DS7A 1B8LA 3IVTA 4JQ0D 4YRUA 5EL2A 1YX8A 2H61C 1KFXL 3LLEA 1Z2CB 4PT1A 2OPOA 1CDPA 2ZRSA 4BY5A 1DJZA 2TN4A 2FCEA 3DVKA 2B1UA 1IJ5A 2I7AA 4DIRA 4QJ3B 1S3PA 3I5GB 3RZSA 1JF2A 2L4IA 1K9UA 2P70A 2AMIA 3PN7B 2LVVA 1DMOA 1FI5A 2KFFA 3CR4X 4JD9A 4HSZA 4AQIA 1WRLA 3ZWHA 1NYAA 1XO5A 2L5XB 1PVAA 4UPGA 3TDUA 1QLKA 4GGFC 1H8BA 1NP8A 5I94A 2FCDA 1OW4A 2ZFDA 1CM1A 3DXLA 4CIDA 1WDCB 2ZKMX 1CM4A 2O5GA 3CS1A 1F71A 1F55A 1L2OC 5KSZA 1B9AA 1CDMA 1KK8C 2K61A 1SCMB 1WLZA 1IG5A 2JZIA 3FS7A 5FI6A 1SR6B 1YTZC 2BL0B 2K7BA 2OTGB 2SASA 2G2BA 3GK1A 4I5LB 3NSIA 1FPWA 1BMOA 2K8MB 2LC5A 3NHTA 1UURA 3L4AA 2ZNEA 1M46A 2CTNA 3OX5A 2HPSA 4PHNA 1RK9A 2WC6A 3I5GC 4DRWA 4CFRA 2GV5A 2MAZA 1NX3A 3OX6A 1R6PA 4I5KA 5D3OA 3RLZA 1IQ3A 2JOJA 1CNPA 3AAJA 3SIAA 3PN7C 1YUTA 1OZSA 4MSPA 3WXAA 1NX2A 2HQ8A 2KQ6A 1CFPA 1XFWO 1D1OA 3JTDB 1Y0VH 3B7AA 1KFUL 3HX4A 3N7HA 5TNCA 1KSMA 1BLQA 1QATA 1C07A 2WCHA 1R2UA 1J1DA 2MLEC 2I18A 1WDCC 1A29A 1KFXS 4JWQA 1XK4C 2KAXA 1LINA 1N2DA 1TNQA 3CR2A 3H4SE 1RROA 3CLNA 5KTYA 1QX2A 3HCMA 4WQ2A 3E3RA 5CSIA 4M2OA 5JOLA 1SR6C 2OTGC 2BL0C 1Y1AA 4OKHA 5DKQA 2JXLA 2KQYA 3F45A 5PALA 4MZJA 3TDZA 1C3YA 2JWWA 3SG2A 1RWYA 3SG7A 1YRUB 4TNCA 1IH0A 2QPTA 1B8RA 1XA5A 1S36A 5HKYA 5AEQA 1LA0A 3BJHA 1C7WA 2R2IA 2JPOA 1LXFC 1XFVO 2COLB 3S0EA 1TIZA 1TNXA 4MEWA 3TUYB 1S26D 2L2EA 1SL8A 1NIWA 3BOWA 4C0JA 5CPVA 3VB1A 3BUMB 2QACA 2LVIA 1KCYA 3TDIA 1MR8A 2WCLA 3S0BA 1SY9A 3SJSA 1LA3A 4MRXA 4QJ4B 1CKKA 3BOWB 3BUNB 4JPZB 1TTXA 1W7IB 2NCOA 3B6XA 2WOSA 4PE4A 3KHEA 3BYAA 3SS4A 2M3WA 3Q8IA 5CSFA 1N0YA 1OZOA 1ZOTB 5B8IB 1XFZO 3BFHA 4AOMA 1BR4B 3AKAA 2PYQA 4HREE 3EK8A 2BAPA 1UWOA 1SL7A 2E6WA 2K2AA 1ZACA 1KFUS 1Y1XA 5AERA 1CMGA 3DVEA 2H2KA 3KF9A 1KK7Z 3VGOA 2LVJA 1G4YR 4PDZA 1DJYA 4F0ZB 1C3ZA 4OV2A 1A03A 1LKJA 2BE4A 2O60A 5FI7A 2CCMA 2NLNA 1K2HA 1GJYA 4NDDA 4GNKB 5D69A 5G08A 2RGIA 3CGAA 3QRXA 4ORAB 1DTLA 5GQQC 2MLFC 1EJ3A 2EC6B 1K8UA 3FE8A 1PK0D 1RFJA 5FYXA 4AQJA 1YX7A 1IJ6A 1OMDA 2BCBA 1TNPA 3OB1B 4WQ3A 2G9BA 3CR5X 3EKJA 1GM0A 1J1EA 3MSEB 1NCXA 1J7RA 3DVMA 5I2QA 3DZTA 1Q80A 3CDNA 2PSRA 3PATA 3QMEA 4I5NB 1SYMA 1DJHA 1K94A 2JT3A 3SG6A 1HQVA 2JQ6A 1NX0A 1YUUA 2L4HA 1K90D 1DJXA 3I5HC 3PSRA 3CZ2A 1CFCA 2BNXA 4MN0A 4BY4A 4YGDB 3V2LA 5HKWA 2QEOA 2WC5A 1CMFA 2HQWA 2M0RA 3CWGA 3R1PA 2MRDA 2KYFA 2KI4B 3K21A 1K9KA 3O4YA 2EC6C 2HF5A 2LUXA 2HETA 1NCZA 2M7NA 1F54A 1OOJA 4U8DA 5K89A 2WCKA 2WCBA 1XFRA 2JPTA 1TN4A 5CSJA 1N65A 5AFPA 1QIVA 3D76A 1TUJA 4ORBB 2QEBA 1SW8A 1JFJA 1EG3A 3LCPC 1UUSA 3SG3A 1BJFA 4MZLA 3DF0A 1ALWA 1FW4A 3S0AA 2WCFA 2ZN9A 1B7TY 4R1EA 3EVRA 2QDIA 2DOQA 1IIOA 3EKHA 2QEVA 1TRFA 4OVNF 1YURA 2L98A 1CFDA 1KWOB 3DF0B 2F2OA 5BPJA 1DGUA 3GK4X 3OGNA 1G8IA 2KI4C 4M2QA 2JRFA 1RJVA 2CNPA 2L0PA 1SBJA 2PRUA 4KYNA 1CLBA 2M9GA 1QTXA 3C1VA 1L7ZA 2KLDA 1NUBA 1S6IA 4F7FA 4OZDA 2GTEA 2JTZA 1QS7A 4P2YB 4ORCB 1ZUZA 2KFHA 1W7JB 3SS3A 2ZRTA 1FI6A 2EGDA 1XFUO 1SKTA 2NXQA 4IJ7A 1AVSA 2K7DA 1SCMC 2VRGA 2KFGA 2M8UA 3B86A 2ERBA 3B88A 1ORGA 1SCVA 1F4OA 1FBVA 3I5FB 1JFKA 1S1EA 1DVIA 3VRNA 4ETOA 3UNWA 1KWOC 3D73A 1B4CA 1J55A 4GUKA 1TCOB 4C0KA 1BR1B 1IKUA 2D8NA 2GGMA 3FE6A 2ZN8A 5DKRA 3ZNIA 2WORA 4GPLB 1S5GZ 1EH2A 3OB2B 1YUSA 1TWOA 3JTDC 3PFVA 3O4XA 5HLVA 3VRQA 2MA2A 1V1GA 1T14A 3EG5B 1BT6A 4M2PA 3M0WA 2KOTA 2LM5A 3AAKA 4INXA 1WLMA 3JVTB 4IL1A 3SS5A 3K1EA 2F2PA 3NGVA 3D10A 3BXKA 1LVCD 1B47A 1A2XA 2CBLA 1OOHA 5HLOA 4D1EA 2WCMA 1PRWA 3BFBA 2LE9B 3NXAA 3I5FC 2P71A 2AUCA 1QVIZ 4GFTA 1GGZA 1M63B 3TZ1A 4DCKA 1FF1A 3O2PA 2LNKA 1KQVA 2M1KB 4PHJA 1PSBA 3A8RA 2LMVA 4INWA 2BKHB 2LP2A 1CDLA 4CLNA 1NPQA 4C0LA 1CTRA 1JUOA 3EVVA 2JTTA 2K7CA 3EK4A 4I5JA 1AUIB 4YBHB 1OQPA 1F4QA 3TUYC 1RECA 1F8HA 3OP0A 4ZCUA 1CDNA 3CZTX 4PCWA 1CLMA 2I94A 1PULA 2M49B 2PASA 3DVJA 1OOIX 2Y5IA 2H61A 3FWBA 5HKZA 1XFXO 3SIBA 2BCXA 4FQTA 1H4BA 1QX7A 2LAPA 2WCEA 1CB1A 1PVBA 2BBNA 2BECA 4YGEB 1ZFSA 2KNEA 2LHIA 3CYZA 2I2RE 1EXRA 1Z4HA 3CZ0A 3EK7A 2K0JA 2FJYA 2JNXA 2FOTA 2KBMA 1WRZA 4MBEA 3TS5B 1QXPA 4GGNA 1LS8A 2LLTA 4NDBA 2JU0A 1GQMA 3UO9A 1BF5A 1DQEA 2A4JA 4OR9B 2L5YA 5J3XA 1OE9B 1G33A 2PVBA 2EHBA 2ZNDA 1F70A 4YGAA 4YGBB 2BCAA 3EVUA 1AP4A 3O78A 3GK2A 1SK6D 1UHKA 1UHJA 5DICA 2KSPA 1CFFA 3ICBA 1KK7Y 2JC2A 1DT7B 1UHHA 1SRAA 1TOPA 2CXJA 3SG4A 2IS9A 3D74A 3DD4A 3B87A
chains in the Genus database with same CATH topology
1K9PA 2KYCA 1L2OB 2BKIB 5F6TA 5AANA 4USLA 1M39A 2JXCA 1AJ5A 1IWQA 1CLLA 1K95A 1DJWA 2LMUA 3PLFB 3IQQA 3TS5C 2OS8B 1ALVA 1JWDA 1YVHA 2KGRA 2V53A 2MHHA 2LCPA 1JSAA 2JULA 2KAYA 1EL4A 1YR5A 3NSLA 2L51A 2LMTA 5CSNA 1OSAA 1DGVA 1QIWA 3NSKA 5I2OA 1XK4A 2E30A 2K2FA 2Q4UA 3FIAA 4PHKA 1YVLA 1MXLC 1OMRA 4GBAA 4OCIA 3I5IB 2MJWB 2BE6A 2LLSA 3PALA 3BUOB 1MQ1A 2KBIA 3LK1A 4P5OE 3RM1A 1A4PA 5HYDA 2Y1NA 4PE7A 4N5XA 1KSOA 3D0YA 5D7FA 4MVFA 1A75A 4N1GA 4A4CA 3BUWB 3IF7A 1MWNA 2OS8C 3BQ3A 1BODA 4YI9A 2BBMA 3VRRA 1JC2A 3D0YB 1A75B 4XYNA 1WRKA 1GGWA 3CTNA 1XFYO 1S6JA 2M1UA 5I8NA 3PM8A 3WHTB 1K93D 5IBWA 2L50A 2ISDA 4HRHA 1Y6WA 2F8PA 2KHNA 3OHMB 1U5IA 2MBXA 1MXEA 3I5IC 1OMVA 1Y1UA 4HRGA 2Q91A 1QLSA 1B1GA 1M45A 1HT9A 4WRIA 4Q04A 4QJ5B 1U5IB 2FJUB 2JNFA 4MLWA 2WC8A 1MUXA 1J7QA 1QX5B 1SL9A 1IQ5A 1E8AA 1QV1A 1C7VA 2GGZA 2JT0A 2LHLA 1JBAA 1AJ4A 1DJIA 1UHNA 1UP5A 5ER4X 3FWCA 1BG1A 1NCYA 2F3ZA 3GOFA 2WNDA 2P6BB 2M29A 1M31A 2KGBC 3LL8B 1BU3A 1ZMZA 3KEVA 4CPVA 1K96A 1SMGA 1BOCA 3WNXB 4CFQA 1WY9A 2Y1MA 2M7LA 4DUQA 2Y4QA 3O6BA 1PALA 1J7OA 1IGVA 1QASA 3LK0A 3VRPA 5JJGA 3AKBA 3IQOA 3NSOA 2PMYA 2AAOA 1NX1A 2KAVA 2KI6C 4L9MA 4ZCVA 1PSRA 4MRYA 1VRKA 2F3YA 3A4UB 2K7OA 4NDCA 2JT8A 2NZ0A 2LVKA 1YRTB 1S5GY 1B8CA 2LANA 3JVTC 1AHRA 2KI6D 1DF0A 4A4BA 1SNLA 1NWDA 1V1FA 4E68A 1S6CA 1TCFA 1MHOA 4MZKA 4FQOA 1KQMB 1JF0A 1RTP1 4PHMA 2LV7A 1XYDA 2M97A 5DKNA 4ICBA 1DF0B 2CT9A 1IRJA 3I5HB 2NCPA 2LP3A 3VROA 1J7PA 4GAOA 5KU1A 4NQGA 2SCPA 1UHIA 1ODBA 2KDHA 2LLUA 3BUXB 4GGFA 1QVIY 4FTGA 4YI8A 1QJTA 1NSHA 5ER5A 3SG5A 2LUCA 3KPXA 5AXIA 1SPYA 4PALA 4XJKA 3WHUB 1TNWA 2F33A 1AK8A 4PE1A 4YGCB 1B7TZ 1XVJA 1DJGA 4PE0A 1QV0A 5I2LA 1MF8B 4N1FA 2PALA 3KO0A 1KQMC 1X02A 1KK8B 1EG4A 4XJKB 4DS7A 1B8LA 4JQ0D 4YRUA 1YX8A 2H61C 1KFXL 3LLEA 2OPOA 1CDPA 2ZRSA 4BY5A 1DJZA 2TN4A 2FCEA 3DVKA 2B1UA 1IJ5A 2I7AA 4DIRA 4QJ3B 1S3PA 3I5GB 1JF2A 2L4IA 1K9UA 2AMIA 3PN7B 2LVVA 1DMOA 1FI5A 2KFFA 3CR4X 4HSZA 4AQIA 1WRLA 3ZWHA 1NYAA 1XO5A 2L5XB 1PVAA 4UPGA 3TDUA 1QLKA 4GGFC 1H8BA 1NP8A 2FCDA 2ZFDA 4CIDA 1CM1A 1WDCB 2ZKMX 1CM4A 2O5GA 3CS1A 1F71A 1F55A 1L2OC 5KSZA 1B9AA 1CDMA 1KK8C 2K61A 1SCMB 1WLZA 1IG5A 2JZIA 3FS7A 1SR6B 1YTZC 2BL0B 2K7BA 2OTGB 2SASA 2G2BA 3GK1A 4I5LB 3NSIA 1FPWA 1BMOA 2K8MB 2LC5A 1UURA 2ZNEA 1M46A 2CTNA 3OX5A 2HPSA 4PHNA 1RK9A 3I5GC 4DRWA 4CFRA 2GV5A 2MAZA 1NX3A 3OX6A 1R6PA 4I5KA 3RLZA 1IQ3A 2JOJA 1CNPA 3AAJA 3SIAA 3PN7C 1YUTA 1OZSA 4MSPA 3WXAA 1NX2A 2HQ8A 2KQ6A 1CFPA 1XFWO 1D1OA 3JTDB 1Y0VH 3HX4A 1KFUL 1C07A 5TNCA 1BLQA 1KSMA 1QATA 1R2UA 1J1DA 2MLEC 2I18A 1WDCC 1A29A 1KFXS 4JWQA 1XK4C 2KAXA 1LINA 1N2DA 1TNQA 3CR2A 3H4SE 1RROA 3CLNA 5KTYA 1QX2A 3HCMA 4WQ2A 3E3RA 5CSIA 4M2OA 5JOLA 1SR6C 2OTGC 2BL0C 1Y1AA 4OKHA 5DKQA 2JXLA 2KQYA 3F45A 5PALA 4MZJA 3TDZA 2JWWA 3SG2A 1RWYA 3SG7A 1YRUB 4TNCA 1IH0A 2QPTA 1B8RA 1XA5A 1S36A 5HKYA 5AEQA 1LA0A 1C7WA 2R2IA 1LXFC 1XFVO 2COLB 1TIZA 1TNXA 4MEWA 3TUYB 1S26D 2L2EA 1SL8A 1NIWA 3BOWA 4C0JA 5CPVA 3BUMB 2QACA 2LVIA 1KCYA 3TDIA 1MR8A 1SY9A 3SJSA 1LA3A 4MRXA 4QJ4B 1CKKA 3BOWB 3BUNB 4JPZB 1TTXA 1W7IB 2NCOA 2WOSA 4PE4A 3KHEA 3BYAA 2M3WA 5CSFA 1N0YA 1OZOA 1ZOTB 5B8IB 1XFZO 4AOMA 1BR4B 3AKAA 4HREE 3EK8A 1UWOA 1SL7A 2E6WA 2K2AA 1ZACA 1KFUS 1Y1XA 5AERA 1CMGA 3DVEA 2H2KA 3KF9A 1KK7Z 3VGOA 2LVJA 1G4YR 4PDZA 1DJYA 4F0ZB 4OV2A 1A03A 1LKJA 2BE4A 2O60A 2CCMA 2NLNA 1K2HA 1GJYA 4NDDA 4GNKB 5D69A 5G08A 2RGIA 3CGAA 3QRXA 4ORAB 1DTLA 5GQQC 2MLFC 1EJ3A 2EC6B 1K8UA 1PK0D 1RFJA 5FYXA 4AQJA 1YX7A 1IJ6A 1OMDA 2BCBA 1TNPA 3OB1B 4WQ3A 2G9BA 3CR5X 3EKJA 1J1EA 3MSEB 1NCXA 1J7RA 3DVMA 5I2QA 1Q80A 2PSRA 3PATA 4I5NB 1SYMA 1DJHA 1K94A 2JT3A 3SG6A 1HQVA 2JQ6A 1NX0A 1YUUA 2L4HA 1K90D 1DJXA 3I5HC 3PSRA 1CFCA 4MN0A 4BY4A 4YGDB 5HKWA 1CMFA 2HQWA 2M0RA 3CWGA 2MRDA 2KYFA 2KI4B 3K21A 1K9KA 3O4YA 2EC6C 2HF5A 2LUXA 2HETA 1NCZA 2M7NA 1F54A 1OOJA 4U8DA 5K89A 2WCBA 2JPTA 1TN4A 5CSJA 1N65A 5AFPA 1QIVA 4ORBB 1JFJA 1SW8A 1EG3A 3LCPC 1UUSA 3SG3A 1BJFA 4MZLA 3DF0A 1ALWA 1FW4A 2WCFA 2ZN9A 1B7TY 4R1EA 3EVRA 2DOQA 3EKHA 1TRFA 4OVNF 1YURA 2L98A 1CFDA 1KWOB 3DF0B 2F2OA 5BPJA 1DGUA 3GK4X 1G8IA 2KI4C 4M2QA 2JRFA 1RJVA 2CNPA 2L0PA 1SBJA 2PRUA 1CLBA 2M9GA 1QTXA 3C1VA 1L7ZA 1NUBA 1S6IA 2JTZA 1QS7A 4P2YB 4ORCB 1ZUZA 2KFHA 1W7JB 2ZRTA 1FI6A 2EGDA 1XFUO 1SKTA 2NXQA 1AVSA 2K7DA 1SCMC 2VRGA 2KFGA 2M8UA 1SCVA 1F4OA 1FBVA 3I5FB 1JFKA 1S1EA 1DVIA 3VRNA 4ETOA 1KWOC 1B4CA 1J55A 4GUKA 1TCOB 4C0KA 1BR1B 1IKUA 2D8NA 2GGMA 2ZN8A 5DKRA 3ZNIA 2WORA 4GPLB 1S5GZ 3OB2B 1YUSA 3JTDC 3PFVA 5HLVA 3VRQA 2MA2A 1V1GA 1BT6A 4M2PA 3M0WA 2KOTA 2LM5A 3AAKA 4IL1A 1WLMA 3JVTB 2F2PA 3D10A 3BXKA 1LVCD 1B47A 1A2XA 2CBLA 5HLOA 4D1EA 1PRWA 2LE9B 3NXAA 3I5FC 2AUCA 1QVIZ 4GFTA 1GGZA 1M63B 3TZ1A 4DCKA 1FF1A 3O2PA 2LNKA 1KQVA 2M1KB 4PHJA 1PSBA 3A8RA 2LMVA 2BKHB 2LP2A 1CDLA 4CLNA 1NPQA 4C0LA 1CTRA 1JUOA 3EVVA 2JTTA 2K7CA 3EK4A 4I5JA 1AUIB 4YBHB 1OQPA 1F4QA 3TUYC 1RECA 1F8HA 3OP0A 4ZCUA 1CDNA 3CZTX 4PCWA 1CLMA 2I94A 1PULA 2M49B 2PASA 3DVJA 2Y5IA 2H61A 3FWBA 5HKZA 1XFXO 3SIBA 2BCXA 1H4BA 1QX7A 2LAPA 2WCEA 1CB1A 1PVBA 2BBNA 2BECA 4YGEB 1ZFSA 2KNEA 2LHIA 2I2RE 1EXRA 3EK7A 2K0JA 2JNXA 4MBEA 2FOTA 2KBMA 1WRZA 3TS5B 1QXPA 4GGNA 2LLTA 4NDBA 2JU0A 1GQMA 1BF5A 2A4JA 4OR9B 5J3XA 1OE9B 1G33A 2PVBA 2EHBA 2ZNDA 1F70A 4YGAA 4YGBB 2BCAA 3EVUA 1AP4A 3O78A 3GK2A 1SK6D 1UHKA 1UHJA 2KSPA 1CFFA 3ICBA 1KK7Y 2JC2A 1DT7B 1UHHA 1SRAA 1TOPA 2CXJA 3SG4A 2IS9A 1EH2A 3DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9P A;  2KYC A;  1L2O B;  2BKI B;  5F6T A;  5AAN A;  4USL A;  1M39 A;  2JXC A;  1AJ5 A;  1IWQ A;  1CLL A;  1K95 A;  1DJW A;  2LMU A;  3PLF B;  3IQQ A;  3TS5 C;  2OS8 B;  1ALV A;  1JWD A;  1YVH A;  2KGR A;  2V53 A;  2MHH A;  2LCP A;  1JSA A;  2JUL A;  2KAY A;  1EL4 A;  1YR5 A;  3NSL A;  2L51 A;  2LMT A;  5CSN A;  1OSA A;  1DGV A;  1QIW A;  3NSK A;  5I2O A;  1XK4 A;  2E30 A;  2K2F A;  2Q4U A;  3FIA A;  4PHK A;  1YVL A;  1MXL C;  1OMR A;  4GBA A;  4OCI A;  3I5I B;  2MJW B;  2BE6 A;  2LLS A;  3PAL A;  3BUO B;  1MQ1 A;  2KBI A;  3LK1 A;  4P5O E;  3RM1 A;  1A4P A;  5HYD A;  2Y1N A;  4PE7 A;  4N5X A;  1KSO A;  3D0Y A;  5D7F A;  4MVF A;  1A75 A;  4N1G A;  4A4C A;  3BUW B;  3IF7 A;  1MWN A;  2OS8 C;  3BQ3 A;  1BOD A;  4YI9 A;  2BBM A;  3VRR A;  1JC2 A;  3D0Y B;  1A75 B;  4XYN A;  1WRK A;  1GGW A;  3CTN A;  1XFY O;  1S6J A;  2M1U A;  5I8N A;  3PM8 A;  3WHT B;  1K93 D;  5IBW A;  2L50 A;  2ISD A;  4HRH A;  1Y6W A;  2F8P A;  2KHN A;  3OHM B;  1U5I A;  2MBX A;  1MXE A;  3I5I C;  1OMV A;  1Y1U A;  4HRG A;  2Q91 A;  1QLS A;  1B1G A;  1M45 A;  1HT9 A;  4WRI A;  4Q04 A;  4QJ5 B;  1U5I B;  2FJU B;  2JNF A;  4MLW A;  2WC8 A;  1MUX A;  1J7Q A;  1QX5 B;  1SL9 A;  1IQ5 A;  1E8A A;  1QV1 A;  1C7V A;  2GGZ A;  2JT0 A;  2LHL A;  1JBA A;  1AJ4 A;  1DJI A;  1UHN A;  1UP5 A;  5ER4 X;  3FWC A;  1BG1 A;  1NCY A;  2F3Z A;  3GOF A;  2WND A;  2P6B B;  2M29 A;  1M31 A;  2KGB C;  3LL8 B;  1BU3 A;  1ZMZ A;  3KEV A;  4CPV A;  1K96 A;  1SMG A;  1BOC A;  3WNX B;  4CFQ A;  1WY9 A;  2Y1M A;  2M7L A;  4DUQ A;  2Y4Q A;  3O6B A;  1PAL A;  1J7O A;  1IGV A;  1QAS A;  3LK0 A;  3VRP A;  5JJG A;  3AKB A;  3IQO A;  3NSO A;  2PMY A;  2AAO A;  1NX1 A;  2KAV A;  2KI6 C;  4L9M A;  4ZCV A;  1PSR A;  4MRY A;  1VRK A;  2F3Y A;  3A4U B;  2K7O A;  4NDC A;  2JT8 A;  2NZ0 A;  2LVK A;  1YRT B;  1S5G Y;  1B8C A;  2LAN A;  3JVT C;  1AHR A;  2KI6 D;  1DF0 A;  4A4B A;  1SNL A;  1NWD A;  1V1F A;  4E68 A;  1S6C A;  1TCF A;  1MHO A;  4MZK A;  4FQO A;  1KQM B;  1JF0 A;  1RTP 1;  4PHM A;  2LV7 A;  1XYD A;  2M97 A;  5DKN A;  4ICB A;  1DF0 B;  2CT9 A;  1IRJ A;  3I5H B;  2NCP A;  2LP3 A;  3VRO A;  1J7P A;  4GAO A;  5KU1 A;  4NQG A;  2SCP A;  1UHI A;  1ODB A;  2KDH A;  2LLU A;  3BUX B;  4GGF A;  1QVI Y;  4FTG A;  4YI8 A;  1QJT A;  1NSH A;  5ER5 A;  3SG5 A;  2LUC A;  3KPX A;  5AXI A;  1SPY A;  4PAL A;  4XJK A;  3WHU B;  1TNW A;  2F33 A;  1AK8 A;  4PE1 A;  4YGC B;  1B7T Z;  1XVJ A;  1DJG A;  4PE0 A;  1QV0 A;  5I2L A;  1MF8 B;  4N1F A;  2PAL A;  3KO0 A;  1KQM C;  1X02 A;  1KK8 B;  1EG4 A;  4XJK B;  4DS7 A;  1B8L A;  4JQ0 D;  4YRU A;  1YX8 A;  2H61 C;  1KFX L;  3LLE A;  2OPO A;  1CDP A;  2ZRS A;  4BY5 A;  1DJZ A;  2TN4 A;  2FCE A;  3DVK A;  2B1U A;  1IJ5 A;  2I7A A;  4DIR A;  4QJ3 B;  1S3P A;  3I5G B;  1JF2 A;  2L4I A;  1K9U A;  2AMI A;  3PN7 B;  2LVV A;  1DMO A;  1FI5 A;  2KFF A;  3CR4 X;  4HSZ A;  4AQI A;  1WRL A;  3ZWH A;  1NYA A;  1XO5 A;  2L5X B;  1PVA A;  4UPG A;  3TDU A;  1QLK A;  4GGF C;  1H8B A;  1NP8 A;  2FCD A;  2ZFD A;  4CID A;  1CM1 A;  1WDC B;  2ZKM X;  1CM4 A;  2O5G A;  3CS1 A;  1F71 A;  1F55 A;  1L2O C;  5KSZ A;  1B9A A;  1CDM A;  1KK8 C;  2K61 A;  1SCM B;  1WLZ A;  1IG5 A;  2JZI A;  3FS7 A;  1SR6 B;  1YTZ C;  2BL0 B;  2K7B A;  2OTG B;  2SAS A;  2G2B A;  3GK1 A;  4I5L B;  3NSI A;  1FPW A;  1BMO A;  2K8M B;  2LC5 A;  1UUR A;  2ZNE A;  1M46 A;  2CTN A;  3OX5 A;  2HPS A;  4PHN A;  1RK9 A;  3I5G C;  4DRW A;  4CFR A;  2GV5 A;  2MAZ A;  1NX3 A;  3OX6 A;  1R6P A;  4I5K A;  3RLZ A;  1IQ3 A;  2JOJ A;  1CNP A;  3AAJ A;  3SIA A;  3PN7 C;  1YUT A;  1OZS A;  4MSP A;  3WXA A;  1NX2 A;  2HQ8 A;  2KQ6 A;  1CFP A;  1XFW O;  1D1O A;  3JTD B;  1Y0V H;  3HX4 A;  1KFU L;  1C07 A;  5TNC A;  1BLQ A;  1KSM A;  1QAT A;  1R2U A;  1J1D A;  2MLE C;  2I18 A;  1WDC C;  1A29 A;  1KFX S;  4JWQ A;  1XK4 C;  2KAX A;  1LIN A;  1N2D A;  1TNQ A;  3CR2 A;  3H4S E;  1RRO A;  3CLN A;  5KTY A;  1QX2 A;  3HCM A;  4WQ2 A;  3E3R A;  5CSI A;  4M2O A;  5JOL A;  1SR6 C;  2OTG C;  2BL0 C;  1Y1A A;  4OKH A;  5DKQ A;  2JXL A;  2KQY A;  3F45 A;  5PAL A;  4MZJ A;  3TDZ A;  2JWW A;  3SG2 A;  1RWY A;  3SG7 A;  1YRU B;  4TNC A;  1IH0 A;  2QPT A;  1B8R A;  1XA5 A;  1S36 A;  5HKY A;  5AEQ A;  1LA0 A;  1C7W A;  2R2I A;  1LXF C;  1XFV O;  2COL B;  1TIZ A;  1TNX A;  4MEW A;  3TUY B;  1S26 D;  2L2E A;  1SL8 A;  1NIW A;  3BOW A;  4C0J A;  5CPV A;  3BUM B;  2QAC A;  2LVI A;  1KCY A;  3TDI A;  1MR8 A;  1SY9 A;  3SJS A;  1LA3 A;  4MRX A;  4QJ4 B;  1CKK A;  3BOW B;  3BUN B;  4JPZ B;  1TTX A;  1W7I B;  2NCO A;  2WOS A;  4PE4 A;  3KHE A;  3BYA A;  2M3W A;  5CSF A;  1N0Y A;  1OZO A;  1ZOT B;  5B8I B;  1XFZ O;  4AOM A;  1BR4 B;  3AKA A;  4HRE E;  3EK8 A;  1UWO A;  1SL7 A;  2E6W A;  2K2A A;  1ZAC A;  1KFU S;  1Y1X A;  5AER A;  1CMG A;  3DVE A;  2H2K A;  3KF9 A;  1KK7 Z;  3VGO A;  2LVJ A;  1G4Y R;  4PDZ A;  1DJY A;  4F0Z B;  4OV2 A;  1A03 A;  1LKJ A;  2BE4 A;  2O60 A;  2CCM A;  2NLN A;  1K2H A;  1GJY A;  4NDD A;  4GNK B;  5D69 A;  5G08 A;  2RGI A;  3CGA A;  3QRX A;  4ORA B;  1DTL A;  5GQQ C;  2MLF C;  1EJ3 A;  2EC6 B;  1K8U A;  1PK0 D;  1RFJ A;  5FYX A;  4AQJ A;  1YX7 A;  1IJ6 A;  1OMD A;  2BCB A;  1TNP A;  3OB1 B;  4WQ3 A;  2G9B A;  3CR5 X;  3EKJ A;  1J1E A;  3MSE B;  1NCX A;  1J7R A;  3DVM A;  5I2Q A;  1Q80 A;  2PSR A;  3PAT A;  4I5N B;  1SYM A;  1DJH A;  1K94 A;  2JT3 A;  3SG6 A;  1HQV A;  2JQ6 A;  1NX0 A;  1YUU A;  2L4H A;  1K90 D;  1DJX A;  3I5H C;  3PSR A;  1CFC A;  4MN0 A;  4BY4 A;  4YGD B;  5HKW A;  1CMF A;  2HQW A;  2M0R A;  3CWG A;  2MRD A;  2KYF A;  2KI4 B;  3K21 A;  1K9K A;  3O4Y A;  2EC6 C;  2HF5 A;  2LUX A;  2HET A;  1NCZ A;  2M7N A;  1F54 A;  1OOJ A;  4U8D A;  5K89 A;  2WCB A;  2JPT A;  1TN4 A;  5CSJ A;  1N65 A;  5AFP A;  1QIV A;  4ORB B;  1JFJ A;  1SW8 A;  1EG3 A;  3LCP C;  1UUS A;  3SG3 A;  1BJF A;  4MZL A;  3DF0 A;  1ALW A;  1FW4 A;  2WCF A;  2ZN9 A;  1B7T Y;  4R1E A;  3EVR A;  2DOQ A;  3EKH A;  1TRF A;  4OVN F;  1YUR A;  2L98 A;  1CFD A;  1KWO B;  3DF0 B;  2F2O A;  5BPJ A;  1DGU A;  3GK4 X;  1G8I A;  2KI4 C;  4M2Q A;  2JRF A;  1RJV A;  2CNP A;  2L0P A;  1SBJ A;  2PRU A;  1CLB A;  2M9G A;  1QTX A;  3C1V A;  1L7Z A;  1NUB A;  1S6I A;  2JTZ A;  1QS7 A;  4P2Y B;  4ORC B;  1ZUZ A;  2KFH A;  1W7J B;  2ZRT A;  1FI6 A;  2EGD A;  1XFU O;  1SKT A;  2NXQ A;  1AVS A;  2K7D A;  1SCM C;  2VRG A;  2KFG A;  2M8U A;  1SCV A;  1F4O A;  1FBV A;  3I5F B;  1JFK A;  1S1E A;  1DVI A;  3VRN A;  4ETO A;  1KWO C;  1B4C A;  1J55 A;  4GUK A;  1TCO B;  4C0K A;  1BR1 B;  1IKU A;  2D8N A;  2GGM A;  2ZN8 A;  5DKR A;  3ZNI A;  2WOR A;  4GPL B;  1S5G Z;  3OB2 B;  1YUS A;  3JTD C;  3PFV A;  5HLV A;  3VRQ A;  2MA2 A;  1V1G A;  1BT6 A;  4M2P A;  3M0W A;  2KOT A;  2LM5 A;  3AAK A;  4IL1 A;  1WLM A;  3JVT B;  2F2P A;  3D10 A;  3BXK A;  1LVC D;  1B47 A;  1A2X A;  2CBL A;  5HLO A;  4D1E A;  1PRW A;  2LE9 B;  3NXA A;  3I5F C;  2AUC A;  1QVI Z;  4GFT A;  1GGZ A;  1M63 B;  3TZ1 A;  4DCK A;  1FF1 A;  3O2P A;  2LNK A;  1KQV A;  2M1K B;  4PHJ A;  1PSB A;  3A8R A;  2LMV A;  2BKH B;  2LP2 A;  1CDL A;  4CLN A;  1NPQ A;  4C0L A;  1CTR A;  1JUO A;  3EVV A;  2JTT A;  2K7C A;  3EK4 A;  4I5J A;  1AUI B;  4YBH B;  1OQP A;  1F4Q A;  3TUY C;  1REC A;  1F8H A;  3OP0 A;  4ZCU A;  1CDN A;  3CZT X;  4PCW A;  1CLM A;  2I94 A;  1PUL A;  2M49 B;  2PAS A;  3DVJ A;  2Y5I A;  2H61 A;  3FWB A;  5HKZ A;  1XFX O;  3SIB A;  2BCX A;  1H4B A;  1QX7 A;  2LAP A;  2WCE A;  1CB1 A;  1PVB A;  2BBN A;  2BEC A;  4YGE B;  1ZFS A;  2KNE A;  2LHI A;  2I2R E;  1EXR A;  3EK7 A;  2K0J A;  2JNX A;  4MBE A;  2FOT A;  2KBM A;  1WRZ A;  3TS5 B;  1QXP A;  4GGN A;  2LLT A;  4NDB A;  2JU0 A;  1GQM A;  1BF5 A;  2A4J A;  4OR9 B;  5J3X A;  1OE9 B;  1G33 A;  2PVB A;  2EHB A;  2ZND A;  1F70 A;  4YGA A;  4YGB B;  2BCA A;  3EVU A;  1AP4 A;  3O78 A;  3GK2 A;  1SK6 D;  1UHK A;  1UHJ A;  2KSP A;  1CFF A;  3ICB A;  1KK7 Y;  2JC2 A;  1DT7 B;  1UHH A;  1SRA A;  1TOP A;  2CXJ A;  3SG4 A;  2IS9 A;  1EH2 A;  3DD4 A; 
#chains in the Genus database with same CATH topology
 1K9P A;  1P28 A;  1L2O B;  2BKI B;  2KYC A;  5F6T A;  5AAN A;  4USL A;  1M39 A;  2JXC A;  1AJ5 A;  1IWQ A;  1CLL A;  1K95 A;  3S0F A;  1DJW A;  2LMU A;  3PLF B;  3IQQ A;  3TS5 C;  2OS8 B;  1ALV A;  1SSE B;  1JWD A;  1YVH A;  2KGR A;  2V53 A;  2MHH A;  2LCP A;  1JSA A;  2JUL A;  2L2C A;  2KAY A;  1EL4 A;  1YR5 A;  3NSL A;  2L51 A;  2LMT A;  5CSN A;  1OSA A;  1DGV A;  1QIW A;  3NSK A;  3L4L A;  5I2O A;  1XK4 A;  2E30 A;  3D75 A;  2K2F A;  2Q4U A;  3FIA A;  4PHK A;  1YVL A;  1MXL C;  1OMR A;  4GBA A;  4OCI A;  3I5I B;  2MJW B;  2BE6 A;  2LLS A;  3PAL A;  3BUO B;  1MQ1 A;  1DEK A;  2KBI A;  3LK1 A;  3NHI A;  4P5O E;  1A4P A;  3RM1 A;  2Y1N A;  4PE7 A;  4N5X A;  5HYD A;  1KSO A;  3D0Y A;  5D7F A;  4MVF A;  1A75 A;  4N1G A;  2YGU A;  4A4C A;  1W9Z A;  3BUW B;  3IF7 A;  1MWN A;  2OS8 C;  2QEH A;  3BQ3 A;  1BOD A;  4YI9 A;  2BBM A;  3VRR A;  1JC2 A;  3S0D A;  3D0Y B;  1A75 B;  3L47 A;  4XYN A;  1WRK A;  1OOF A;  5HL1 A;  1GGW A;  3PM2 A;  3CTN A;  1XFY O;  1S6J A;  2M1U A;  5I8N A;  3PM8 A;  3WHT B;  1K93 D;  5IBW A;  2L50 A;  2ISD A;  4HRH A;  3R72 A;  1Y6W A;  2F8P A;  2KHN A;  3OHM B;  1U5I A;  2MBX A;  1MXE A;  3I5I C;  3PJI A;  1OMV A;  1Y1U A;  4HRG A;  3DYE A;  2Q91 A;  1QLS A;  3D78 A;  1M45 A;  1B1G A;  1HT9 A;  3D77 A;  4WRI A;  4Q04 A;  3CAB A;  4QJ5 B;  1U5I B;  2FJU B;  2JNF A;  4MLW A;  1DC1 A;  3DY9 A;  2WC8 A;  1MUX A;  1J7Q A;  1QX5 B;  3BFA A;  1SL9 A;  1IQ5 A;  1E8A A;  1QV1 A;  1OOG A;  1C7V A;  2GGZ A;  2JT0 A;  2LHL A;  1JBA A;  1AJ4 A;  1DJI A;  1UHN A;  1UP5 A;  5ER4 X;  3FWC A;  2PQL A;  1BG1 A;  1NCY A;  2F3Z A;  3GOF A;  2WND A;  2P6B B;  2M29 A;  1DEL A;  1M31 A;  1QWV A;  2KGB C;  3LL8 B;  1BU3 A;  1ZMZ A;  3KEV A;  4CPV A;  1K96 A;  1SMG A;  1BOC A;  3WNX B;  4CFQ A;  1WY9 A;  2Y1M A;  2M7L A;  4DUQ A;  2Y4Q A;  3S0G A;  3O6B A;  1PAL A;  1J7O A;  1IGV A;  1QAS A;  3LK0 A;  3VRP A;  5JJG A;  3AKB A;  3IQO A;  3NSO A;  2PMY A;  2AAO A;  1NX1 A;  2KAV A;  2KI6 C;  4L9M A;  4ZCV A;  1PSR A;  3OBV A;  4MRY A;  1VRK A;  2F3Y A;  3A4U B;  2K7O A;  4NDC A;  2JT8 A;  2NZ0 A;  2LVK A;  5FI2 A;  1YRT B;  1S5G Y;  1B8C A;  2LAN A;  3JVT C;  2WCJ A;  1AHR A;  2KI6 D;  2KPH A;  4JKT A;  1DF0 A;  4A4B A;  1SNL A;  1NWD A;  1V1F A;  4E68 A;  1S6C A;  1TCF A;  1MHO A;  4MZK A;  4FQO A;  1KQM B;  1JF0 A;  1RTP 1;  4PHM A;  2LV7 A;  1XYD A;  2M97 A;  2K60 A;  5DKN A;  2H8V A;  4ICB A;  1DF0 B;  2CT9 A;  1IRJ A;  3I5H B;  2NCP A;  2LP3 A;  3CZ1 A;  3VRO A;  1J7P A;  4GAO A;  5KU1 A;  4NQG A;  2SCP A;  1UHI A;  1ODB A;  2KDH A;  2LLU A;  3BUX B;  4GGF A;  1QVI Y;  4FTG A;  4YI8 A;  1QJT A;  1TUZ A;  1NSH A;  5ER5 A;  3SG5 A;  2KLE A;  2LUC A;  3FE9 A;  3KPX A;  5AXI A;  1SPY A;  4PAL A;  4XJK A;  3WHU B;  1TNW A;  2F33 A;  3R1O A;  1AK8 A;  4PE1 A;  4YGC B;  1B7T Z;  1XVJ A;  1DJG A;  4PE0 A;  1QV0 A;  5I2L A;  1MF8 B;  4N1F A;  2PAL A;  3KO0 A;  1KQM C;  1X02 A;  1KK8 B;  1EG4 A;  3R1V A;  4XJK B;  4DS7 A;  1B8L A;  3IVT A;  4JQ0 D;  4YRU A;  5EL2 A;  1YX8 A;  2H61 C;  1KFX L;  3LLE A;  1Z2C B;  4PT1 A;  2OPO A;  1CDP A;  2ZRS A;  4BY5 A;  1DJZ A;  2TN4 A;  2FCE A;  3DVK A;  2B1U A;  1IJ5 A;  2I7A A;  4DIR A;  4QJ3 B;  1S3P A;  3I5G B;  3RZS A;  1JF2 A;  2L4I A;  1K9U A;  2P70 A;  2AMI A;  3PN7 B;  2LVV A;  1DMO A;  1FI5 A;  2KFF A;  3CR4 X;  4JD9 A;  4HSZ A;  4AQI A;  1WRL A;  3ZWH A;  1NYA A;  1XO5 A;  2L5X B;  1PVA A;  4UPG A;  3TDU A;  1QLK A;  4GGF C;  1H8B A;  1NP8 A;  5I94 A;  2FCD A;  1OW4 A;  2ZFD A;  1CM1 A;  3DXL A;  4CID A;  1WDC B;  2ZKM X;  1CM4 A;  2O5G A;  3CS1 A;  1F71 A;  1F55 A;  1L2O C;  5KSZ A;  1B9A A;  1CDM A;  1KK8 C;  2K61 A;  1SCM B;  1WLZ A;  1IG5 A;  2JZI A;  3FS7 A;  5FI6 A;  1SR6 B;  1YTZ C;  2BL0 B;  2K7B A;  2OTG B;  2SAS A;  2G2B A;  3GK1 A;  4I5L B;  3NSI A;  1FPW A;  1BMO A;  2K8M B;  2LC5 A;  3NHT A;  1UUR A;  3L4A A;  2ZNE A;  1M46 A;  2CTN A;  3OX5 A;  2HPS A;  4PHN A;  1RK9 A;  2WC6 A;  3I5G C;  4DRW A;  4CFR A;  2GV5 A;  2MAZ A;  1NX3 A;  3OX6 A;  1R6P A;  4I5K A;  5D3O A;  3RLZ A;  1IQ3 A;  2JOJ A;  1CNP A;  3AAJ A;  3SIA A;  3PN7 C;  1YUT A;  1OZS A;  4MSP A;  3WXA A;  1NX2 A;  2HQ8 A;  2KQ6 A;  1CFP A;  1XFW O;  1D1O A;  3JTD B;  1Y0V H;  3B7A A;  1KFU L;  3HX4 A;  3N7H A;  5TNC A;  1KSM A;  1BLQ A;  1QAT A;  1C07 A;  2WCH A;  1R2U A;  1J1D A;  2MLE C;  2I18 A;  1WDC C;  1A29 A;  1KFX S;  4JWQ A;  1XK4 C;  2KAX A;  1LIN A;  1N2D A;  1TNQ A;  3CR2 A;  3H4S E;  1RRO A;  3CLN A;  5KTY A;  1QX2 A;  3HCM A;  4WQ2 A;  3E3R A;  5CSI A;  4M2O A;  5JOL A;  1SR6 C;  2OTG C;  2BL0 C;  1Y1A A;  4OKH A;  5DKQ A;  2JXL A;  2KQY A;  3F45 A;  5PAL A;  4MZJ A;  3TDZ A;  1C3Y A;  2JWW A;  3SG2 A;  1RWY A;  3SG7 A;  1YRU B;  4TNC A;  1IH0 A;  2QPT A;  1B8R A;  1XA5 A;  1S36 A;  5HKY A;  5AEQ A;  1LA0 A;  3BJH A;  1C7W A;  2R2I A;  2JPO A;  1LXF C;  1XFV O;  2COL B;  3S0E A;  1TIZ A;  1TNX A;  4MEW A;  3TUY B;  1S26 D;  2L2E A;  1SL8 A;  1NIW A;  3BOW A;  4C0J A;  5CPV A;  3VB1 A;  3BUM B;  2QAC A;  2LVI A;  1KCY A;  3TDI A;  1MR8 A;  2WCL A;  3S0B A;  1SY9 A;  3SJS A;  1LA3 A;  4MRX A;  4QJ4 B;  1CKK A;  3BOW B;  3BUN B;  4JPZ B;  1TTX A;  1W7I B;  2NCO A;  3B6X A;  2WOS A;  4PE4 A;  3KHE A;  3BYA A;  3SS4 A;  2M3W A;  3Q8I A;  5CSF A;  1N0Y A;  1OZO A;  1ZOT B;  5B8I B;  1XFZ O;  3BFH A;  4AOM A;  1BR4 B;  3AKA A;  2PYQ A;  4HRE E;  3EK8 A;  2BAP A;  1UWO A;  1SL7 A;  2E6W A;  2K2A A;  1ZAC A;  1KFU S;  1Y1X A;  5AER A;  1CMG A;  3DVE A;  2H2K A;  3KF9 A;  1KK7 Z;  3VGO A;  2LVJ A;  1G4Y R;  4PDZ A;  1DJY A;  4F0Z B;  1C3Z A;  4OV2 A;  1A03 A;  1LKJ A;  2BE4 A;  2O60 A;  5FI7 A;  2CCM A;  2NLN A;  1K2H A;  1GJY A;  4NDD A;  4GNK B;  5D69 A;  5G08 A;  2RGI A;  3CGA A;  3QRX A;  4ORA B;  1DTL A;  5GQQ C;  2MLF C;  1EJ3 A;  2EC6 B;  1K8U A;  3FE8 A;  1PK0 D;  1RFJ A;  5FYX A;  4AQJ A;  1YX7 A;  1IJ6 A;  1OMD A;  2BCB A;  1TNP A;  3OB1 B;  4WQ3 A;  2G9B A;  3CR5 X;  3EKJ A;  1GM0 A;  1J1E A;  3MSE B;  1NCX A;  1J7R A;  3DVM A;  5I2Q A;  3DZT A;  1Q80 A;  3CDN A;  2PSR A;  3PAT A;  3QME A;  4I5N B;  1SYM A;  1DJH A;  1K94 A;  2JT3 A;  3SG6 A;  1HQV A;  2JQ6 A;  1NX0 A;  1YUU A;  2L4H A;  1K90 D;  1DJX A;  3I5H C;  3PSR A;  3CZ2 A;  1CFC A;  2BNX A;  4MN0 A;  4BY4 A;  4YGD B;  3V2L A;  5HKW A;  2QEO A;  2WC5 A;  1CMF A;  2HQW A;  2M0R A;  3CWG A;  3R1P A;  2MRD A;  2KYF A;  2KI4 B;  3K21 A;  1K9K A;  3O4Y A;  2EC6 C;  2HF5 A;  2LUX A;  2HET A;  1NCZ A;  2M7N A;  1F54 A;  1OOJ A;  4U8D A;  5K89 A;  2WCK A;  2WCB A;  1XFR A;  2JPT A;  1TN4 A;  5CSJ A;  1N65 A;  5AFP A;  1QIV A;  3D76 A;  1TUJ A;  4ORB B;  2QEB A;  1SW8 A;  1JFJ A;  1EG3 A;  3LCP C;  1UUS A;  3SG3 A;  1BJF A;  4MZL A;  3DF0 A;  1ALW A;  1FW4 A;  3S0A A;  2WCF A;  2ZN9 A;  1B7T Y;  4R1E A;  3EVR A;  2QDI A;  2DOQ A;  1IIO A;  3EKH A;  2QEV A;  1TRF A;  4OVN F;  1YUR A;  2L98 A;  1CFD A;  1KWO B;  3DF0 B;  2F2O A;  5BPJ A;  1DGU A;  3GK4 X;  3OGN A;  1G8I A;  2KI4 C;  4M2Q A;  2JRF A;  1RJV A;  2CNP A;  2L0P A;  1SBJ A;  2PRU A;  4KYN A;  1CLB A;  2M9G A;  1QTX A;  3C1V A;  1L7Z A;  2KLD A;  1NUB A;  1S6I A;  4F7F A;  4OZD A;  2GTE A;  2JTZ A;  1QS7 A;  4P2Y B;  4ORC B;  1ZUZ A;  2KFH A;  1W7J B;  3SS3 A;  2ZRT A;  1FI6 A;  2EGD A;  1XFU O;  1SKT A;  2NXQ A;  4IJ7 A;  1AVS A;  2K7D A;  1SCM C;  2VRG A;  2KFG A;  2M8U A;  3B86 A;  2ERB A;  3B88 A;  1ORG A;  1SCV A;  1F4O A;  1FBV A;  3I5F B;  1JFK A;  1S1E A;  1DVI A;  3VRN A;  4ETO A;  3UNW A;  1KWO C;  3D73 A;  1B4C A;  1J55 A;  4GUK A;  1TCO B;  4C0K A;  1BR1 B;  1IKU A;  2D8N A;  2GGM A;  3FE6 A;  2ZN8 A;  5DKR A;  3ZNI A;  2WOR A;  4GPL B;  1S5G Z;  1EH2 A;  3OB2 B;  1YUS A;  1TWO A;  3JTD C;  3PFV A;  3O4X A;  5HLV A;  3VRQ A;  2MA2 A;  1V1G A;  1T14 A;  3EG5 B;  1BT6 A;  4M2P A;  3M0W A;  2KOT A;  2LM5 A;  3AAK A;  4INX A;  1WLM A;  3JVT B;  4IL1 A;  3SS5 A;  3K1E A;  2F2P A;  3NGV A;  3D10 A;  3BXK A;  1LVC D;  1B47 A;  1A2X A;  2CBL A;  1OOH A;  5HLO A;  4D1E A;  2WCM A;  1PRW A;  3BFB A;  2LE9 B;  3NXA A;  3I5F C;  2P71 A;  2AUC A;  1QVI Z;  4GFT A;  1GGZ A;  1M63 B;  3TZ1 A;  4DCK A;  1FF1 A;  3O2P A;  2LNK A;  1KQV A;  2M1K B;  4PHJ A;  1PSB A;  3A8R A;  2LMV A;  4INW A;  2BKH B;  2LP2 A;  1CDL A;  4CLN A;  1NPQ A;  4C0L A;  1CTR A;  1JUO A;  3EVV A;  2JTT A;  2K7C A;  3EK4 A;  4I5J A;  1AUI B;  4YBH B;  1OQP A;  1F4Q A;  3TUY C;  1REC A;  1F8H A;  3OP0 A;  4ZCU A;  1CDN A;  3CZT X;  4PCW A;  1CLM A;  2I94 A;  1PUL A;  2M49 B;  2PAS A;  3DVJ A;  1OOI X;  2Y5I A;  2H61 A;  3FWB A;  5HKZ A;  1XFX O;  3SIB A;  2BCX A;  4FQT A;  1H4B A;  1QX7 A;  2LAP A;  2WCE A;  1CB1 A;  1PVB A;  2BBN A;  2BEC A;  4YGE B;  1ZFS A;  2KNE A;  2LHI A;  3CYZ A;  2I2R E;  1EXR A;  1Z4H A;  3CZ0 A;  3EK7 A;  2K0J A;  2FJY A;  2JNX A;  2FOT A;  2KBM A;  1WRZ A;  4MBE A;  3TS5 B;  1QXP A;  4GGN A;  1LS8 A;  2LLT A;  4NDB A;  2JU0 A;  1GQM A;  3UO9 A;  1BF5 A;  1DQE A;  2A4J A;  4OR9 B;  2L5Y A;  5J3X A;  1OE9 B;  1G33 A;  2PVB A;  2EHB A;  2ZND A;  1F70 A;  4YGA A;  4YGB B;  2BCA A;  3EVU A;  1AP4 A;  3O78 A;  3GK2 A;  1SK6 D;  1UHK A;  1UHJ A;  5DIC A;  2KSP A;  1CFF A;  3ICB A;  1KK7 Y;  2JC2 A;  1DT7 B;  1UHH A;  1SRA A;  1TOP A;  2CXJ A;  3SG4 A;  2IS9 A;  3D74 A;  3DD4 A;  3B87 A; 
#chains in the Genus database with same CATH homology
 1K9P A;  2KYC A;  1L2O B;  2BKI B;  5F6T A;  5AAN A;  4USL A;  1M39 A;  2JXC A;  1AJ5 A;  1IWQ A;  1CLL A;  1K95 A;  1DJW A;  2LMU A;  3PLF B;  3IQQ A;  3TS5 C;  2OS8 B;  1ALV A;  1JWD A;  1YVH A;  2KGR A;  2V53 A;  2MHH A;  2LCP A;  1JSA A;  2JUL A;  2KAY A;  1EL4 A;  1YR5 A;  3NSL A;  2L51 A;  2LMT A;  5CSN A;  1OSA A;  1DGV A;  1QIW A;  3NSK A;  5I2O A;  1XK4 A;  2E30 A;  2K2F A;  2Q4U A;  3FIA A;  4PHK A;  1YVL A;  1MXL C;  1OMR A;  4GBA A;  4OCI A;  3I5I B;  2MJW B;  2BE6 A;  2LLS A;  3PAL A;  3BUO B;  1MQ1 A;  2KBI A;  3LK1 A;  4P5O E;  3RM1 A;  1A4P A;  5HYD A;  2Y1N A;  4PE7 A;  4N5X A;  1KSO A;  3D0Y A;  5D7F A;  4MVF A;  1A75 A;  4N1G A;  4A4C A;  3BUW B;  3IF7 A;  1MWN A;  2OS8 C;  3BQ3 A;  1BOD A;  4YI9 A;  2BBM A;  3VRR A;  1JC2 A;  3D0Y B;  1A75 B;  4XYN A;  1WRK A;  1GGW A;  3CTN A;  1XFY O;  1S6J A;  2M1U A;  5I8N A;  3PM8 A;  3WHT B;  1K93 D;  5IBW A;  2L50 A;  2ISD A;  4HRH A;  1Y6W A;  2F8P A;  2KHN A;  3OHM B;  1U5I A;  2MBX A;  1MXE A;  3I5I C;  1OMV A;  1Y1U A;  4HRG A;  2Q91 A;  1QLS A;  1B1G A;  1M45 A;  1HT9 A;  4WRI A;  4Q04 A;  4QJ5 B;  1U5I B;  2FJU B;  2JNF A;  4MLW A;  2WC8 A;  1MUX A;  1J7Q A;  1QX5 B;  1SL9 A;  1IQ5 A;  1E8A A;  1QV1 A;  1C7V A;  2GGZ A;  2JT0 A;  2LHL A;  1JBA A;  1AJ4 A;  1DJI A;  1UHN A;  1UP5 A;  5ER4 X;  3FWC A;  1BG1 A;  1NCY A;  2F3Z A;  3GOF A;  2WND A;  2P6B B;  2M29 A;  1M31 A;  2KGB C;  3LL8 B;  1BU3 A;  1ZMZ A;  3KEV A;  4CPV A;  1K96 A;  1SMG A;  1BOC A;  3WNX B;  4CFQ A;  1WY9 A;  2Y1M A;  2M7L A;  4DUQ A;  2Y4Q A;  3O6B A;  1PAL A;  1J7O A;  1IGV A;  1QAS A;  3LK0 A;  3VRP A;  5JJG A;  3AKB A;  3IQO A;  3NSO A;  2PMY A;  2AAO A;  1NX1 A;  2KAV A;  2KI6 C;  4L9M A;  4ZCV A;  1PSR A;  4MRY A;  1VRK A;  2F3Y A;  3A4U B;  2K7O A;  4NDC A;  2JT8 A;  2NZ0 A;  2LVK A;  1YRT B;  1S5G Y;  1B8C A;  2LAN A;  3JVT C;  1AHR A;  2KI6 D;  1DF0 A;  4A4B A;  1SNL A;  1NWD A;  1V1F A;  4E68 A;  1S6C A;  1TCF A;  1MHO A;  4MZK A;  4FQO A;  1KQM B;  1JF0 A;  1RTP 1;  4PHM A;  2LV7 A;  1XYD A;  2M97 A;  5DKN A;  4ICB A;  1DF0 B;  2CT9 A;  1IRJ A;  3I5H B;  2NCP A;  2LP3 A;  3VRO A;  1J7P A;  4GAO A;  5KU1 A;  4NQG A;  2SCP A;  1UHI A;  1ODB A;  2KDH A;  2LLU A;  3BUX B;  4GGF A;  1QVI Y;  4FTG A;  4YI8 A;  1QJT A;  1NSH A;  5ER5 A;  3SG5 A;  2LUC A;  3KPX A;  5AXI A;  1SPY A;  4PAL A;  4XJK A;  3WHU B;  1TNW A;  2F33 A;  1AK8 A;  4PE1 A;  4YGC B;  1B7T Z;  1XVJ A;  1DJG A;  4PE0 A;  1QV0 A;  5I2L A;  1MF8 B;  4N1F A;  2PAL A;  3KO0 A;  1KQM C;  1X02 A;  1KK8 B;  1EG4 A;  4XJK B;  4DS7 A;  1B8L A;  4JQ0 D;  4YRU A;  1YX8 A;  2H61 C;  1KFX L;  3LLE A;  2OPO A;  1CDP A;  2ZRS A;  4BY5 A;  1DJZ A;  2TN4 A;  2FCE A;  3DVK A;  2B1U A;  1IJ5 A;  2I7A A;  4DIR A;  4QJ3 B;  1S3P A;  3I5G B;  1JF2 A;  2L4I A;  1K9U A;  2AMI A;  3PN7 B;  2LVV A;  1DMO A;  1FI5 A;  2KFF A;  3CR4 X;  4HSZ A;  4AQI A;  1WRL A;  3ZWH A;  1NYA A;  1XO5 A;  2L5X B;  1PVA A;  4UPG A;  3TDU A;  1QLK A;  4GGF C;  1H8B A;  1NP8 A;  2FCD A;  2ZFD A;  4CID A;  1CM1 A;  1WDC B;  2ZKM X;  1CM4 A;  2O5G A;  3CS1 A;  1F71 A;  1F55 A;  1L2O C;  5KSZ A;  1B9A A;  1CDM A;  1KK8 C;  2K61 A;  1SCM B;  1WLZ A;  1IG5 A;  2JZI A;  3FS7 A;  1SR6 B;  1YTZ C;  2BL0 B;  2K7B A;  2OTG B;  2SAS A;  2G2B A;  3GK1 A;  4I5L B;  3NSI A;  1FPW A;  1BMO A;  2K8M B;  2LC5 A;  1UUR A;  2ZNE A;  1M46 A;  2CTN A;  3OX5 A;  2HPS A;  4PHN A;  1RK9 A;  3I5G C;  4DRW A;  4CFR A;  2GV5 A;  2MAZ A;  1NX3 A;  3OX6 A;  1R6P A;  4I5K A;  3RLZ A;  1IQ3 A;  2JOJ A;  1CNP A;  3AAJ A;  3SIA A;  3PN7 C;  1YUT A;  1OZS A;  4MSP A;  3WXA A;  1NX2 A;  2HQ8 A;  2KQ6 A;  1CFP A;  1XFW O;  1D1O A;  3JTD B;  1Y0V H;  3HX4 A;  1KFU L;  1C07 A;  5TNC A;  1BLQ A;  1KSM A;  1QAT A;  1R2U A;  1J1D A;  2MLE C;  2I18 A;  1WDC C;  1A29 A;  1KFX S;  4JWQ A;  1XK4 C;  2KAX A;  1LIN A;  1N2D A;  1TNQ A;  3CR2 A;  3H4S E;  1RRO A;  3CLN A;  5KTY A;  1QX2 A;  3HCM A;  4WQ2 A;  3E3R A;  5CSI A;  4M2O A;  5JOL A;  1SR6 C;  2OTG C;  2BL0 C;  1Y1A A;  4OKH A;  5DKQ A;  2JXL A;  2KQY A;  3F45 A;  5PAL A;  4MZJ A;  3TDZ A;  2JWW A;  3SG2 A;  1RWY A;  3SG7 A;  1YRU B;  4TNC A;  1IH0 A;  2QPT A;  1B8R A;  1XA5 A;  1S36 A;  5HKY A;  5AEQ A;  1LA0 A;  1C7W A;  2R2I A;  1LXF C;  1XFV O;  2COL B;  1TIZ A;  1TNX A;  4MEW A;  3TUY B;  1S26 D;  2L2E A;  1SL8 A;  1NIW A;  3BOW A;  4C0J A;  5CPV A;  3BUM B;  2QAC A;  2LVI A;  1KCY A;  3TDI A;  1MR8 A;  1SY9 A;  3SJS A;  1LA3 A;  4MRX A;  4QJ4 B;  1CKK A;  3BOW B;  3BUN B;  4JPZ B;  1TTX A;  1W7I B;  2NCO A;  2WOS A;  4PE4 A;  3KHE A;  3BYA A;  2M3W A;  5CSF A;  1N0Y A;  1OZO A;  1ZOT B;  5B8I B;  1XFZ O;  4AOM A;  1BR4 B;  3AKA A;  4HRE E;  3EK8 A;  1UWO A;  1SL7 A;  2E6W A;  2K2A A;  1ZAC A;  1KFU S;  1Y1X A;  5AER A;  1CMG A;  3DVE A;  2H2K A;  3KF9 A;  1KK7 Z;  3VGO A;  2LVJ A;  1G4Y R;  4PDZ A;  1DJY A;  4F0Z B;  4OV2 A;  1A03 A;  1LKJ A;  2BE4 A;  2O60 A;  2CCM A;  2NLN A;  1K2H A;  1GJY A;  4NDD A;  4GNK B;  5D69 A;  5G08 A;  2RGI A;  3CGA A;  3QRX A;  4ORA B;  1DTL A;  5GQQ C;  2MLF C;  1EJ3 A;  2EC6 B;  1K8U A;  1PK0 D;  1RFJ A;  5FYX A;  4AQJ A;  1YX7 A;  1IJ6 A;  1OMD A;  2BCB A;  1TNP A;  3OB1 B;  4WQ3 A;  2G9B A;  3CR5 X;  3EKJ A;  1J1E A;  3MSE B;  1NCX A;  1J7R A;  3DVM A;  5I2Q A;  1Q80 A;  2PSR A;  3PAT A;  4I5N B;  1SYM A;  1DJH A;  1K94 A;  2JT3 A;  3SG6 A;  1HQV A;  2JQ6 A;  1NX0 A;  1YUU A;  2L4H A;  1K90 D;  1DJX A;  3I5H C;  3PSR A;  1CFC A;  4MN0 A;  4BY4 A;  4YGD B;  5HKW A;  1CMF A;  2HQW A;  2M0R A;  3CWG A;  2MRD A;  2KYF A;  2KI4 B;  3K21 A;  1K9K A;  3O4Y A;  2EC6 C;  2HF5 A;  2LUX A;  2HET A;  1NCZ A;  2M7N A;  1F54 A;  1OOJ A;  4U8D A;  5K89 A;  2WCB A;  2JPT A;  1TN4 A;  5CSJ A;  1N65 A;  5AFP A;  1QIV A;  4ORB B;  1JFJ A;  1SW8 A;  1EG3 A;  3LCP C;  1UUS A;  3SG3 A;  1BJF A;  4MZL A;  3DF0 A;  1ALW A;  1FW4 A;  2WCF A;  2ZN9 A;  1B7T Y;  4R1E A;  3EVR A;  2DOQ A;  3EKH A;  1TRF A;  4OVN F;  1YUR A;  2L98 A;  1CFD A;  1KWO B;  3DF0 B;  2F2O A;  5BPJ A;  1DGU A;  3GK4 X;  1G8I A;  2KI4 C;  4M2Q A;  2JRF A;  1RJV A;  2CNP A;  2L0P A;  1SBJ A;  2PRU A;  1CLB A;  2M9G A;  1QTX A;  3C1V A;  1L7Z A;  1NUB A;  1S6I A;  2JTZ A;  1QS7 A;  4P2Y B;  4ORC B;  1ZUZ A;  2KFH A;  1W7J B;  2ZRT A;  1FI6 A;  2EGD A;  1XFU O;  1SKT A;  2NXQ A;  1AVS A;  2K7D A;  1SCM C;  2VRG A;  2KFG A;  2M8U A;  1SCV A;  1F4O A;  1FBV A;  3I5F B;  1JFK A;  1S1E A;  1DVI A;  3VRN A;  4ETO A;  1KWO C;  1B4C A;  1J55 A;  4GUK A;  1TCO B;  4C0K A;  1BR1 B;  1IKU A;  2D8N A;  2GGM A;  2ZN8 A;  5DKR A;  3ZNI A;  2WOR A;  4GPL B;  1S5G Z;  3OB2 B;  1YUS A;  3JTD C;  3PFV A;  5HLV A;  3VRQ A;  2MA2 A;  1V1G A;  1BT6 A;  4M2P A;  3M0W A;  2KOT A;  2LM5 A;  3AAK A;  4IL1 A;  1WLM A;  3JVT B;  2F2P A;  3D10 A;  3BXK A;  1LVC D;  1B47 A;  1A2X A;  2CBL A;  5HLO A;  4D1E A;  1PRW A;  2LE9 B;  3NXA A;  3I5F C;  2AUC A;  1QVI Z;  4GFT A;  1GGZ A;  1M63 B;  3TZ1 A;  4DCK A;  1FF1 A;  3O2P A;  2LNK A;  1KQV A;  2M1K B;  4PHJ A;  1PSB A;  3A8R A;  2LMV A;  2BKH B;  2LP2 A;  1CDL A;  4CLN A;  1NPQ A;  4C0L A;  1CTR A;  1JUO A;  3EVV A;  2JTT A;  2K7C A;  3EK4 A;  4I5J A;  1AUI B;  4YBH B;  1OQP A;  1F4Q A;  3TUY C;  1REC A;  1F8H A;  3OP0 A;  4ZCU A;  1CDN A;  3CZT X;  4PCW A;  1CLM A;  2I94 A;  1PUL A;  2M49 B;  2PAS A;  3DVJ A;  2Y5I A;  2H61 A;  3FWB A;  5HKZ A;  1XFX O;  3SIB A;  2BCX A;  1H4B A;  1QX7 A;  2LAP A;  2WCE A;  1CB1 A;  1PVB A;  2BBN A;  2BEC A;  4YGE B;  1ZFS A;  2KNE A;  2LHI A;  2I2R E;  1EXR A;  3EK7 A;  2K0J A;  2JNX A;  4MBE A;  2FOT A;  2KBM A;  1WRZ A;  3TS5 B;  1QXP A;  4GGN A;  2LLT A;  4NDB A;  2JU0 A;  1GQM A;  1BF5 A;  2A4J A;  4OR9 B;  5J3X A;  1OE9 B;  1G33 A;  2PVB A;  2EHB A;  2ZND A;  1F70 A;  4YGA A;  4YGB B;  2BCA A;  3EVU A;  1AP4 A;  3O78 A;  3GK2 A;  1SK6 D;  1UHK A;  1UHJ A;  2KSP A;  1CFF A;  3ICB A;  1KK7 Y;  2JC2 A;  1DT7 B;  1UHH A;  1SRA A;  1TOP A;  2CXJ A;  3SG4 A;  2IS9 A;  1EH2 A;  3DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...