3KEVA

X-ray crystal structure of a dcun1 domain-containing protein from galdieria sulfuraria
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
183
Chain Sequence
ADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTEFSEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYSKEPSQRSLPAETAMALWDVLLRGRFSLLDSWLEFLKNNTHSISRDTWNLLYDFSQLKDLSDYDAWPVLIDDFVKWLKHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Galieria sulfuraria DCUN1 domain-containing protein
publication title Structural architecture of Galdieria sulphuraria DCN1L.
pubmed doi rcsb
source organism Galdieria sulphuraria
total genus 64
structure length 183
sequence length 189
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kevA01
1.10.238.200 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 3kevA02
3AAJA 5CSIA 2F3ZA 1V1FA 1RWYA 1IQ3A 1SYMA 5HKWA 3OB1B 3SG4A 1S6JA 4ETOA 2NXQA 4WQ2A 3KO0A 3BXKA 2BE4A 2KNEA 2L4HA 1NP8A 2DOQA 3WHTB 4AQIA 3F45A 4DS7A 1Q80A 1DF0B 5DKNA 1CM4A 3EKJA 3IF7A 1QVIY 1BOCA 1FW4A 1L7ZA 1QXPA 2BKHB 1SR6C 2OS8B 4MZJA 4QJ4B 3JVTB 1NPQA 5G08A 1MUXA 1LA0A 4GGNA 3SIAA 1BU3A 1N65A 3TDZA 3SG2A 1K94A 1IWQA 1DVIA 1ZFSA 2FJUB 1OZSA 1SL8A 2KDHA 4ICBA 1K8UA 5KSZA 2BCXA 1J1EA 5CSNA 1S5GY 2Y1MA 3CLNA 1KK8C 1J1DA 3BOWA 1JFKA 2H2KA 4E68A 1IGVA 4HSZA 3GK4X 2M7LA 1ZMZA 2Y5IA 1F4OA 2MLFC 2MLEC 1UHHA 2FOTA 3KEVA 3O2PA 4PHMA 1ODBA 2G2BA 3E3RA 2WCFA 2I7AA 2L5XB 1AVSA 2KAVA 1QATA 3AKBA 1OMDA 3OB2B 4I5JA 3TS5C 3KPXA 2QACA 3NXAA 3VRPA 3A4UB 5B8IB 1CDLA 1UP5A 4CPVA 1JBAA 1WLZA 1QIVA 3DVJA 2LNKA 1GJYA 1YVHA 5AERA 4C0JA 2LMTA 3C1VA 4GNKB 2CBLA 3ZNIA 2AAOA 1KK8B 1B7TY 1QS7A 1ZOTB 2OPOA 2WCEA 2L51A 1B8RA 2M97A 3EVRA 4F0ZB 1YURA 3D0YB 4CFRA 3AAKA 2F33A 3DVKA 4PCWA 2COLB 1RJVA 3IQQA 2K61A 3WNXB 1SRAA 3LLEA 3PM8A 1G4YR 5GQQC 1PVBA 1XVJA 5I2LA 1QTXA 3IQOA 2KFGA 1WRKA 1DF0A 2CT9A 5AANA 3TS5B 2PSRA 3BUXB 1CDPA 1B8LA 1CTRA 1MXLC 2G9BA 4YGDB 4D1EA 2ZFDA 1QX5B 2OTGC 1NCXA 2PASA 2LAPA 3PALA 4YGBB 2JT0A 3FWCA 1XK4A 1EH2A 1RECA 2HF5A 1GQMA 4OVNF 1JF2A 2JULA 5DKQA 5HKZA 1DT7B 4WQ3A 2JRFA 4XJKB 2JXCA 2FCDA 1F8HA 1JWDA 1B9AA 4YGCB 1F54A 4GAOA 2LCPA 2HETA 1RTP1 1FI6A 1SMGA 1M39A 3BUNB 2D8NA 3I5FC 3ICBA 1G33A 1QJTA 2LE9B 4GFTA 2BCBA 1K90D 1TTXA 1IRJA 2K2FA 2RGIA 1AJ5A 1XA5A 3M0WA 3O78A 1CKKA 3FS7A 2L0PA 1QLSA 1YVLA 1PSRA 4WRIA 1QLKA 2K8MB 3BQ3A 1Y0VH 5AXIA 1CMFA 1SY9A 2OTGB 5CSFA 1B8CA 3PATA 2IS9A 4MBEA 2JQ6A 1QX7A 2MJWB 2SCPA 3OX6A 3NSLA 1QV0A 4FQOA 3LCPC 1XFYO 1KFXS 2L2EA 3SG6A 5ER4X 2K7CA 1YUTA 4DIRA 3K21A 3EVVA 4A4CA 1CFFA 1YX8A 1KSOA 2V53A 4ORCB 2I94A 1XFZO 1ZUZA 1Y1UA 2K2AA 1CLMA 2KGRA 1YRUB 2NCPA 4OKHA 3RM1A 2JOJA 2LHLA 4OCIA 3VRNA 5KU1A 1S1EA 3I5FB 1XYDA 2KOTA 1LKJA 1M31A 4JPZB 3WXAA 3D0YA 1K2HA 3NSKA 3DVMA 1KFUS 4QJ3B 4N1GA 1N2DA 4C0LA 4YI9A 1WLMA 3PFVA 1CB1A 1CM1A 5D69A 3EK8A 1UHJA 1QX2A 1CLLA 3NSOA 3WHUB 3CWGA 4M2OA 2L98A 5BPJA 1YX7A 1WRLA 2BL0C 3BUMB 4FTGA 2HQ8A 3SG5A 4AQJA 4BY4A 1F70A 2K7DA 1KCYA 4YRUA 1H8BA 1AUIB 3VROA 2JTTA 1CDMA 4PDZA 3PSRA 1SK6D 4JWQA 1UWOA 4MRXA 4CIDA 3EK4A 1TCFA 2M3WA 1NX1A 2JPTA 2M8UA 4ORAB 5AEQA 2MAZA 2KAXA 1IG5A 3GK2A 1J55A 1KQMC 4XJKA 4YI8A 2KI6C 3HX4A 1FBVA 1XO5A 4ORBB 1DJGA 1EG3A 1B1GA 3SJSA 2B1UA 4XYNA 1SR6B 1NCYA 3ZWHA 1CNPA 1M63B 1OSAA 1CDNA 1YUSA 1BODA 1KSMA 2PMYA 1SPYA 1Y6WA 3I5HC 1UHKA 1XFWO 2M1UA 4MZKA 1DJWA 1A03A 3SIBA 2BKIB 2JZIA 1F4QA 1BMOA 1B47A 1VRKA 1W7JB 1LXFC 4M2PA 4PHNA 1CLBA 1EJ3A 1CMGA 1S3PA 3KF9A 2M29A 3CR2A 4P2YB 5K89A 2LUCA 1KQMB 3QRXA 4QJ5B 1DTLA 3DD4A 2KHNA 1PK0D 4BY5A 4DUQA 2LV7A 1KWOC 4PE0A 1WY9A 4GGFC 1S6CA 4OR9B 2SASA 5IBWA 1IH0A 2F3YA 1D1OA 5CSJA 5I8NA 1M46A 3I5HB 1TOPA 1J7RA 2LMVA 4R1EA 1TRFA 2EHBA 2LUXA 1K93D 2QPTA 1LA3A 2FCEA 2KFFA 1UURA 3VRQA 1UUSA 2I18A 1KFXL 1W7IB 2EC6C 2LLSA 3KHEA 2F8PA 1OQPA 4M2QA 1IKUA 1UHIA 2PRUA 1KWOB 3PN7C 4I5KA 1TNPA 2KFHA 3EK7A 1MHOA 1SNLA 1OE9B 1XFUO 4PHKA 1C7WA 4PHJA 2MHHA 1YR5A 1JF0A 1M45A 1TN4A 3CTNA 4P5OE 1HT9A 1HQVA 2KSPA 3BYAA 1IQ5A 2Q91A 3CGAA 1RROA 1DJHA 1KFUL 1R2UA 4CLNA 2KYCA 3D10A 4GPLB 2JU0A 2WORA 2Y1NA 2LLUA 4HRHA 1C7VA 1JC2A 3OHMB 5PALA 1B4CA 1TIZA 3EKHA 1GGZA 1SL7A 1LINA 5I2OA 3I5GC 1N0YA 1A75B 1BF5A 4MEWA 2WC8A 4IL1A 2MA2A 1SL9A 1TNXA 2KBIA 1S36A 4MN0A 2EC6B 1NUBA 2KAYA 2LP3A 4I5NB 2JNFA 1AP4A 2WOSA 1V1GA 4AOMA 1G8IA 2BBNA 3EVUA 5FYXA 1XFVO 1Y1XA 4I5LB 4DCKA 2NCOA 1ALVA 2VRGA 2CNPA 1AK8A 2LVKA 4PALA 3LL8B 3AKAA 3FIAA 3VGOA 5JOLA 1F55A 2ISDA 2WCBA 1NYAA 4A4BA 2H61C 4N5XA 2O5GA 2JT3A 1S26D 3GOFA 4JQ0D 3I5GB 3VRRA 1NX0A 1U5IB 1MF8B 1YUUA 4UPGA 4PE7A 1WRZA 2LLTA 5TNCA 1QIWA 2M9GA 4ZCUA 1BT6A 4L9MA 5HKYA 1NSHA 2KI6D 4GUKA 2ZNEA 1A29A 2GGMA 1RFJA 1IJ6A 2K7BA 2R2IA 2KBMA 1J7QA 1DJIA 1CFCA 4U8DA 2ZNDA 1KK7Z 1QV1A 3CR4X 4DRWA 1YRTB 1MR8A 2L4IA 2NLNA 1FPWA 5DKRA 1JUOA 1YTZC 1LVCD 1PSBA 3RLZA 1BR1B 1CFDA 1MQ1A 4GGFA 1L2OC 1NIWA 1E8AA 2LP2A 3NSIA 2F2OA 2JXLA 2BL0B 2M0RA 1J7PA 5HYDA 1JSAA 1MWNA 1TNWA 5D7FA 4TNCA 1WDCC 2LHIA 3CZTX 4PE4A 3PLFB 3JTDC 3DF0B 2Y4QA 2WNDA 1OMVA 2JNXA 4NDDA 1NX2A 3FWBA 1X02A 1R6PA 1DJXA 1BLQA 2ZN9A 1IJ5A 1OMRA 1QVIZ 1Y1AA 2K0JA 3O4YA 4YGEB 1A75A 4N1FA 2A4JA 1DGVA 3CS1A 4NDCA 4USLA 2M1KB 1ZACA 1TNQA 3TDIA 1AHRA 2CTNA 3GK1A 3O6BA 2LC5A 1K9KA 2JC2A 2CCMA 2NZ0A 2TN4A 2HPSA 2AMIA 2ZN8A 2GGZA 5F6TA 2M7NA 2HQWA 3DVEA 2BCAA 2ZKMX 1L2OB 3OP0A 1DJZA 1S5GZ 2BE6A 3SG3A 3TDUA 1WDCB 2E6WA 1TCOB 5JJGA 3JTDB 3CR5X 2KI4C 5CPVA 2JTZA 1AJ4A 3BUOB 1SBJA 2KQYA 2MBXA 5AFPA 1CFPA 2KGBC 1H4BA 1FF1A 1SCMC 1SKTA 1U5IA 1BG1A 4NQGA 2PALA 5KTYA 1NX3A 1FI5A 1A2XA 2I2RE 1KQVA 2ZRTA 2P6BB 2JT8A 2L50A 1EXRA 4MVFA 4Q04A 1S6IA 5HLVA 1K9UA 2KYFA 4MLWA 2F2PA 1BJFA 1F71A 2LANA 2LVVA 3I5IC 2O60A 3LK0A 2Q4UA 5HLOA 4HRGA 1EL4A 3HCMA 1SW8A 3OX5A 5J3XA 3TUYC 1RK9A 3BOWB 1A4PA 4CFQA 1C07A 2K7OA 1PRWA 1GGWA 1K96A 1B7TZ 1XFXO 2E30A 2LVIA 1EG4A 2BBMA 1J7OA 1QASA 2KQ6A 2KI4B 4MZLA 4YGAA 4OV2A 1SCVA 2MRDA 1BR4B 1OZOA 2H61A 2CXJA 2EGDA 3BUWB 1JFJA 4NDBA 1ALWA 2GV5A 2M49B 1SCMB 4MSPA 3DF0A 1K9PA 3TZ1A 1DMOA 3A8RA 2BECA 2LMUA 4HREE 5I2QA 2ZRSA 4GBAA 4YBHB 1DJYA 4C0KA 2PVBA 5ER5A 1DGUA 2LM5A 3SG7A 2AUCA 1NCZA 1UHNA 2JWWA 2OS8C 3LK1A 1PVAA 3MSEB 3PN7B 3JVTC 4MRYA 1KK7Y 1MXEA 3I5IB 1XK4C 4PE1A 3H4SE 1PALA 1PULA 1NWDA 4ZCVA 2LVJA 1OOJA 1K95A 3TUYB
chains in the Genus database with same CATH superfamily
3AAJA 5CSIA 2F3ZA 1V1FA 1RWYA 1IQ3A 1SYMA 5HKWA 3OB1B 3SG4A 1S6JA 4ETOA 4OZDA 2NXQA 3B88A 4WQ2A 3KO0A 5D3OA 3BXKA 2BE4A 2ERBA 2KNEA 1IIOA 2L4HA 1NP8A 2DOQA 3WHTB 4AQIA 3F45A 4DS7A 1Q80A 1DF0B 5DKNA 1CM4A 3EKJA 3IF7A 1QVIY 1BOCA 1FW4A 1L7ZA 1QXPA 3L47A 2BKHB 1SR6C 2OS8B 4MZJA 4QJ4B 3UO9A 3JVTB 1NPQA 1T14A 3K1EA 3S0BA 5G08A 1OOGA 5EL2A 1MUXA 1LA0A 2WCMA 4GGNA 2L5YA 3SIAA 1BU3A 1N65A 3TDZA 3SG2A 1K94A 1IWQA 1DVIA 1ZFSA 2FJUB 1OZSA 1SL8A 2KDHA 1OW4A 4ICBA 1K8UA 1SSEB 5KSZA 2BCXA 1J1EA 2YGUA 5CSNA 1S5GY 2Y1MA 3CLNA 1KK8C 3QMEA 1J1DA 3BOWA 1JFKA 2H2KA 4E68A 1IGVA 4HSZA 3GK4X 4PT1A 3N7HA 2M7LA 1ZMZA 2Y5IA 1F4OA 4FQTA 2MLFC 2MLEC 1UHHA 2FOTA 3KEVA 3O2PA 4PHMA 1ODBA 2G2BA 3E3RA 2WCFA 2I7AA 2L5XB 1AVSA 2KAVA 1QATA 3AKBA 1OMDA 3OB2B 4I5JA 3TS5C 3KPXA 1ORGA 2QACA 3NXAA 3VRPA 3A4UB 3R1OA 5B8IB 1CDLA 1UP5A 4CPVA 1DELA 1JBAA 1WLZA 1QIVA 3DVJA 2LNKA 1GJYA 1YVHA 5AERA 4JD9A 4C0JA 2LMTA 3C1VA 4GNKB 2CBLA 3ZNIA 2AAOA 1KK8B 1B7TY 1QS7A 1ZOTB 2OPOA 3BJHA 5DICA 2WCEA 2L51A 1B8RA 2M97A 3EVRA 3PJIA 4F0ZB 1YURA 3D0YB 4CFRA 3AAKA 3CABA 2F33A 3DVKA 4PCWA 2COLB 1RJVA 3IQQA 2K61A 3WNXB 1SRAA 3LLEA 3PM8A 4INWA 1G4YR 5GQQC 1PVBA 1XVJA 5I2LA 1QTXA 3CYZA 3IQOA 2KFGA 1WRKA 1DF0A 2CT9A 5AANA 3TS5B 3V2LA 3RZSA 3CZ1A 2PSRA 3BUXB 3CDNA 3EG5B 1CDPA 1B8LA 1CTRA 1MXLC 2G9BA 4YGDB 4D1EA 2ZFDA 1QX5B 2OTGC 1NCXA 2PASA 2LAPA 3DZTA 3PALA 4YGBB 2JT0A 3FWCA 1XK4A 1EH2A 1OOIX 1RECA 2HF5A 1GQMA 4OVNF 1JF2A 2JULA 5DKQA 1Z2CB 5HKZA 1DT7B 4WQ3A 2JRFA 4XJKB 2JXCA 2FCDA 1F8HA 1JWDA 1B9AA 4F7FA 4YGCB 1F54A 4GAOA 3L4LA 2LCPA 2HETA 1RTP1 1OOHA 1FI6A 1SMGA 1M39A 3BUNB 2D8NA 3I5FC 3ICBA 5HL1A 1G33A 1QJTA 2LE9B 4GFTA 2BCBA 1K90D 1TTXA 1GM0A 1IRJA 2K2FA 2RGIA 1AJ5A 1XA5A 3M0WA 3O78A 1CKKA 3FS7A 2L0PA 4INXA 2K60A 1QLSA 1YVLA 1PSRA 4WRIA 1QLKA 2K8MB 3BQ3A 2QDIA 1Y0VH 3IVTA 5AXIA 1CMFA 1SY9A 2OTGB 3D75A 5CSFA 1B8CA 3PATA 2IS9A 4MBEA 2JQ6A 1QX7A 2MJWB 2SCPA 2WCJA 3OX6A 3NSLA 1QV0A 4FQOA 3LCPC 5FI6A 1XFYO 3B87A 1KFXS 2P70A 2L2EA 3SG6A 2WCLA 2K7CA 5ER4X 1YUTA 4DIRA 3K21A 3EVVA 4A4CA 1CFFA 1YX8A 1KSOA 2V53A 4ORCB 2I94A 1XFZO 1ZUZA 1Y1UA 2K2AA 1CLMA 2KGRA 1YRUB 2NCPA 4OKHA 3RM1A 2JOJA 2LHLA 4OCIA 3VRNA 5KU1A 4IJ7A 1S1EA 3I5FB 1XYDA 2KOTA 1LKJA 1M31A 4JPZB 3WXAA 3D0YA 1K2HA 1TWOA 3R72A 3NSKA 3DVMA 1KFUS 4QJ3B 4N1GA 1N2DA 4C0LA 2L2CA 1WLMA 4YI9A 3PFVA 3S0EA 1CB1A 1CM1A 5D69A 3EK8A 1UHJA 1QX2A 1CLLA 3NSOA 3WHUB 3CWGA 4M2OA 2L98A 5BPJA 1YX7A 1WRLA 1Z4HA 2BL0C 3BUMB 4FTGA 2HQ8A 3SG5A 4AQJA 4BY4A 3S0FA 2K7DA 3SS5A 4YRUA 1F70A 1KCYA 1H8BA 1AUIB 3VROA 2JTTA 1CDMA 4PDZA 3PSRA 1SK6D 4JWQA 1UWOA 4MRXA 4CIDA 3EK4A 1TCFA 2M3WA 1NX1A 2JPTA 2M8UA 4ORAB 5AEQA 2MAZA 2KAXA 1IG5A 3GK2A 1J55A 1TUZA 1KQMC 4XJKA 1C3YA 1LS8A 3B86A 4YI8A 2KI6C 3HX4A 1FBVA 2KPHA 1XO5A 4ORBB 1DJGA 1EG3A 1B1GA 3SJSA 2B1UA 4XYNA 1SR6B 1NCYA 3ZWHA 1CNPA 1M63B 2FJYA 1OSAA 1CDNA 1YUSA 1BODA 1KSMA 2PMYA 1SPYA 1Y6WA 3I5HC 1UHKA 1XFWO 2M1UA 4MZKA 1DJWA 1A03A 3SIBA 2BKIB 1QWVA 2JZIA 1F4QA 1BMOA 1B47A 1VRKA 1W7JB 1LXFC 4M2PA 4PHNA 1CLBA 1EJ3A 1CMGA 2QEOA 1S3PA 3KF9A 2M29A 3CR2A 4P2YB 5K89A 2LUCA 1KQMB 3QRXA 4QJ5B 1DTLA 3DD4A 2KHNA 1PK0D 3VB1A 4BY5A 4DUQA 2LV7A 1KWOC 4PE0A 1WY9A 4GGFC 1S6CA 4OR9B 2SASA 3R1VA 5IBWA 1IH0A 2F3YA 1D1OA 5CSJA 5I8NA 1M46A 3D77A 3I5HB 1TOPA 1J7RA 3OBVA 2LMVA 4R1EA 1TRFA 1TUJA 2EHBA 2LUXA 1K93D 2QPTA 3PM2A 1LA3A 1DC1A 3CZ2A 2FCEA 2KFFA 1UURA 2PQLA 3VRQA 3Q8IA 1UUSA 2I18A 1KFXL 1W7IB 2EC6C 2LLSA 3KHEA 2F8PA 1OQPA 4M2QA 1IKUA 1UHIA 2BAPA 2KLDA 2PRUA 3OGNA 1KWOB 3PN7C 4I5KA 1TNPA 2KFHA 3EK7A 1MHOA 1SNLA 1OE9B 1XFUO 4PHKA 1C7WA 4PHJA 2MHHA 1YR5A 5FI2A 1JF0A 1M45A 1TN4A 3CTNA 4P5OE 1HT9A 1HQVA 2KSPA 3BYAA 1OOFA 1IQ5A 2Q91A 3CGAA 1RROA 1DJHA 1KFUL 1R2UA 4CLNA 2KYCA 3D10A 4GPLB 2JU0A 2WORA 2Y1NA 3S0GA 2LLUA 3NGVA 3BFBA 4HRHA 1C7VA 1JC2A 2P71A 3OHMB 5PALA 1B4CA 1TIZA 3EKHA 1GGZA 1SL7A 1LINA 2PYQA 3FE9A 3I5GC 5I2OA 2WCKA 1N0YA 1A75B 3L4AA 1BF5A 4MEWA 2WC8A 4IL1A 2MA2A 1SL9A 1TNXA 2KBIA 1S36A 2GTEA 4MN0A 2EC6B 1NUBA 2KAYA 2LP3A 4I5NB 2JNFA 1AP4A 3D73A 2WOSA 3UNWA 2QEVA 2BNXA 1V1GA 3B7AA 4AOMA 1G8IA 2BBNA 3EVUA 5FYXA 1XFVO 1Y1XA 3DYEA 4I5LB 3FE6A 4DCKA 2NCOA 1ALVA 2VRGA 2CNPA 1AK8A 2LVKA 4PALA 3LL8B 3AKAA 3FIAA 1C3ZA 3VGOA 5JOLA 1F55A 2ISDA 2WCBA 1NYAA 2WC6A 4A4BA 2H61C 4N5XA 2O5GA 2JT3A 1S26D 1DEKA 3GOFA 4JQ0D 3I5GB 3VRRA 1NX0A 1U5IB 1MF8B 1YUUA 2QEBA 4UPGA 1W9ZA 1WRZA 2LLTA 4PE7A 1QIWA 5TNCA 5FI7A 2M9GA 4ZCUA 2JPOA 3CZ0A 1BT6A 4L9MA 3D76A 1NSHA 5HKYA 2KI6D 3R1PA 2ZNEA 4GUKA 1A29A 2GGMA 1RFJA 1IJ6A 2K7BA 2R2IA 2KBMA 1J7QA 3SS4A 1P28A 1DJIA 3BFHA 4U8DA 1CFCA 2ZNDA 1KK7Z 1QV1A 2WC5A 3CR4X 4DRWA 1YRTB 1MR8A 2L4IA 2NLNA 5I94A 1FPWA 5DKRA 3NHTA 1JUOA 1YTZC 1LVCD 1PSBA 3FE8A 3RLZA 1BR1B 1CFDA 1MQ1A 2QEHA 4GGFA 1L2OC 1NIWA 1E8AA 2LP2A 3NSIA 2F2OA 2JXLA 2BL0B 2M0RA 1J7PA 5HYDA 1JSAA 1MWNA 1TNWA 5D7FA 4TNCA 1WDCC 2LHIA 3CZTX 4PE4A 3PLFB 3JTDC 3DF0B 2Y4QA 2WNDA 1OMVA 2JNXA 4NDDA 1NX2A 3FWBA 1X02A 3BFAA 1R6PA 1DJXA 1BLQA 1XFRA 2ZN9A 1IJ5A 1OMRA 1QVIZ 1Y1AA 2K0JA 3O4YA 4YGEB 1A75A 4N1FA 2A4JA 3O6BA 1DGVA 3DY9A 3CS1A 4NDCA 4USLA 2M1KB 1ZACA 1TNQA 3TDIA 1AHRA 2CTNA 3GK1A 3O4XA 2LC5A 1K9KA 2JC2A 2CCMA 2NZ0A 2TN4A 2HPSA 2AMIA 2ZN8A 2GGZA 5F6TA 2M7NA 2HQWA 3DVEA 2BCAA 3D78A 2WCHA 2KLEA 2ZKMX 1L2OB 2H8VA 3OP0A 1DJZA 1S5GZ 2BE6A 3SG3A 3TDUA 1WDCB 2E6WA 1TCOB 5JJGA 3JTDB 3CR5X 2KI4C 5CPVA 2JTZA 1AJ4A 3BUOB 3SS3A 1SBJA 2KQYA 2MBXA 5AFPA 1CFPA 2KGBC 1H4BA 1FF1A 1SCMC 1SKTA 1U5IA 1BG1A 4NQGA 2PALA 5KTYA 1NX3A 1FI5A 1A2XA 2I2RE 1KQVA 1DQEA 2ZRTA 2P6BB 2JT8A 2L50A 1EXRA 4MVFA 4Q04A 1S6IA 5HLVA 1K9UA 2KYFA 4MLWA 2F2PA 1BJFA 1F71A 2LANA 2LVVA 3I5IC 2O60A 3D74A 3LK0A 2Q4UA 3NHIA 5HLOA 4HRGA 1EL4A 3HCMA 1SW8A 3OX5A 5J3XA 3TUYC 1RK9A 3BOWB 1A4PA 4JKTA 4CFQA 2K7OA 1PRWA 1C07A 1GGWA 1K96A 1B7TZ 1XFXO 2E30A 2LVIA 1EG4A 2BBMA 1J7OA 1QASA 2KQ6A 2KI4B 4MZLA 4YGAA 4OV2A 3DXLA 1SCVA 2MRDA 1BR4B 1OZOA 2H61A 3B6XA 2CXJA 2EGDA 3BUWB 1JFJA 4NDBA 1ALWA 2GV5A 2M49B 1SCMB 4MSPA 3DF0A 1K9PA 3TZ1A 1DMOA 3A8RA 2BECA 2LMUA 4HREE 5I2QA 2ZRSA 4GBAA 4YBHB 1DJYA 4C0KA 2PVBA 3S0DA 5ER5A 1DGUA 2LM5A 3S0AA 3SG7A 2AUCA 1NCZA 1UHNA 2JWWA 2OS8C 3LK1A 4KYNA 1PVAA 3MSEB 3PN7B 3JVTC 4MRYA 1KK7Y 1MXEA 3I5IB 1XK4C 4PE1A 3H4SE 1PALA 1PULA 1NWDA 4ZCVA 2LVJA 1OOJA 1K95A 3TUYB
chains in the Genus database with same CATH topology
3AAJA 5CSIA 2F3ZA 1V1FA 1RWYA 1IQ3A 1SYMA 5HKWA 3OB1B 3SG4A 1S6JA 4ETOA 2NXQA 4WQ2A 3KO0A 5D3OA 3BXKA 2BE4A 2KNEA 2L4HA 1NP8A 2DOQA 3WHTB 4AQIA 3F45A 4DS7A 1Q80A 1DF0B 5DKNA 1CM4A 3EKJA 3IF7A 1QVIY 1BOCA 1FW4A 1L7ZA 1QXPA 2BKHB 1SR6C 2OS8B 4MZJA 4QJ4B 3UO9A 3JVTB 1NPQA 5G08A 1MUXA 1LA0A 4GGNA 2L5YA 3SIAA 1BU3A 1N65A 3TDZA 3SG2A 1K94A 1IWQA 1DVIA 1ZFSA 2FJUB 1OZSA 1SL8A 2KDHA 4ICBA 1K8UA 5KSZA 2BCXA 1J1EA 2YGUA 5CSNA 1S5GY 2Y1MA 3CLNA 1KK8C 1J1DA 3BOWA 1JFKA 2H2KA 4E68A 1IGVA 4HSZA 3GK4X 2M7LA 1ZMZA 2Y5IA 1F4OA 2MLFC 2MLEC 1UHHA 2FOTA 3KEVA 3O2PA 4PHMA 1ODBA 2G2BA 3E3RA 2WCFA 2I7AA 2L5XB 1AVSA 2KAVA 1QATA 3AKBA 1OMDA 3OB2B 4I5JA 3TS5C 3KPXA 2QACA 3NXAA 3VRPA 3A4UB 5B8IB 1CDLA 1UP5A 4CPVA 1DELA 1JBAA 1WLZA 1QIVA 3DVJA 2LNKA 1GJYA 1YVHA 5AERA 4C0JA 2LMTA 3C1VA 4GNKB 2CBLA 3ZNIA 2AAOA 1KK8B 1B7TY 1QS7A 1ZOTB 2OPOA 2WCEA 2L51A 1B8RA 2M97A 3EVRA 4F0ZB 1YURA 3D0YB 4CFRA 3AAKA 2F33A 3DVKA 4PCWA 2COLB 1RJVA 3IQQA 2K61A 3WNXB 1SRAA 3LLEA 3PM8A 1G4YR 5GQQC 1PVBA 1XVJA 5I2LA 1QTXA 3IQOA 2KFGA 1WRKA 1DF0A 2CT9A 5AANA 3TS5B 2PSRA 3BUXB 3EG5B 1CDPA 1B8LA 1CTRA 1MXLC 2G9BA 4YGDB 4D1EA 2ZFDA 1QX5B 2OTGC 1NCXA 2PASA 2LAPA 3PALA 4YGBB 2JT0A 3FWCA 1XK4A 1EH2A 1RECA 2HF5A 1GQMA 4OVNF 1JF2A 2JULA 5DKQA 5HKZA 1DT7B 1Z2CB 4WQ3A 2JRFA 4XJKB 2JXCA 2FCDA 1F8HA 1JWDA 1B9AA 4YGCB 1F54A 4GAOA 2LCPA 2HETA 1RTP1 1FI6A 1SMGA 1M39A 3BUNB 2D8NA 3I5FC 3ICBA 5HL1A 1G33A 1QJTA 2LE9B 4GFTA 2BCBA 1K90D 1TTXA 1IRJA 2K2FA 2RGIA 1AJ5A 1XA5A 3M0WA 3O78A 1CKKA 3FS7A 2L0PA 2K60A 1QLSA 1YVLA 1PSRA 4WRIA 1QLKA 2K8MB 3BQ3A 1Y0VH 3IVTA 5AXIA 1CMFA 1SY9A 2OTGB 5CSFA 1B8CA 3PATA 2IS9A 4MBEA 2JQ6A 1QX7A 2MJWB 2SCPA 3OX6A 3NSLA 1QV0A 4FQOA 3LCPC 5FI6A 1XFYO 1KFXS 2L2EA 3SG6A 5ER4X 2K7CA 1YUTA 4DIRA 3K21A 3EVVA 4A4CA 1CFFA 1YX8A 1KSOA 2V53A 4ORCB 2I94A 1XFZO 1ZUZA 1Y1UA 2K2AA 1CLMA 2KGRA 1YRUB 2NCPA 4OKHA 3RM1A 2JOJA 2LHLA 4OCIA 3VRNA 5KU1A 4IJ7A 1S1EA 3I5FB 1XYDA 2KOTA 1LKJA 1M31A 4JPZB 3WXAA 3D0YA 1K2HA 3NSKA 3DVMA 1KFUS 4QJ3B 4N1GA 1N2DA 4C0LA 4YI9A 1WLMA 3PFVA 1CB1A 1CM1A 5D69A 3EK8A 1UHJA 1QX2A 1CLLA 3NSOA 3WHUB 3CWGA 4M2OA 2L98A 5BPJA 1YX7A 1WRLA 1Z4HA 2BL0C 3BUMB 4FTGA 2HQ8A 3SG5A 4AQJA 4BY4A 1F70A 2K7DA 1KCYA 4YRUA 3SS5A 1H8BA 1AUIB 3VROA 2JTTA 1CDMA 4PDZA 3PSRA 1SK6D 4JWQA 1UWOA 4MRXA 4CIDA 3EK4A 1TCFA 2M3WA 1NX1A 2JPTA 2M8UA 4ORAB 5AEQA 2MAZA 2KAXA 1IG5A 3GK2A 1J55A 1KQMC 4XJKA 4YI8A 2KI6C 3HX4A 1FBVA 1XO5A 4ORBB 1DJGA 1EG3A 1B1GA 3SJSA 2B1UA 4XYNA 1SR6B 1NCYA 3ZWHA 1CNPA 1M63B 1OSAA 1CDNA 1YUSA 1BODA 1KSMA 2PMYA 1SPYA 1Y6WA 3I5HC 1UHKA 1XFWO 2M1UA 4MZKA 1DJWA 1A03A 3SIBA 2BKIB 2JZIA 1F4QA 1BMOA 1B47A 1VRKA 1W7JB 1LXFC 4M2PA 4PHNA 1CLBA 1EJ3A 1CMGA 1S3PA 3KF9A 2M29A 3CR2A 4P2YB 5K89A 2LUCA 1KQMB 3QRXA 4QJ5B 1DTLA 3DD4A 2KHNA 1PK0D 4BY5A 4DUQA 2LV7A 1KWOC 4PE0A 1WY9A 4GGFC 1S6CA 4OR9B 2SASA 5IBWA 1IH0A 2F3YA 1D1OA 5CSJA 5I8NA 1M46A 3I5HB 1TOPA 1J7RA 3OBVA 2LMVA 4R1EA 1TRFA 2EHBA 2LUXA 1K93D 2QPTA 3PM2A 1LA3A 1DC1A 2FCEA 2KFFA 1UURA 3VRQA 1UUSA 2I18A 1KFXL 1W7IB 2EC6C 2LLSA 3KHEA 2F8PA 1OQPA 4M2QA 1IKUA 1UHIA 2BAPA 2KLDA 2PRUA 1KWOB 3PN7C 4I5KA 1TNPA 2KFHA 3EK7A 1MHOA 1SNLA 1OE9B 1XFUO 4PHKA 1C7WA 4PHJA 2MHHA 1YR5A 5FI2A 1JF0A 1M45A 1TN4A 3CTNA 4P5OE 1HT9A 1HQVA 2KSPA 3BYAA 1IQ5A 2Q91A 3CGAA 1RROA 1DJHA 1KFUL 1R2UA 4CLNA 2KYCA 3D10A 4GPLB 2JU0A 2WORA 2Y1NA 2LLUA 4HRHA 1C7VA 1JC2A 3OHMB 5PALA 1B4CA 1TIZA 3EKHA 1GGZA 1SL7A 1LINA 5I2OA 3I5GC 1N0YA 1A75B 1BF5A 4MEWA 2WC8A 4IL1A 2MA2A 1SL9A 1TNXA 2KBIA 1S36A 4MN0A 2EC6B 1NUBA 2KAYA 2LP3A 4I5NB 2JNFA 1AP4A 2WOSA 3UNWA 2BNXA 1V1GA 4AOMA 1G8IA 2BBNA 3EVUA 5FYXA 1XFVO 1Y1XA 4I5LB 4DCKA 2NCOA 1ALVA 2VRGA 2CNPA 1AK8A 2LVKA 4PALA 3LL8B 3AKAA 3FIAA 3VGOA 3O4XA 5JOLA 1F55A 2ISDA 2WCBA 1NYAA 4A4BA 2H61C 4N5XA 2O5GA 2JT3A 1S26D 1DEKA 3GOFA 4JQ0D 3I5GB 3VRRA 1NX0A 1U5IB 1MF8B 1YUUA 4UPGA 4PE7A 1WRZA 2LLTA 5TNCA 1QIWA 1W9ZA 5FI7A 2M9GA 4ZCUA 1BT6A 4L9MA 5HKYA 1NSHA 2KI6D 4GUKA 2ZNEA 1A29A 2GGMA 1RFJA 1IJ6A 2K7BA 2R2IA 2KBMA 1J7QA 3SS4A 1DJIA 1CFCA 4U8DA 2ZNDA 1KK7Z 1QV1A 3CR4X 4DRWA 1YRTB 1MR8A 2L4IA 2NLNA 1FPWA 5I94A 5DKRA 1JUOA 1YTZC 1LVCD 1PSBA 3RLZA 1BR1B 1CFDA 1MQ1A 4GGFA 1L2OC 1NIWA 1E8AA 2LP2A 3NSIA 2F2OA 2JXLA 2BL0B 2M0RA 1J7PA 5HYDA 1JSAA 1MWNA 1TNWA 5D7FA 4TNCA 1WDCC 2LHIA 3CZTX 4PE4A 3PLFB 3JTDC 3DF0B 2Y4QA 2WNDA 1OMVA 2JNXA 4NDDA 1NX2A 3FWBA 1X02A 1R6PA 1DJXA 1BLQA 2ZN9A 1IJ5A 1OMRA 1QVIZ 1Y1AA 2K0JA 3O4YA 4YGEB 1A75A 4N1FA 2A4JA 1DGVA 3CS1A 4NDCA 4USLA 2M1KB 1ZACA 1TNQA 3TDIA 1AHRA 2CTNA 3GK1A 3O6BA 2LC5A 1K9KA 2JC2A 2CCMA 2NZ0A 2TN4A 2HPSA 2AMIA 2ZN8A 2GGZA 5F6TA 2M7NA 2HQWA 3DVEA 2BCAA 2KLEA 2ZKMX 1L2OB 3OP0A 1DJZA 1S5GZ 2BE6A 3SG3A 3TDUA 1WDCB 2E6WA 1TCOB 5JJGA 3JTDB 3CR5X 2KI4C 5CPVA 2JTZA 1AJ4A 3BUOB 3SS3A 1SBJA 2KQYA 2MBXA 5AFPA 1CFPA 2KGBC 1H4BA 1FF1A 1SCMC 1SKTA 1U5IA 1BG1A 4NQGA 2PALA 5KTYA 1NX3A 1FI5A 1A2XA 2I2RE 1KQVA 2ZRTA 2P6BB 2JT8A 2L50A 1EXRA 4MVFA 4Q04A 1S6IA 5HLVA 1K9UA 2KYFA 4MLWA 2F2PA 1BJFA 1F71A 2LANA 2LVVA 3I5IC 2O60A 3LK0A 2Q4UA 5HLOA 4HRGA 1EL4A 3HCMA 1SW8A 3OX5A 5J3XA 3TUYC 1RK9A 3BOWB 1A4PA 4CFQA 1C07A 2K7OA 1PRWA 1GGWA 4JKTA 1K96A 1B7TZ 1XFXO 2E30A 2LVIA 1EG4A 2BBMA 1J7OA 1QASA 2KQ6A 2KI4B 4MZLA 4YGAA 4OV2A 1SCVA 2MRDA 1BR4B 1OZOA 2H61A 2CXJA 2EGDA 3BUWB 1JFJA 4NDBA 1ALWA 2GV5A 2M49B 1SCMB 4MSPA 3DF0A 1K9PA 3TZ1A 1DMOA 3A8RA 2BECA 2LMUA 4HREE 5I2QA 2ZRSA 4GBAA 4YBHB 1DJYA 4C0KA 2PVBA 5ER5A 1DGUA 2LM5A 3SG7A 2AUCA 1NCZA 1UHNA 2JWWA 2OS8C 3LK1A 4KYNA 1PVAA 3MSEB 3PN7B 3JVTC 4MRYA 1KK7Y 1MXEA 3I5IB 1XK4C 4PE1A 3H4SE 1PALA 1PULA 1NWDA 4ZCVA 2LVJA 1OOJA 1K95A 3TUYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAJ A;  5CSI A;  2F3Z A;  1V1F A;  1RWY A;  1IQ3 A;  1SYM A;  5HKW A;  3OB1 B;  3SG4 A;  1S6J A;  4ETO A;  2NXQ A;  4WQ2 A;  3KO0 A;  3BXK A;  2BE4 A;  2KNE A;  2L4H A;  1NP8 A;  2DOQ A;  3WHT B;  4AQI A;  3F45 A;  4DS7 A;  1Q80 A;  1DF0 B;  5DKN A;  1CM4 A;  3EKJ A;  3IF7 A;  1QVI Y;  1BOC A;  1FW4 A;  1L7Z A;  1QXP A;  2BKH B;  1SR6 C;  2OS8 B;  4MZJ A;  4QJ4 B;  3JVT B;  1NPQ A;  5G08 A;  1MUX A;  1LA0 A;  4GGN A;  3SIA A;  1BU3 A;  1N65 A;  3TDZ A;  3SG2 A;  1K94 A;  1IWQ A;  1DVI A;  1ZFS A;  2FJU B;  1OZS A;  1SL8 A;  2KDH A;  4ICB A;  1K8U A;  5KSZ A;  2BCX A;  1J1E A;  5CSN A;  1S5G Y;  2Y1M A;  3CLN A;  1KK8 C;  1J1D A;  3BOW A;  1JFK A;  2H2K A;  4E68 A;  1IGV A;  4HSZ A;  3GK4 X;  2M7L A;  1ZMZ A;  2Y5I A;  1F4O A;  2MLF C;  2MLE C;  1UHH A;  2FOT A;  3KEV A;  3O2P A;  4PHM A;  1ODB A;  2G2B A;  3E3R A;  2WCF A;  2I7A A;  2L5X B;  1AVS A;  2KAV A;  1QAT A;  3AKB A;  1OMD A;  3OB2 B;  4I5J A;  3TS5 C;  3KPX A;  2QAC A;  3NXA A;  3VRP A;  3A4U B;  5B8I B;  1CDL A;  1UP5 A;  4CPV A;  1JBA A;  1WLZ A;  1QIV A;  3DVJ A;  2LNK A;  1GJY A;  1YVH A;  5AER A;  4C0J A;  2LMT A;  3C1V A;  4GNK B;  2CBL A;  3ZNI A;  2AAO A;  1KK8 B;  1B7T Y;  1QS7 A;  1ZOT B;  2OPO A;  2WCE A;  2L51 A;  1B8R A;  2M97 A;  3EVR A;  4F0Z B;  1YUR A;  3D0Y B;  4CFR A;  3AAK A;  2F33 A;  3DVK A;  4PCW A;  2COL B;  1RJV A;  3IQQ A;  2K61 A;  3WNX B;  1SRA A;  3LLE A;  3PM8 A;  1G4Y R;  5GQQ C;  1PVB A;  1XVJ A;  5I2L A;  1QTX A;  3IQO A;  2KFG A;  1WRK A;  1DF0 A;  2CT9 A;  5AAN A;  3TS5 B;  2PSR A;  3BUX B;  1CDP A;  1B8L A;  1CTR A;  1MXL C;  2G9B A;  4YGD B;  4D1E A;  2ZFD A;  1QX5 B;  2OTG C;  1NCX A;  2PAS A;  2LAP A;  3PAL A;  4YGB B;  2JT0 A;  3FWC A;  1XK4 A;  1EH2 A;  1REC A;  2HF5 A;  1GQM A;  4OVN F;  1JF2 A;  2JUL A;  5DKQ A;  5HKZ A;  1DT7 B;  4WQ3 A;  2JRF A;  4XJK B;  2JXC A;  2FCD A;  1F8H A;  1JWD A;  1B9A A;  4YGC B;  1F54 A;  4GAO A;  2LCP A;  2HET A;  1RTP 1;  1FI6 A;  1SMG A;  1M39 A;  3BUN B;  2D8N A;  3I5F C;  3ICB A;  1G33 A;  1QJT A;  2LE9 B;  4GFT A;  2BCB A;  1K90 D;  1TTX A;  1IRJ A;  2K2F A;  2RGI A;  1AJ5 A;  1XA5 A;  3M0W A;  3O78 A;  1CKK A;  3FS7 A;  2L0P A;  1QLS A;  1YVL A;  1PSR A;  4WRI A;  1QLK A;  2K8M B;  3BQ3 A;  1Y0V H;  5AXI A;  1CMF A;  1SY9 A;  2OTG B;  5CSF A;  1B8C A;  3PAT A;  2IS9 A;  4MBE A;  2JQ6 A;  1QX7 A;  2MJW B;  2SCP A;  3OX6 A;  3NSL A;  1QV0 A;  4FQO A;  3LCP C;  1XFY O;  1KFX S;  2L2E A;  3SG6 A;  5ER4 X;  2K7C A;  1YUT A;  4DIR A;  3K21 A;  3EVV A;  4A4C A;  1CFF A;  1YX8 A;  1KSO A;  2V53 A;  4ORC B;  2I94 A;  1XFZ O;  1ZUZ A;  1Y1U A;  2K2A A;  1CLM A;  2KGR A;  1YRU B;  2NCP A;  4OKH A;  3RM1 A;  2JOJ A;  2LHL A;  4OCI A;  3VRN A;  5KU1 A;  1S1E A;  3I5F B;  1XYD A;  2KOT A;  1LKJ A;  1M31 A;  4JPZ B;  3WXA A;  3D0Y A;  1K2H A;  3NSK A;  3DVM A;  1KFU S;  4QJ3 B;  4N1G A;  1N2D A;  4C0L A;  4YI9 A;  1WLM A;  3PFV A;  1CB1 A;  1CM1 A;  5D69 A;  3EK8 A;  1UHJ A;  1QX2 A;  1CLL A;  3NSO A;  3WHU B;  3CWG A;  4M2O A;  2L98 A;  5BPJ A;  1YX7 A;  1WRL A;  2BL0 C;  3BUM B;  4FTG A;  2HQ8 A;  3SG5 A;  4AQJ A;  4BY4 A;  1F70 A;  2K7D A;  1KCY A;  4YRU A;  1H8B A;  1AUI B;  3VRO A;  2JTT A;  1CDM A;  4PDZ A;  3PSR A;  1SK6 D;  4JWQ A;  1UWO A;  4MRX A;  4CID A;  3EK4 A;  1TCF A;  2M3W A;  1NX1 A;  2JPT A;  2M8U A;  4ORA B;  5AEQ A;  2MAZ A;  2KAX A;  1IG5 A;  3GK2 A;  1J55 A;  1KQM C;  4XJK A;  4YI8 A;  2KI6 C;  3HX4 A;  1FBV A;  1XO5 A;  4ORB B;  1DJG A;  1EG3 A;  1B1G A;  3SJS A;  2B1U A;  4XYN A;  1SR6 B;  1NCY A;  3ZWH A;  1CNP A;  1M63 B;  1OSA A;  1CDN A;  1YUS A;  1BOD A;  1KSM A;  2PMY A;  1SPY A;  1Y6W A;  3I5H C;  1UHK A;  1XFW O;  2M1U A;  4MZK A;  1DJW A;  1A03 A;  3SIB A;  2BKI B;  2JZI A;  1F4Q A;  1BMO A;  1B47 A;  1VRK A;  1W7J B;  1LXF C;  4M2P A;  4PHN A;  1CLB A;  1EJ3 A;  1CMG A;  1S3P A;  3KF9 A;  2M29 A;  3CR2 A;  4P2Y B;  5K89 A;  2LUC A;  1KQM B;  3QRX A;  4QJ5 B;  1DTL A;  3DD4 A;  2KHN A;  1PK0 D;  4BY5 A;  4DUQ A;  2LV7 A;  1KWO C;  4PE0 A;  1WY9 A;  4GGF C;  1S6C A;  4OR9 B;  2SAS A;  5IBW A;  1IH0 A;  2F3Y A;  1D1O A;  5CSJ A;  5I8N A;  1M46 A;  3I5H B;  1TOP A;  1J7R A;  2LMV A;  4R1E A;  1TRF A;  2EHB A;  2LUX A;  1K93 D;  2QPT A;  1LA3 A;  2FCE A;  2KFF A;  1UUR A;  3VRQ A;  1UUS A;  2I18 A;  1KFX L;  1W7I B;  2EC6 C;  2LLS A;  3KHE A;  2F8P A;  1OQP A;  4M2Q A;  1IKU A;  1UHI A;  2PRU A;  1KWO B;  3PN7 C;  4I5K A;  1TNP A;  2KFH A;  3EK7 A;  1MHO A;  1SNL A;  1OE9 B;  1XFU O;  4PHK A;  1C7W A;  4PHJ A;  2MHH A;  1YR5 A;  1JF0 A;  1M45 A;  1TN4 A;  3CTN A;  4P5O E;  1HT9 A;  1HQV A;  2KSP A;  3BYA A;  1IQ5 A;  2Q91 A;  3CGA A;  1RRO A;  1DJH A;  1KFU L;  1R2U A;  4CLN A;  2KYC A;  3D10 A;  4GPL B;  2JU0 A;  2WOR A;  2Y1N A;  2LLU A;  4HRH A;  1C7V A;  1JC2 A;  3OHM B;  5PAL A;  1B4C A;  1TIZ A;  3EKH A;  1GGZ A;  1SL7 A;  1LIN A;  5I2O A;  3I5G C;  1N0Y A;  1A75 B;  1BF5 A;  4MEW A;  2WC8 A;  4IL1 A;  2MA2 A;  1SL9 A;  1TNX A;  2KBI A;  1S36 A;  4MN0 A;  2EC6 B;  1NUB A;  2KAY A;  2LP3 A;  4I5N B;  2JNF A;  1AP4 A;  2WOS A;  1V1G A;  4AOM A;  1G8I A;  2BBN A;  3EVU A;  5FYX A;  1XFV O;  1Y1X A;  4I5L B;  4DCK A;  2NCO A;  1ALV A;  2VRG A;  2CNP A;  1AK8 A;  2LVK A;  4PAL A;  3LL8 B;  3AKA A;  3FIA A;  3VGO A;  5JOL A;  1F55 A;  2ISD A;  2WCB A;  1NYA A;  4A4B A;  2H61 C;  4N5X A;  2O5G A;  2JT3 A;  1S26 D;  3GOF A;  4JQ0 D;  3I5G B;  3VRR A;  1NX0 A;  1U5I B;  1MF8 B;  1YUU A;  4UPG A;  4PE7 A;  1WRZ A;  2LLT A;  5TNC A;  1QIW A;  2M9G A;  4ZCU A;  1BT6 A;  4L9M A;  5HKY A;  1NSH A;  2KI6 D;  4GUK A;  2ZNE A;  1A29 A;  2GGM A;  1RFJ A;  1IJ6 A;  2K7B A;  2R2I A;  2KBM A;  1J7Q A;  1DJI A;  1CFC A;  4U8D A;  2ZND A;  1KK7 Z;  1QV1 A;  3CR4 X;  4DRW A;  1YRT B;  1MR8 A;  2L4I A;  2NLN A;  1FPW A;  5DKR A;  1JUO A;  1YTZ C;  1LVC D;  1PSB A;  3RLZ A;  1BR1 B;  1CFD A;  1MQ1 A;  4GGF A;  1L2O C;  1NIW A;  1E8A A;  2LP2 A;  3NSI A;  2F2O A;  2JXL A;  2BL0 B;  2M0R A;  1J7P A;  5HYD A;  1JSA A;  1MWN A;  1TNW A;  5D7F A;  4TNC A;  1WDC C;  2LHI A;  3CZT X;  4PE4 A;  3PLF B;  3JTD C;  3DF0 B;  2Y4Q A;  2WND A;  1OMV A;  2JNX A;  4NDD A;  1NX2 A;  3FWB A;  1X02 A;  1R6P A;  1DJX A;  1BLQ A;  2ZN9 A;  1IJ5 A;  1OMR A;  1QVI Z;  1Y1A A;  2K0J A;  3O4Y A;  4YGE B;  1A75 A;  4N1F A;  2A4J A;  1DGV A;  3CS1 A;  4NDC A;  4USL A;  2M1K B;  1ZAC A;  1TNQ A;  3TDI A;  1AHR A;  2CTN A;  3GK1 A;  3O6B A;  2LC5 A;  1K9K A;  2JC2 A;  2CCM A;  2NZ0 A;  2TN4 A;  2HPS A;  2AMI A;  2ZN8 A;  2GGZ A;  5F6T A;  2M7N A;  2HQW A;  3DVE A;  2BCA A;  2ZKM X;  1L2O B;  3OP0 A;  1DJZ A;  1S5G Z;  2BE6 A;  3SG3 A;  3TDU A;  1WDC B;  2E6W A;  1TCO B;  5JJG A;  3JTD B;  3CR5 X;  2KI4 C;  5CPV A;  2JTZ A;  1AJ4 A;  3BUO B;  1SBJ A;  2KQY A;  2MBX A;  5AFP A;  1CFP A;  2KGB C;  1H4B A;  1FF1 A;  1SCM C;  1SKT A;  1U5I A;  1BG1 A;  4NQG A;  2PAL A;  5KTY A;  1NX3 A;  1FI5 A;  1A2X A;  2I2R E;  1KQV A;  2ZRT A;  2P6B B;  2JT8 A;  2L50 A;  1EXR A;  4MVF A;  4Q04 A;  1S6I A;  5HLV A;  1K9U A;  2KYF A;  4MLW A;  2F2P A;  1BJF A;  1F71 A;  2LAN A;  2LVV A;  3I5I C;  2O60 A;  3LK0 A;  2Q4U A;  5HLO A;  4HRG A;  1EL4 A;  3HCM A;  1SW8 A;  3OX5 A;  5J3X A;  3TUY C;  1RK9 A;  3BOW B;  1A4P A;  4CFQ A;  1C07 A;  2K7O A;  1PRW A;  1GGW A;  1K96 A;  1B7T Z;  1XFX O;  2E30 A;  2LVI A;  1EG4 A;  2BBM A;  1J7O A;  1QAS A;  2KQ6 A;  2KI4 B;  4MZL A;  4YGA A;  4OV2 A;  1SCV A;  2MRD A;  1BR4 B;  1OZO A;  2H61 A;  2CXJ A;  2EGD A;  3BUW B;  1JFJ A;  4NDB A;  1ALW A;  2GV5 A;  2M49 B;  1SCM B;  4MSP A;  3DF0 A;  1K9P A;  3TZ1 A;  1DMO A;  3A8R A;  2BEC A;  2LMU A;  4HRE E;  5I2Q A;  2ZRS A;  4GBA A;  4YBH B;  1DJY A;  4C0K A;  2PVB A;  5ER5 A;  1DGU A;  2LM5 A;  3SG7 A;  2AUC A;  1NCZ A;  1UHN A;  2JWW A;  2OS8 C;  3LK1 A;  1PVA A;  3MSE B;  3PN7 B;  3JVT C;  4MRY A;  1KK7 Y;  1MXE A;  3I5I B;  1XK4 C;  4PE1 A;  3H4S E;  1PAL A;  1PUL A;  1NWD A;  4ZCV A;  2LVJ A;  1OOJ A;  1K95 A;  3TUY B; 
#chains in the Genus database with same CATH topology
 3AAJ A;  5CSI A;  2F3Z A;  1V1F A;  1RWY A;  1IQ3 A;  1SYM A;  5HKW A;  3OB1 B;  3SG4 A;  1S6J A;  4ETO A;  4OZD A;  2NXQ A;  3B88 A;  4WQ2 A;  3KO0 A;  5D3O A;  3BXK A;  2BE4 A;  2ERB A;  2KNE A;  1IIO A;  2L4H A;  1NP8 A;  2DOQ A;  3WHT B;  4AQI A;  3F45 A;  4DS7 A;  1Q80 A;  1DF0 B;  5DKN A;  1CM4 A;  3EKJ A;  3IF7 A;  1QVI Y;  1BOC A;  1FW4 A;  1L7Z A;  1QXP A;  3L47 A;  2BKH B;  1SR6 C;  2OS8 B;  4MZJ A;  4QJ4 B;  3UO9 A;  3JVT B;  1NPQ A;  1T14 A;  3K1E A;  3S0B A;  5G08 A;  1OOG A;  5EL2 A;  1MUX A;  1LA0 A;  2WCM A;  4GGN A;  2L5Y A;  3SIA A;  1BU3 A;  1N65 A;  3TDZ A;  3SG2 A;  1K94 A;  1IWQ A;  1DVI A;  1ZFS A;  2FJU B;  1OZS A;  1SL8 A;  2KDH A;  1OW4 A;  4ICB A;  1K8U A;  1SSE B;  5KSZ A;  2BCX A;  1J1E A;  2YGU A;  5CSN A;  1S5G Y;  2Y1M A;  3CLN A;  1KK8 C;  3QME A;  1J1D A;  3BOW A;  1JFK A;  2H2K A;  4E68 A;  1IGV A;  4HSZ A;  3GK4 X;  4PT1 A;  3N7H A;  2M7L A;  1ZMZ A;  2Y5I A;  1F4O A;  4FQT A;  2MLF C;  2MLE C;  1UHH A;  2FOT A;  3KEV A;  3O2P A;  4PHM A;  1ODB A;  2G2B A;  3E3R A;  2WCF A;  2I7A A;  2L5X B;  1AVS A;  2KAV A;  1QAT A;  3AKB A;  1OMD A;  3OB2 B;  4I5J A;  3TS5 C;  3KPX A;  1ORG A;  2QAC A;  3NXA A;  3VRP A;  3A4U B;  3R1O A;  5B8I B;  1CDL A;  1UP5 A;  4CPV A;  1DEL A;  1JBA A;  1WLZ A;  1QIV A;  3DVJ A;  2LNK A;  1GJY A;  1YVH A;  5AER A;  4JD9 A;  4C0J A;  2LMT A;  3C1V A;  4GNK B;  2CBL A;  3ZNI A;  2AAO A;  1KK8 B;  1B7T Y;  1QS7 A;  1ZOT B;  2OPO A;  3BJH A;  5DIC A;  2WCE A;  2L51 A;  1B8R A;  2M97 A;  3EVR A;  3PJI A;  4F0Z B;  1YUR A;  3D0Y B;  4CFR A;  3AAK A;  3CAB A;  2F33 A;  3DVK A;  4PCW A;  2COL B;  1RJV A;  3IQQ A;  2K61 A;  3WNX B;  1SRA A;  3LLE A;  3PM8 A;  4INW A;  1G4Y R;  5GQQ C;  1PVB A;  1XVJ A;  5I2L A;  1QTX A;  3CYZ A;  3IQO A;  2KFG A;  1WRK A;  1DF0 A;  2CT9 A;  5AAN A;  3TS5 B;  3V2L A;  3RZS A;  3CZ1 A;  2PSR A;  3BUX B;  3CDN A;  3EG5 B;  1CDP A;  1B8L A;  1CTR A;  1MXL C;  2G9B A;  4YGD B;  4D1E A;  2ZFD A;  1QX5 B;  2OTG C;  1NCX A;  2PAS A;  2LAP A;  3DZT A;  3PAL A;  4YGB B;  2JT0 A;  3FWC A;  1XK4 A;  1EH2 A;  1OOI X;  1REC A;  2HF5 A;  1GQM A;  4OVN F;  1JF2 A;  2JUL A;  5DKQ A;  1Z2C B;  5HKZ A;  1DT7 B;  4WQ3 A;  2JRF A;  4XJK B;  2JXC A;  2FCD A;  1F8H A;  1JWD A;  1B9A A;  4F7F A;  4YGC B;  1F54 A;  4GAO A;  3L4L A;  2LCP A;  2HET A;  1RTP 1;  1OOH A;  1FI6 A;  1SMG A;  1M39 A;  3BUN B;  2D8N A;  3I5F C;  3ICB A;  5HL1 A;  1G33 A;  1QJT A;  2LE9 B;  4GFT A;  2BCB A;  1K90 D;  1TTX A;  1GM0 A;  1IRJ A;  2K2F A;  2RGI A;  1AJ5 A;  1XA5 A;  3M0W A;  3O78 A;  1CKK A;  3FS7 A;  2L0P A;  4INX A;  2K60 A;  1QLS A;  1YVL A;  1PSR A;  4WRI A;  1QLK A;  2K8M B;  3BQ3 A;  2QDI A;  1Y0V H;  3IVT A;  5AXI A;  1CMF A;  1SY9 A;  2OTG B;  3D75 A;  5CSF A;  1B8C A;  3PAT A;  2IS9 A;  4MBE A;  2JQ6 A;  1QX7 A;  2MJW B;  2SCP A;  2WCJ A;  3OX6 A;  3NSL A;  1QV0 A;  4FQO A;  3LCP C;  5FI6 A;  1XFY O;  3B87 A;  1KFX S;  2P70 A;  2L2E A;  3SG6 A;  2WCL A;  2K7C A;  5ER4 X;  1YUT A;  4DIR A;  3K21 A;  3EVV A;  4A4C A;  1CFF A;  1YX8 A;  1KSO A;  2V53 A;  4ORC B;  2I94 A;  1XFZ O;  1ZUZ A;  1Y1U A;  2K2A A;  1CLM A;  2KGR A;  1YRU B;  2NCP A;  4OKH A;  3RM1 A;  2JOJ A;  2LHL A;  4OCI A;  3VRN A;  5KU1 A;  4IJ7 A;  1S1E A;  3I5F B;  1XYD A;  2KOT A;  1LKJ A;  1M31 A;  4JPZ B;  3WXA A;  3D0Y A;  1K2H A;  1TWO A;  3R72 A;  3NSK A;  3DVM A;  1KFU S;  4QJ3 B;  4N1G A;  1N2D A;  4C0L A;  2L2C A;  1WLM A;  4YI9 A;  3PFV A;  3S0E A;  1CB1 A;  1CM1 A;  5D69 A;  3EK8 A;  1UHJ A;  1QX2 A;  1CLL A;  3NSO A;  3WHU B;  3CWG A;  4M2O A;  2L98 A;  5BPJ A;  1YX7 A;  1WRL A;  1Z4H A;  2BL0 C;  3BUM B;  4FTG A;  2HQ8 A;  3SG5 A;  4AQJ A;  4BY4 A;  3S0F A;  2K7D A;  3SS5 A;  4YRU A;  1F70 A;  1KCY A;  1H8B A;  1AUI B;  3VRO A;  2JTT A;  1CDM A;  4PDZ A;  3PSR A;  1SK6 D;  4JWQ A;  1UWO A;  4MRX A;  4CID A;  3EK4 A;  1TCF A;  2M3W A;  1NX1 A;  2JPT A;  2M8U A;  4ORA B;  5AEQ A;  2MAZ A;  2KAX A;  1IG5 A;  3GK2 A;  1J55 A;  1TUZ A;  1KQM C;  4XJK A;  1C3Y A;  1LS8 A;  3B86 A;  4YI8 A;  2KI6 C;  3HX4 A;  1FBV A;  2KPH A;  1XO5 A;  4ORB B;  1DJG A;  1EG3 A;  1B1G A;  3SJS A;  2B1U A;  4XYN A;  1SR6 B;  1NCY A;  3ZWH A;  1CNP A;  1M63 B;  2FJY A;  1OSA A;  1CDN A;  1YUS A;  1BOD A;  1KSM A;  2PMY A;  1SPY A;  1Y6W A;  3I5H C;  1UHK A;  1XFW O;  2M1U A;  4MZK A;  1DJW A;  1A03 A;  3SIB A;  2BKI B;  1QWV A;  2JZI A;  1F4Q A;  1BMO A;  1B47 A;  1VRK A;  1W7J B;  1LXF C;  4M2P A;  4PHN A;  1CLB A;  1EJ3 A;  1CMG A;  2QEO A;  1S3P A;  3KF9 A;  2M29 A;  3CR2 A;  4P2Y B;  5K89 A;  2LUC A;  1KQM B;  3QRX A;  4QJ5 B;  1DTL A;  3DD4 A;  2KHN A;  1PK0 D;  3VB1 A;  4BY5 A;  4DUQ A;  2LV7 A;  1KWO C;  4PE0 A;  1WY9 A;  4GGF C;  1S6C A;  4OR9 B;  2SAS A;  3R1V A;  5IBW A;  1IH0 A;  2F3Y A;  1D1O A;  5CSJ A;  5I8N A;  1M46 A;  3D77 A;  3I5H B;  1TOP A;  1J7R A;  3OBV A;  2LMV A;  4R1E A;  1TRF A;  1TUJ A;  2EHB A;  2LUX A;  1K93 D;  2QPT A;  3PM2 A;  1LA3 A;  1DC1 A;  3CZ2 A;  2FCE A;  2KFF A;  1UUR A;  2PQL A;  3VRQ A;  3Q8I A;  1UUS A;  2I18 A;  1KFX L;  1W7I B;  2EC6 C;  2LLS A;  3KHE A;  2F8P A;  1OQP A;  4M2Q A;  1IKU A;  1UHI A;  2BAP A;  2KLD A;  2PRU A;  3OGN A;  1KWO B;  3PN7 C;  4I5K A;  1TNP A;  2KFH A;  3EK7 A;  1MHO A;  1SNL A;  1OE9 B;  1XFU O;  4PHK A;  1C7W A;  4PHJ A;  2MHH A;  1YR5 A;  5FI2 A;  1JF0 A;  1M45 A;  1TN4 A;  3CTN A;  4P5O E;  1HT9 A;  1HQV A;  2KSP A;  3BYA A;  1OOF A;  1IQ5 A;  2Q91 A;  3CGA A;  1RRO A;  1DJH A;  1KFU L;  1R2U A;  4CLN A;  2KYC A;  3D10 A;  4GPL B;  2JU0 A;  2WOR A;  2Y1N A;  3S0G A;  2LLU A;  3NGV A;  3BFB A;  4HRH A;  1C7V A;  1JC2 A;  2P71 A;  3OHM B;  5PAL A;  1B4C A;  1TIZ A;  3EKH A;  1GGZ A;  1SL7 A;  1LIN A;  2PYQ A;  3FE9 A;  3I5G C;  5I2O A;  2WCK A;  1N0Y A;  1A75 B;  3L4A A;  1BF5 A;  4MEW A;  2WC8 A;  4IL1 A;  2MA2 A;  1SL9 A;  1TNX A;  2KBI A;  1S36 A;  2GTE A;  4MN0 A;  2EC6 B;  1NUB A;  2KAY A;  2LP3 A;  4I5N B;  2JNF A;  1AP4 A;  3D73 A;  2WOS A;  3UNW A;  2QEV A;  2BNX A;  1V1G A;  3B7A A;  4AOM A;  1G8I A;  2BBN A;  3EVU A;  5FYX A;  1XFV O;  1Y1X A;  3DYE A;  4I5L B;  3FE6 A;  4DCK A;  2NCO A;  1ALV A;  2VRG A;  2CNP A;  1AK8 A;  2LVK A;  4PAL A;  3LL8 B;  3AKA A;  3FIA A;  1C3Z A;  3VGO A;  5JOL A;  1F55 A;  2ISD A;  2WCB A;  1NYA A;  2WC6 A;  4A4B A;  2H61 C;  4N5X A;  2O5G A;  2JT3 A;  1S26 D;  1DEK A;  3GOF A;  4JQ0 D;  3I5G B;  3VRR A;  1NX0 A;  1U5I B;  1MF8 B;  1YUU A;  2QEB A;  4UPG A;  1W9Z A;  1WRZ A;  2LLT A;  4PE7 A;  1QIW A;  5TNC A;  5FI7 A;  2M9G A;  4ZCU A;  2JPO A;  3CZ0 A;  1BT6 A;  4L9M A;  3D76 A;  1NSH A;  5HKY A;  2KI6 D;  3R1P A;  2ZNE A;  4GUK A;  1A29 A;  2GGM A;  1RFJ A;  1IJ6 A;  2K7B A;  2R2I A;  2KBM A;  1J7Q A;  3SS4 A;  1P28 A;  1DJI A;  3BFH A;  4U8D A;  1CFC A;  2ZND A;  1KK7 Z;  1QV1 A;  2WC5 A;  3CR4 X;  4DRW A;  1YRT B;  1MR8 A;  2L4I A;  2NLN A;  5I94 A;  1FPW A;  5DKR A;  3NHT A;  1JUO A;  1YTZ C;  1LVC D;  1PSB A;  3FE8 A;  3RLZ A;  1BR1 B;  1CFD A;  1MQ1 A;  2QEH A;  4GGF A;  1L2O C;  1NIW A;  1E8A A;  2LP2 A;  3NSI A;  2F2O A;  2JXL A;  2BL0 B;  2M0R A;  1J7P A;  5HYD A;  1JSA A;  1MWN A;  1TNW A;  5D7F A;  4TNC A;  1WDC C;  2LHI A;  3CZT X;  4PE4 A;  3PLF B;  3JTD C;  3DF0 B;  2Y4Q A;  2WND A;  1OMV A;  2JNX A;  4NDD A;  1NX2 A;  3FWB A;  1X02 A;  3BFA A;  1R6P A;  1DJX A;  1BLQ A;  1XFR A;  2ZN9 A;  1IJ5 A;  1OMR A;  1QVI Z;  1Y1A A;  2K0J A;  3O4Y A;  4YGE B;  1A75 A;  4N1F A;  2A4J A;  3O6B A;  1DGV A;  3DY9 A;  3CS1 A;  4NDC A;  4USL A;  2M1K B;  1ZAC A;  1TNQ A;  3TDI A;  1AHR A;  2CTN A;  3GK1 A;  3O4X A;  2LC5 A;  1K9K A;  2JC2 A;  2CCM A;  2NZ0 A;  2TN4 A;  2HPS A;  2AMI A;  2ZN8 A;  2GGZ A;  5F6T A;  2M7N A;  2HQW A;  3DVE A;  2BCA A;  3D78 A;  2WCH A;  2KLE A;  2ZKM X;  1L2O B;  2H8V A;  3OP0 A;  1DJZ A;  1S5G Z;  2BE6 A;  3SG3 A;  3TDU A;  1WDC B;  2E6W A;  1TCO B;  5JJG A;  3JTD B;  3CR5 X;  2KI4 C;  5CPV A;  2JTZ A;  1AJ4 A;  3BUO B;  3SS3 A;  1SBJ A;  2KQY A;  2MBX A;  5AFP A;  1CFP A;  2KGB C;  1H4B A;  1FF1 A;  1SCM C;  1SKT A;  1U5I A;  1BG1 A;  4NQG A;  2PAL A;  5KTY A;  1NX3 A;  1FI5 A;  1A2X A;  2I2R E;  1KQV A;  1DQE A;  2ZRT A;  2P6B B;  2JT8 A;  2L50 A;  1EXR A;  4MVF A;  4Q04 A;  1S6I A;  5HLV A;  1K9U A;  2KYF A;  4MLW A;  2F2P A;  1BJF A;  1F71 A;  2LAN A;  2LVV A;  3I5I C;  2O60 A;  3D74 A;  3LK0 A;  2Q4U A;  3NHI A;  5HLO A;  4HRG A;  1EL4 A;  3HCM A;  1SW8 A;  3OX5 A;  5J3X A;  3TUY C;  1RK9 A;  3BOW B;  1A4P A;  4JKT A;  4CFQ A;  2K7O A;  1PRW A;  1C07 A;  1GGW A;  1K96 A;  1B7T Z;  1XFX O;  2E30 A;  2LVI A;  1EG4 A;  2BBM A;  1J7O A;  1QAS A;  2KQ6 A;  2KI4 B;  4MZL A;  4YGA A;  4OV2 A;  3DXL A;  1SCV A;  2MRD A;  1BR4 B;  1OZO A;  2H61 A;  3B6X A;  2CXJ A;  2EGD A;  3BUW B;  1JFJ A;  4NDB A;  1ALW A;  2GV5 A;  2M49 B;  1SCM B;  4MSP A;  3DF0 A;  1K9P A;  3TZ1 A;  1DMO A;  3A8R A;  2BEC A;  2LMU A;  4HRE E;  5I2Q A;  2ZRS A;  4GBA A;  4YBH B;  1DJY A;  4C0K A;  2PVB A;  3S0D A;  5ER5 A;  1DGU A;  2LM5 A;  3S0A A;  3SG7 A;  2AUC A;  1NCZ A;  1UHN A;  2JWW A;  2OS8 C;  3LK1 A;  4KYN A;  1PVA A;  3MSE B;  3PN7 B;  3JVT C;  4MRY A;  1KK7 Y;  1MXE A;  3I5I B;  1XK4 C;  4PE1 A;  3H4S E;  1PAL A;  1PUL A;  1NWD A;  4ZCV A;  2LVJ A;  1OOJ A;  1K95 A;  3TUY B; 
#chains in the Genus database with same CATH homology
 3AAJ A;  5CSI A;  2F3Z A;  1V1F A;  1RWY A;  1IQ3 A;  1SYM A;  5HKW A;  3OB1 B;  3SG4 A;  1S6J A;  4ETO A;  2NXQ A;  4WQ2 A;  3KO0 A;  5D3O A;  3BXK A;  2BE4 A;  2KNE A;  2L4H A;  1NP8 A;  2DOQ A;  3WHT B;  4AQI A;  3F45 A;  4DS7 A;  1Q80 A;  1DF0 B;  5DKN A;  1CM4 A;  3EKJ A;  3IF7 A;  1QVI Y;  1BOC A;  1FW4 A;  1L7Z A;  1QXP A;  2BKH B;  1SR6 C;  2OS8 B;  4MZJ A;  4QJ4 B;  3UO9 A;  3JVT B;  1NPQ A;  5G08 A;  1MUX A;  1LA0 A;  4GGN A;  2L5Y A;  3SIA A;  1BU3 A;  1N65 A;  3TDZ A;  3SG2 A;  1K94 A;  1IWQ A;  1DVI A;  1ZFS A;  2FJU B;  1OZS A;  1SL8 A;  2KDH A;  4ICB A;  1K8U A;  5KSZ A;  2BCX A;  1J1E A;  2YGU A;  5CSN A;  1S5G Y;  2Y1M A;  3CLN A;  1KK8 C;  1J1D A;  3BOW A;  1JFK A;  2H2K A;  4E68 A;  1IGV A;  4HSZ A;  3GK4 X;  2M7L A;  1ZMZ A;  2Y5I A;  1F4O A;  2MLF C;  2MLE C;  1UHH A;  2FOT A;  3KEV A;  3O2P A;  4PHM A;  1ODB A;  2G2B A;  3E3R A;  2WCF A;  2I7A A;  2L5X B;  1AVS A;  2KAV A;  1QAT A;  3AKB A;  1OMD A;  3OB2 B;  4I5J A;  3TS5 C;  3KPX A;  2QAC A;  3NXA A;  3VRP A;  3A4U B;  5B8I B;  1CDL A;  1UP5 A;  4CPV A;  1DEL A;  1JBA A;  1WLZ A;  1QIV A;  3DVJ A;  2LNK A;  1GJY A;  1YVH A;  5AER A;  4C0J A;  2LMT A;  3C1V A;  4GNK B;  2CBL A;  3ZNI A;  2AAO A;  1KK8 B;  1B7T Y;  1QS7 A;  1ZOT B;  2OPO A;  2WCE A;  2L51 A;  1B8R A;  2M97 A;  3EVR A;  4F0Z B;  1YUR A;  3D0Y B;  4CFR A;  3AAK A;  2F33 A;  3DVK A;  4PCW A;  2COL B;  1RJV A;  3IQQ A;  2K61 A;  3WNX B;  1SRA A;  3LLE A;  3PM8 A;  1G4Y R;  5GQQ C;  1PVB A;  1XVJ A;  5I2L A;  1QTX A;  3IQO A;  2KFG A;  1WRK A;  1DF0 A;  2CT9 A;  5AAN A;  3TS5 B;  2PSR A;  3BUX B;  3EG5 B;  1CDP A;  1B8L A;  1CTR A;  1MXL C;  2G9B A;  4YGD B;  4D1E A;  2ZFD A;  1QX5 B;  2OTG C;  1NCX A;  2PAS A;  2LAP A;  3PAL A;  4YGB B;  2JT0 A;  3FWC A;  1XK4 A;  1EH2 A;  1REC A;  2HF5 A;  1GQM A;  4OVN F;  1JF2 A;  2JUL A;  5DKQ A;  5HKZ A;  1DT7 B;  1Z2C B;  4WQ3 A;  2JRF A;  4XJK B;  2JXC A;  2FCD A;  1F8H A;  1JWD A;  1B9A A;  4YGC B;  1F54 A;  4GAO A;  2LCP A;  2HET A;  1RTP 1;  1FI6 A;  1SMG A;  1M39 A;  3BUN B;  2D8N A;  3I5F C;  3ICB A;  5HL1 A;  1G33 A;  1QJT A;  2LE9 B;  4GFT A;  2BCB A;  1K90 D;  1TTX A;  1IRJ A;  2K2F A;  2RGI A;  1AJ5 A;  1XA5 A;  3M0W A;  3O78 A;  1CKK A;  3FS7 A;  2L0P A;  2K60 A;  1QLS A;  1YVL A;  1PSR A;  4WRI A;  1QLK A;  2K8M B;  3BQ3 A;  1Y0V H;  3IVT A;  5AXI A;  1CMF A;  1SY9 A;  2OTG B;  5CSF A;  1B8C A;  3PAT A;  2IS9 A;  4MBE A;  2JQ6 A;  1QX7 A;  2MJW B;  2SCP A;  3OX6 A;  3NSL A;  1QV0 A;  4FQO A;  3LCP C;  5FI6 A;  1XFY O;  1KFX S;  2L2E A;  3SG6 A;  5ER4 X;  2K7C A;  1YUT A;  4DIR A;  3K21 A;  3EVV A;  4A4C A;  1CFF A;  1YX8 A;  1KSO A;  2V53 A;  4ORC B;  2I94 A;  1XFZ O;  1ZUZ A;  1Y1U A;  2K2A A;  1CLM A;  2KGR A;  1YRU B;  2NCP A;  4OKH A;  3RM1 A;  2JOJ A;  2LHL A;  4OCI A;  3VRN A;  5KU1 A;  4IJ7 A;  1S1E A;  3I5F B;  1XYD A;  2KOT A;  1LKJ A;  1M31 A;  4JPZ B;  3WXA A;  3D0Y A;  1K2H A;  3NSK A;  3DVM A;  1KFU S;  4QJ3 B;  4N1G A;  1N2D A;  4C0L A;  4YI9 A;  1WLM A;  3PFV A;  1CB1 A;  1CM1 A;  5D69 A;  3EK8 A;  1UHJ A;  1QX2 A;  1CLL A;  3NSO A;  3WHU B;  3CWG A;  4M2O A;  2L98 A;  5BPJ A;  1YX7 A;  1WRL A;  1Z4H A;  2BL0 C;  3BUM B;  4FTG A;  2HQ8 A;  3SG5 A;  4AQJ A;  4BY4 A;  1F70 A;  2K7D A;  1KCY A;  4YRU A;  3SS5 A;  1H8B A;  1AUI B;  3VRO A;  2JTT A;  1CDM A;  4PDZ A;  3PSR A;  1SK6 D;  4JWQ A;  1UWO A;  4MRX A;  4CID A;  3EK4 A;  1TCF A;  2M3W A;  1NX1 A;  2JPT A;  2M8U A;  4ORA B;  5AEQ A;  2MAZ A;  2KAX A;  1IG5 A;  3GK2 A;  1J55 A;  1KQM C;  4XJK A;  4YI8 A;  2KI6 C;  3HX4 A;  1FBV A;  1XO5 A;  4ORB B;  1DJG A;  1EG3 A;  1B1G A;  3SJS A;  2B1U A;  4XYN A;  1SR6 B;  1NCY A;  3ZWH A;  1CNP A;  1M63 B;  1OSA A;  1CDN A;  1YUS A;  1BOD A;  1KSM A;  2PMY A;  1SPY A;  1Y6W A;  3I5H C;  1UHK A;  1XFW O;  2M1U A;  4MZK A;  1DJW A;  1A03 A;  3SIB A;  2BKI B;  2JZI A;  1F4Q A;  1BMO A;  1B47 A;  1VRK A;  1W7J B;  1LXF C;  4M2P A;  4PHN A;  1CLB A;  1EJ3 A;  1CMG A;  1S3P A;  3KF9 A;  2M29 A;  3CR2 A;  4P2Y B;  5K89 A;  2LUC A;  1KQM B;  3QRX A;  4QJ5 B;  1DTL A;  3DD4 A;  2KHN A;  1PK0 D;  4BY5 A;  4DUQ A;  2LV7 A;  1KWO C;  4PE0 A;  1WY9 A;  4GGF C;  1S6C A;  4OR9 B;  2SAS A;  5IBW A;  1IH0 A;  2F3Y A;  1D1O A;  5CSJ A;  5I8N A;  1M46 A;  3I5H B;  1TOP A;  1J7R A;  3OBV A;  2LMV A;  4R1E A;  1TRF A;  2EHB A;  2LUX A;  1K93 D;  2QPT A;  3PM2 A;  1LA3 A;  1DC1 A;  2FCE A;  2KFF A;  1UUR A;  3VRQ A;  1UUS A;  2I18 A;  1KFX L;  1W7I B;  2EC6 C;  2LLS A;  3KHE A;  2F8P A;  1OQP A;  4M2Q A;  1IKU A;  1UHI A;  2BAP A;  2KLD A;  2PRU A;  1KWO B;  3PN7 C;  4I5K A;  1TNP A;  2KFH A;  3EK7 A;  1MHO A;  1SNL A;  1OE9 B;  1XFU O;  4PHK A;  1C7W A;  4PHJ A;  2MHH A;  1YR5 A;  5FI2 A;  1JF0 A;  1M45 A;  1TN4 A;  3CTN A;  4P5O E;  1HT9 A;  1HQV A;  2KSP A;  3BYA A;  1IQ5 A;  2Q91 A;  3CGA A;  1RRO A;  1DJH A;  1KFU L;  1R2U A;  4CLN A;  2KYC A;  3D10 A;  4GPL B;  2JU0 A;  2WOR A;  2Y1N A;  2LLU A;  4HRH A;  1C7V A;  1JC2 A;  3OHM B;  5PAL A;  1B4C A;  1TIZ A;  3EKH A;  1GGZ A;  1SL7 A;  1LIN A;  5I2O A;  3I5G C;  1N0Y A;  1A75 B;  1BF5 A;  4MEW A;  2WC8 A;  4IL1 A;  2MA2 A;  1SL9 A;  1TNX A;  2KBI A;  1S36 A;  4MN0 A;  2EC6 B;  1NUB A;  2KAY A;  2LP3 A;  4I5N B;  2JNF A;  1AP4 A;  2WOS A;  3UNW A;  2BNX A;  1V1G A;  4AOM A;  1G8I A;  2BBN A;  3EVU A;  5FYX A;  1XFV O;  1Y1X A;  4I5L B;  4DCK A;  2NCO A;  1ALV A;  2VRG A;  2CNP A;  1AK8 A;  2LVK A;  4PAL A;  3LL8 B;  3AKA A;  3FIA A;  3VGO A;  3O4X A;  5JOL A;  1F55 A;  2ISD A;  2WCB A;  1NYA A;  4A4B A;  2H61 C;  4N5X A;  2O5G A;  2JT3 A;  1S26 D;  1DEK A;  3GOF A;  4JQ0 D;  3I5G B;  3VRR A;  1NX0 A;  1U5I B;  1MF8 B;  1YUU A;  4UPG A;  4PE7 A;  1WRZ A;  2LLT A;  5TNC A;  1QIW A;  1W9Z A;  5FI7 A;  2M9G A;  4ZCU A;  1BT6 A;  4L9M A;  5HKY A;  1NSH A;  2KI6 D;  4GUK A;  2ZNE A;  1A29 A;  2GGM A;  1RFJ A;  1IJ6 A;  2K7B A;  2R2I A;  2KBM A;  1J7Q A;  3SS4 A;  1DJI A;  1CFC A;  4U8D A;  2ZND A;  1KK7 Z;  1QV1 A;  3CR4 X;  4DRW A;  1YRT B;  1MR8 A;  2L4I A;  2NLN A;  1FPW A;  5I94 A;  5DKR A;  1JUO A;  1YTZ C;  1LVC D;  1PSB A;  3RLZ A;  1BR1 B;  1CFD A;  1MQ1 A;  4GGF A;  1L2O C;  1NIW A;  1E8A A;  2LP2 A;  3NSI A;  2F2O A;  2JXL A;  2BL0 B;  2M0R A;  1J7P A;  5HYD A;  1JSA A;  1MWN A;  1TNW A;  5D7F A;  4TNC A;  1WDC C;  2LHI A;  3CZT X;  4PE4 A;  3PLF B;  3JTD C;  3DF0 B;  2Y4Q A;  2WND A;  1OMV A;  2JNX A;  4NDD A;  1NX2 A;  3FWB A;  1X02 A;  1R6P A;  1DJX A;  1BLQ A;  2ZN9 A;  1IJ5 A;  1OMR A;  1QVI Z;  1Y1A A;  2K0J A;  3O4Y A;  4YGE B;  1A75 A;  4N1F A;  2A4J A;  1DGV A;  3CS1 A;  4NDC A;  4USL A;  2M1K B;  1ZAC A;  1TNQ A;  3TDI A;  1AHR A;  2CTN A;  3GK1 A;  3O6B A;  2LC5 A;  1K9K A;  2JC2 A;  2CCM A;  2NZ0 A;  2TN4 A;  2HPS A;  2AMI A;  2ZN8 A;  2GGZ A;  5F6T A;  2M7N A;  2HQW A;  3DVE A;  2BCA A;  2KLE A;  2ZKM X;  1L2O B;  3OP0 A;  1DJZ A;  1S5G Z;  2BE6 A;  3SG3 A;  3TDU A;  1WDC B;  2E6W A;  1TCO B;  5JJG A;  3JTD B;  3CR5 X;  2KI4 C;  5CPV A;  2JTZ A;  1AJ4 A;  3BUO B;  3SS3 A;  1SBJ A;  2KQY A;  2MBX A;  5AFP A;  1CFP A;  2KGB C;  1H4B A;  1FF1 A;  1SCM C;  1SKT A;  1U5I A;  1BG1 A;  4NQG A;  2PAL A;  5KTY A;  1NX3 A;  1FI5 A;  1A2X A;  2I2R E;  1KQV A;  2ZRT A;  2P6B B;  2JT8 A;  2L50 A;  1EXR A;  4MVF A;  4Q04 A;  1S6I A;  5HLV A;  1K9U A;  2KYF A;  4MLW A;  2F2P A;  1BJF A;  1F71 A;  2LAN A;  2LVV A;  3I5I C;  2O60 A;  3LK0 A;  2Q4U A;  5HLO A;  4HRG A;  1EL4 A;  3HCM A;  1SW8 A;  3OX5 A;  5J3X A;  3TUY C;  1RK9 A;  3BOW B;  1A4P A;  4CFQ A;  1C07 A;  2K7O A;  1PRW A;  1GGW A;  4JKT A;  1K96 A;  1B7T Z;  1XFX O;  2E30 A;  2LVI A;  1EG4 A;  2BBM A;  1J7O A;  1QAS A;  2KQ6 A;  2KI4 B;  4MZL A;  4YGA A;  4OV2 A;  1SCV A;  2MRD A;  1BR4 B;  1OZO A;  2H61 A;  2CXJ A;  2EGD A;  3BUW B;  1JFJ A;  4NDB A;  1ALW A;  2GV5 A;  2M49 B;  1SCM B;  4MSP A;  3DF0 A;  1K9P A;  3TZ1 A;  1DMO A;  3A8R A;  2BEC A;  2LMU A;  4HRE E;  5I2Q A;  2ZRS A;  4GBA A;  4YBH B;  1DJY A;  4C0K A;  2PVB A;  5ER5 A;  1DGU A;  2LM5 A;  3SG7 A;  2AUC A;  1NCZ A;  1UHN A;  2JWW A;  2OS8 C;  3LK1 A;  4KYN A;  1PVA A;  3MSE B;  3PN7 B;  3JVT C;  4MRY A;  1KK7 Y;  1MXE A;  3I5I B;  1XK4 C;  4PE1 A;  3H4S E;  1PAL A;  1PUL A;  1NWD A;  4ZCV A;  2LVJ A;  1OOJ A;  1K95 A;  3TUY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...