3KEVA

X-ray crystal structure of a dcun1 domain-containing protein from galdieria sulfuraria
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
183
Chain Sequence
b'ADKKAILELFQTYKEPLGNYIGAEGLQRLFEDIQVDPSDVVTLVLAWKLKASSTEFSEKEFVEGLANLQVDSLEKLKRKLSSLRKEIEDPSKFRAFYQFVFQYSKEPSQRSLPAETAMALWDVLLRGRFSLLDSWLEFLKNNTHSISRDTWNLLYDFSQLKDLSDYDAWPVLIDDFVKWLKHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galieria sulfuraria DCUN1 domain-containing protein
publication title Structural architecture of Galdieria sulphuraria DCN1L.
pubmed doi rcsb
source organism Galdieria sulphuraria
molecule tags Structural genomics, unknown function
total genus 64
structure length 183
sequence length 189
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03556 Cullin_binding Cullin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3kevA01
1.10.238.200 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 3kevA02
2NCPA 2NXQA 2K61A 2KQYA 3A4UB 1EJ3A 4DS7A 3O78A 1DJWA 1J55A 4NDDA 2MLEC 3DVJA 3PLFB 4C0LA 4ORBB 4R1EA 2KFHA 2KSPA 2ZNDA 2CNPA 2I18A 5CSFA 1XK4C 4MBEA 1XYDA 3I5GC 1ZMZA 3O2PA 4P2YB 1NUBA 3I5FC 1K9PA 1ZOTB 2K7CA 1OMDA 2Y1MA 4MVFA 4YGDB 5AEQA 1BLQA 1S3PA 2JT0A 2LUXA 3BOWB 1IWQA 1EG3A 1NWDA 3OX6A 2MLFC 2K7OA 2CT9A 2BCBA 2NCOA 4UPGA 2O5GA 1JSAA 1KFXS 1S36A 1A75B 4CFRA 3RM1A 3AAKA 1XFXO 2G2BA 4I5LB 1CMFA 2BL0B 1SK6D 1RK9A 3DVMA 3KEVA 3VRNA 1LA0A 2KGRA 2PVBA 1UHJA 2HPSA 1KWOC 1QASA 2JTZA 3AKBA 1DF0A 4P5OE 2A4JA 3SG6A 1GJYA 1HQVA 2BE4A 2K0JA 4L9MA 2MBXA 2O60A 3ZWHA 2JULA 2JT3A 2FJUB 3LK1A 4OCIA 4QJ5B 1BG1A 2EHBA 3PATA 1B7TZ 1JF0A 1NX3A 4PDZA 3EVRA 1BJFA 1R6PA 1K90D 3DD4A 1DGUA 2SCPA 4YGBB 1CDLA 1BR4B 4MN0A 3SJSA 2CXJA 1SR6B 1BT6A 1PULA 2BKHB 2BKIB 1L7ZA 1TCOB 1TNQA 2LP2A 1QXPA 5KTYA 2PASA 4BY5A 1IQ5A 1H8BA 1WRLA 2MHHA 1Y1AA 3CR4X 3M0WA 3RLZA 3KF9A 1LVCD 4MZJA 1NCYA 3TDZA 1QX2A 4PHNA 1K95A 1LINA 3D10A 5TNCA 3VRPA 1MXLC 3GK2A 3WHTB 3SG5A 1DF0B 4WQ2A 5KSZA 1CTRA 2DOQA 2ISDA 1J7PA 1SYMA 3AKAA 2IS9A 1YRTB 3BXKA 5KU1A 2JQ6A 3BYAA 4HRHA 1Y6WA 1LXFC 1UHKA 2EC6B 1IJ5A 5CSIA 1RJVA 1LKJA 1SY9A 5AXIA 2EC6C 2COLB 2VRGA 1F4OA 1U5IA 2LM5A 2WCBA 2KAVA 3LL8B 4PHMA 1EH2A 1PVAA 2QACA 4PE7A 2KYCA 1AJ4A 1NSHA 1XFVO 1DJHA 2GGMA 1CM1A 2F33A 4HRGA 1QX7A 1YUSA 2MAZA 1QLSA 3H4SE 1D1OA 1CKKA 1B1GA 1QATA 1SKTA 1YVLA 2JNFA 4XYNA 1AK8A 1Y1UA 1E8AA 1DJIA 4YI8A 4I5JA 3VROA 1S5GY 3D0YB 4WQ3A 1C07A 5I2LA 2PRUA 1BODA 1ZUZA 4MRXA 2KDHA 1BMOA 3IQQA 3NXAA 1J1DA 1RTP1 2MJWB 1ALVA 2L5XB 2KAXA 3GK4X 5F6TA 4DIRA 3CS1A 2M97A 1A03A 1AHRA 1JFKA 2JOJA 1S6CA 1U5IB 2KOTA 1FI6A 2FCDA 3LLEA 1AVSA 1BR1B 1VRKA 1OOJA 1YTZC 1TNXA 3NSOA 3BUMB 1QVIY 1SL9A 3O6BA 4MLWA 4JQ0D 1KCYA 3IQOA 2PSRA 3GOFA 1EL4A 1K9UA 5HLVA 3SG7A 2PMYA 1H4BA 1CDMA 3NSLA 3CWGA 1BU3A 1ODBA 1J7QA 2M7LA 1GGZA 4JPZB 2SASA 1YX8A 2M29A 2LNKA 4DUQA 2ZFDA 1J1EA 1A29A 2KAYA 5I2OA 1CM4A 1WY9A 3SIBA 2F2OA 4HREE 3EK4A 4YGCB 3A8RA 2JTTA 1F55A 2M49B 3NSKA 2I7AA 1OQPA 2WORA 4F0ZB 4A4CA 1M45A 2LP3A 1UUSA 1TTXA 5GQQC 3QRXA 1CLBA 1NX2A 1GQMA 3OX5A 3EVVA 4HSZA 1QJTA 2BL0C 1IG5A 2LCPA 1EG4A 1ZFSA 4BY4A 2KBMA 1NCZA 2LVKA 3FWCA 2OPOA 1CFFA 1B8CA 1TNPA 3JTDB 1AJ5A 1NIWA 2H2KA 3CR5X 1TCFA 2Y1NA 2HQ8A 5AERA 2JXCA 1AP4A 2KQ6A 2M1KB 2ZRTA 1NX0A 1K96A 3WXAA 1F4QA 1C7VA 1SBJA 1DMOA 3DVEA 1B7TY 1DJZA 2L50A 1YUTA 1V1FA 2LHIA 1KK8B 4ICBA 5HYDA 1Q80A 4IL1A 3VGOA 2JC2A 2L0PA 1UHHA 1OE9B 2JPTA 4YBHB 4USLA 1KK8C 1MXEA 4NDBA 3TDUA 4QJ4B 1SR6C 1TN4A 2F2PA 2ZNEA 4PE4A 1B9AA 1PSRA 3BUOB 1CDPA 4TNCA 1DTLA 1SL7A 1G4YR 1J7RA 2BE6A 4Q04A 3FS7A 1M39A 1CMGA 2CTNA 4MZLA 4GFTA 2KGBC 3CR2A 1XO5A 1QIVA 4I5KA 1UURA 2M0RA 1FBVA 3OB2B 1N0YA 4N5XA 1J7OA 2P6BB 2LMVA 4M2QA 1C7WA 2HF5A 3TS5B 4XJKA 1CFPA 1B8LA 2MA2A 4PCWA 4N1FA 1DVIA 1XFZO 2L4IA 2KI6D 2Q4UA 1OMVA 1CB1A 2NZ0A 4AOMA 3DF0A 3SIAA 5BPJA 1KK7Z 4MZKA 2KNEA 1B47A 3NSIA 4YGAA 1K9KA 1FW4A 2OS8B 4ZCUA 3TDIA 1RROA 5D69A 4ETOA 1JBAA 4GGFA 1PVBA 1SPYA 1WDCB 2LANA 5CSNA 4C0KA 5JJGA 2LAPA 1SCVA 2LHLA 1XFYO 4GUKA 2H61A 4YI9A 3SG3A 1YVHA 1XFUO 3KPXA 4ZCVA 1IQ3A 1XA5A 1K8UA 1IH0A 1NCXA 1IKUA 1SW8A 4YRUA 1PRWA 1JC2A 1N65A 3JVTB 2F3ZA 4QJ3B 3BUNB 2Q91A 1XVJA 2K7DA 1PK0D 2KHNA 4M2OA 4XJKB 3KO0A 2K2FA 1NYAA 3I5IB 2RGIA 4CLNA 4MSPA 1YRUB 4GPLB 5G08A 1RFJA 1B4CA 5DKRA 3I5IC 1L2OB 1XK4A 3PSRA 5DKNA 4N1GA 3WNXB 1YUUA 1W7JB 2KFFA 2K8MB 2KYFA 2L4HA 2LVVA 3EVUA 3TUYB 3DVKA 3DF0B 3MSEB 4MEWA 2NLNA 2CCMA 2JXLA 3VRQA 4DCKA 1QIWA 2K7BA 1S5GZ 1F8HA 1N2DA 1M31A 2AAOA 3AAJA 4OVNF 4I5NB 3WHUB 1FF1A 3KHEA 4AQJA 1NX1A 1ZACA 2ZN9A 1DJXA 1Y0VH 2OTGB 1G8IA 1QV0A 2JRFA 1YR5A 1MQ1A 1Y1XA 2OTGC 2Y4QA 2LV7A 3CTNA 1YX7A 3CZTX 1NP8A 1OMRA 2KBIA 1SMGA 1QV1A 1S1EA 2LLTA 4OKHA 2HQWA 1A2XA 1KSMA 1QVIZ 4FTGA 2BCXA 4CFQA 5AFPA 5HKZA 2LUCA 2ZKMX 2WCEA 1SCMB 2D8NA 1S26D 1WLMA 2E6WA 1PALA 2AUCA 3I5GB 2M7NA 5IBWA 1KSOA 1SCMC 3I5FB 4GBAA 1KFUL 3PFVA 4FQOA 2ZN8A 3PN7B 3HX4A 1F71A 1KFUS 2QPTA 1UHNA 3FWBA 3FIAA 3K21A 3PN7C 4A4BA 5CSJA 1QLKA 1BF5A 2PALA 1KFXL 1B8RA 3JTDC 4CPVA 4D1EA 2M8UA 2BECA 1V1GA 5JOLA 2JNXA 1KWOB 2BBNA 1BOCA 1K93D 2LC5A 1UWOA 4E68A 5I2QA 3PALA 3OHMB 4JWQA 4WRIA 1FI5A 3EKHA 4PHKA 2KI6C 5I8NA 4PALA 1CLLA 1QS7A 2M9GA 1SNLA 2TN4A 1IRJA 3SG2A 4C0JA 4U8DA 2WOSA 1KQMB 1PSBA 4YGEB 2F3YA 3EK7A 1A4PA 2LLUA 2L2EA 1KQMC 3EKJA 1LA3A 5J3XA 4M2PA 1KQVA 1JFJA 3O4YA 1JWDA 1GGWA 1G33A 3GK1A 1SL8A 1MF8B 3ICBA 3C1VA 5D7FA 1DJYA 2K2AA 2E30A 1RWYA 1HT9A 5CPVA 3TS5C 3TZ1A 1MR8A 1M46A 2M1UA 3CLNA 3LK0A 3BQ3A 1MWNA 2LVJA 4DRWA 1MUXA 3ZNIA 2LVIA 4AQIA 1XFWO 1QTXA 1YURA 5HKWA 2HETA 3EK8A 1KK7Y 2LLSA 2Y5IA 3VRRA 1DGVA 1QX5B 3D0YA 1JUOA 5DKQA 5B8IB 2LE9B 3PM8A 2WC8A 5HLOA 4ORCB 2KI4B 2OS8C 3LCPC 3OP0A 1FPWA 4ORAB 1WRKA 1M63B 1AUIB 2JZIA 2G9BA 5ER4X 2KI4C 2KFGA 2EGDA 1WDCC 1IJ6A 4GNKB 3HCMA 2JU0A 1S6JA 2GV5A 3OB1B 1F70A 1K2HA 2BBMA 1UHIA 4GGNA 2I94A 3BUWB 3F45A 2WCFA 1WRZA 5ER5A 2V53A 4MRYA 1CDNA 1TOPA 1TNWA 1X02A 1W7IB 1WLZA 3JVTC 1MHOA 3SG4A 2AMIA 1TIZA 4NQGA 4OR9B 4OV2A 2WNDA 2CBLA 5K89A 1CNPA 1UP5A 1F54A 1JF2A 4NDCA 1OSAA 2R2IA 1EXRA 2LMUA 4PE0A 1IGVA 1K94A 2I2RE 1SRAA 1L2OC 2BCAA 4PE1A 3TUYC 1CLMA 4PHJA 3E3RA 2L51A 2JWWA 3BOWA 2L98A 1S6IA 5PALA 2LMTA 4CIDA 5AANA 1CFCA 1TRFA 1ALWA 2ZRSA 2B1UA 5FYXA 3I5HB 1DT7B 1R2UA 3BUXB 4GGFC 5HKYA 3CGAA 1A75A 3IF7A 1CFDA 1OZSA 1RECA 2GGZA 1DJGA 3I5HC 2JT8A 2H61C 1NPQA 2F8PA 2FCEA 2FOTA 2M3WA 2MRDA 4GAOA 1OZOA
chains in the Genus database with same CATH superfamily
2NCPA 3NHTA 2NXQA 2K61A 2KQYA 3A4UB 1EJ3A 4DS7A 2QEOA 3O78A 1DJWA 1J55A 4NDDA 2MLEC 3DVJA 5EL2A 3PLFB 4C0LA 4ORBB 4R1EA 1OOFA 2KFHA 2KSPA 2ZNDA 2CNPA 2I18A 1DQEA 3L4AA 4PT1A 5CSFA 1XK4C 4MBEA 5FI2A 1ORGA 1XYDA 1ZMZA 3I5GC 3O2PA 4P2YB 1NUBA 3I5FC 1K9PA 1ZOTB 2K7CA 1OMDA 2Y1MA 4MVFA 4YGDB 5AEQA 1BLQA 3BFAA 1S3PA 2JT0A 2LUXA 3BOWB 1IWQA 1EG3A 1NWDA 3OX6A 1GM0A 2MLFC 2K7OA 2CT9A 2BCBA 2NCOA 4UPGA 2O5GA 1JSAA 1KFXS 1S36A 1A75B 4CFRA 2PYQA 3AAKA 1XFXO 2G2BA 2WC6A 4I5LB 3RM1A 1CMFA 2BL0B 1SK6D 2JPOA 1RK9A 3DVMA 3KEVA 3VRNA 1LA0A 2KGRA 3EG5B 2PVBA 1UHJA 2HPSA 1KWOC 1QASA 2JTZA 3AKBA 1DF0A 3DYEA 1OOHA 2A4JA 4P5OE 1GJYA 1HQVA 2QEHA 3SG6A 2BE4A 2K0JA 4L9MA 2MBXA 2O60A 3FE6A 3ZWHA 2JULA 2JT3A 2FJUB 3LK1A 1DC1A 3IVTA 4OCIA 4QJ5B 1BG1A 2KPHA 2EHBA 3PATA 1B7TZ 1JF0A 1NX3A 4PDZA 3EVRA 1BJFA 3B6XA 1R6PA 1K90D 2QDIA 3BFHA 3DD4A 1DGUA 2SCPA 4YGBB 1CDLA 1BR4B 4MN0A 3SJSA 2CXJA 1SR6B 2P71A 3S0DA 1BT6A 1PULA 2BKHB 2BKIB 3OGNA 1L7ZA 1TCOB 1TNQA 2LP2A 1QXPA 5KTYA 2PASA 4BY5A 1IQ5A 1H8BA 1WRLA 2MHHA 2WC5A 1Y1AA 5FI7A 3CR4X 3M0WA 3RLZA 3KF9A 1LVCD 4MZJA 1NCYA 2BAPA 3TDZA 5D3OA 1QX2A 3D78A 4PHNA 1K95A 1LINA 3D10A 3N7HA 5TNCA 1MXLC 3GK2A 3VRPA 3SG5A 3WHTB 1DF0B 3NHIA 4INXA 4WQ2A 5KSZA 1CTRA 2DOQA 2ISDA 1J7PA 1SYMA 2WCHA 3AKAA 3D76A 2IS9A 1YRTB 3BXKA 5FI6A 1SSEB 5KU1A 2JQ6A 3BYAA 4HRHA 1Y6WA 1LXFC 1UHKA 2EC6B 1IJ5A 5CSIA 1C3YA 1RJVA 1LKJA 3S0EA 1SY9A 5AXIA 2EC6C 2COLB 2VRGA 1F4OA 1U5IA 2LM5A 2WCBA 2KAVA 3LL8B 4PHMA 1EH2A 1PVAA 2QACA 3SS5A 4PE7A 2KYCA 1AJ4A 1NSHA 1XFVO 1DJHA 2GGMA 1CM1A 2F33A 4HRGA 1QX7A 1YUSA 3PM2A 4IJ7A 2MAZA 1QLSA 3H4SE 1D1OA 1CKKA 1B1GA 1QATA 1SKTA 1YVLA 2JNFA 4XYNA 1AK8A 3BJHA 4JKTA 1Y1UA 1E8AA 1DJIA 4YI8A 4I5JA 3VROA 1S5GY 3S0FA 3D0YB 4WQ3A 3V2LA 5I2LA 1C07A 2PRUA 1C3ZA 3S0GA 1BODA 1ZUZA 4MRXA 2KDHA 1BMOA 3IQQA 3NXAA 1J1DA 1RTP1 3FE8A 2MJWB 1ALVA 2L5XB 2KAXA 3GK4X 5F6TA 4DIRA 3CS1A 2M97A 1A03A 1AHRA 1JFKA 2JOJA 1S6CA 1OOGA 1U5IB 2KOTA 1QWVA 2FCDA 1FI6A 3LLEA 1AVSA 1BR1B 1VRKA 1OOJA 1YTZC 1TNXA 3NSOA 3BUMB 3QMEA 1QVIY 1SL9A 3O6BA 1OW4A 4JQ0D 4MLWA 1KCYA 3IQOA 3CZ1A 2PSRA 3GOFA 1EL4A 1K9UA 3R1PA 5HLVA 3SG7A 2PMYA 1H4BA 1CDMA 3NSLA 2WCKA 1BU3A 1ODBA 3CWGA 2M7LA 1J7QA 1GGZA 4JPZB 2SASA 1YX8A 2M29A 2LNKA 4DUQA 2ZFDA 1J1EA 1A29A 2KAYA 5I2OA 1CM4A 1WY9A 3SIBA 2F2OA 4HREE 3EK4A 4YGCB 3A8RA 3SS4A 2JTTA 3CZ0A 1F55A 2M49B 3NSKA 2I7AA 1OQPA 2WORA 4F0ZB 4A4CA 1M45A 2LP3A 1UUSA 1TTXA 5GQQC 3QRXA 1CLBA 1NX2A 1GQMA 3OX5A 3EVVA 4HSZA 1QJTA 2BL0C 1IG5A 2LCPA 1EG4A 1ZFSA 4BY4A 2KBMA 2WCMA 2WCLA 3PJIA 1NCZA 2LVKA 3FWCA 2OPOA 1CFFA 1B8CA 1TNPA 3JTDB 1AJ5A 1NIWA 2H2KA 3CR5X 1TCFA 2Y1NA 2HQ8A 5AERA 3R1OA 2JXCA 1AP4A 2KQ6A 2M1KB 2ERBA 2ZRTA 1NX0A 1K96A 3WXAA 1F4QA 1C7VA 1SBJA 1DMOA 3DVEA 1B7TY 2L2CA 1DJZA 2L50A 1YUTA 1V1FA 2LHIA 1T14A 1KK8B 1DELA 4ICBA 1Q80A 4IL1A 3VGOA 5HYDA 2JC2A 2L0PA 1UHHA 1OE9B 2JPTA 3D74A 3DXLA 4YBHB 4USLA 1KK8C 1MXEA 3VB1A 4NDBA 3TDUA 4QJ4B 1SR6C 1TN4A 2F2PA 2ZNEA 4PE4A 1B9AA 1PSRA 3BUOB 1CDPA 4TNCA 1DTLA 4OZDA 1SL7A 1G4YR 1J7RA 1Z4HA 2BE6A 4Q04A 3FS7A 1M39A 1CMGA 2CTNA 4MZLA 4GFTA 2KGBC 3CR2A 1XO5A 1QIVA 4I5KA 1UURA 3K1EA 2M0RA 1FBVA 3OB2B 1N0YA 4N5XA 1J7OA 2P6BB 2QEVA 2LMVA 4M2QA 1C7WA 2HF5A 3TS5B 4XJKA 1CFPA 1B8LA 2MA2A 4PCWA 4N1FA 1DVIA 1IIOA 1XFZO 2L4IA 2KI6D 2Q4UA 1OMVA 3CYZA 1CB1A 2NZ0A 4AOMA 3DF0A 3SIAA 5BPJA 1KK7Z 4MZKA 2KNEA 1B47A 3NSIA 4YGAA 1K9KA 1FW4A 2OS8B 4ZCUA 3TDIA 1RROA 2L5YA 5D69A 4ETOA 3CABA 1JBAA 3R1VA 4GGFA 1PVBA 1SPYA 1WDCB 2LANA 5CSNA 4C0KA 5JJGA 2LAPA 1SCVA 2LHLA 1XFYO 4GUKA 2H61A 4YI9A 3SG3A 1YVHA 1XFUO 3KPXA 4ZCVA 1IQ3A 1XA5A 1K8UA 1IH0A 1NCXA 4FQTA 1IKUA 1SW8A 4YRUA 1PRWA 1JC2A 1N65A 2PQLA 3JVTB 2F3ZA 4QJ3B 3BUNB 2Q91A 1XVJA 2K7DA 1PK0D 2KHNA 4M2OA 4XJKB 3KO0A 2K2FA 1NYAA 3I5IB 2RGIA 4CLNA 4MSPA 3B87A 1YRUB 4GPLB 5G08A 1RFJA 1B4CA 5DKRA 3I5IC 1L2OB 1XK4A 3PSRA 5DKNA 4N1GA 3WNXB 1YUUA 1W7JB 2KFFA 2K8MB 2KYFA 2L4HA 2LVVA 3EVUA 3TUYB 3UNWA 3DVKA 3DF0B 3MSEB 4MEWA 2NLNA 2CCMA 2JXLA 3VRQA 4DCKA 1QIWA 2K7BA 1S5GZ 1F8HA 1N2DA 1M31A 2AAOA 3AAJA 4OVNF 1TWOA 3S0AA 4I5NB 5HL1A 2BNXA 3WHUB 1FF1A 3KHEA 3Q8IA 5DICA 1NX1A 4AQJA 1ZACA 2ZN9A 1DJXA 1Y0VH 2OTGB 1G8IA 1QV0A 3NGVA 2JRFA 3CZ2A 1YR5A 1MQ1A 1Y1XA 2OTGC 2Y4QA 2LV7A 3CTNA 1YX7A 3CZTX 1NP8A 2WCJA 1OMRA 2KBIA 1SMGA 1QV1A 1S1EA 2LLTA 4OKHA 2HQWA 1A2XA 1KSMA 1QVIZ 4FTGA 2BCXA 4CFQA 5AFPA 5HKZA 2LUCA 2ZKMX 3R72A 2WCEA 1SCMB 2D8NA 3FE9A 1S26D 1WLMA 2E6WA 1PALA 2AUCA 3I5GB 2M7NA 5IBWA 1KSOA 2YGUA 1SCMC 3I5FB 4GBAA 1KFUL 3PFVA 5I94A 1TUJA 4FQOA 2ZN8A 3PN7B 3HX4A 1F71A 1KFUS 2FJYA 2QPTA 1UHNA 3L47A 2KLEA 3FWBA 3FIAA 3K21A 3PN7C 4A4BA 5CSJA 1QLKA 1BF5A 2PALA 1KFXL 1B8RA 2QEBA 3JTDC 4CPVA 4D1EA 3L4LA 3BFBA 2GTEA 2M8UA 2BECA 1V1GA 5JOLA 2JNXA 1KWOB 1XFRA 2BBNA 1BOCA 1K93D 2LC5A 1UWOA 4E68A 5I2QA 3PALA 3B86A 3DZTA 3OHMB 4JWQA 4WRIA 1FI5A 3EKHA 4PHKA 2KI6C 5I8NA 3RZSA 4PALA 1CLLA 1QS7A 2M9GA 1SNLA 2TN4A 1IRJA 3D75A 3SG2A 1OOIX 4C0JA 4U8DA 2WOSA 1KQMB 1PSBA 4YGEB 3UO9A 2F3YA 3EK7A 1A4PA 1TUZA 2LLUA 2L2EA 1KQMC 3EKJA 1LA3A 5J3XA 4M2PA 1KQVA 1JFJA 3O4YA 1JWDA 1GGWA 1G33A 3GK1A 1SL8A 1Z2CB 1MF8B 3OBVA 3ICBA 1DEKA 3C1VA 5D7FA 1DJYA 2K2AA 2E30A 1RWYA 1HT9A 5CPVA 3TS5C 3TZ1A 1MR8A 1M46A 2M1UA 3CLNA 3LK0A 3BQ3A 1MWNA 2LVJA 4DRWA 1MUXA 3ZNIA 2LVIA 4AQIA 1XFWO 1QTXA 1YURA 5HKWA 2HETA 3EK8A 1KK7Y 2LLSA 2Y5IA 3VRRA 3S0BA 1DGVA 1QX5B 3D0YA 1JUOA 5DKQA 5B8IB 2LE9B 3PM8A 2WC8A 5HLOA 4ORCB 2KI4B 2OS8C 3LCPC 3OP0A 4KYNA 1FPWA 4ORAB 3B88A 1WRKA 1M63B 1AUIB 2JZIA 2G9BA 5ER4X 2KI4C 2KFGA 2EGDA 2KLDA 2P70A 1WDCC 1IJ6A 4GNKB 3HCMA 1LS8A 2JU0A 3DY9A 1S6JA 2GV5A 2H8VA 3D73A 3D77A 2BBMA 3OB1B 1UHIA 4JD9A 4GGNA 1F70A 2I94A 1K2HA 3BUWB 3F45A 2WCFA 3CDNA 1WRZA 5ER5A 2V53A 4MRYA 1CDNA 1TOPA 1TNWA 1X02A 1W7IB 1WLZA 3JVTC 1MHOA 4INWA 3SG4A 2AMIA 1TIZA 4NQGA 4OR9B 4OV2A 2WNDA 2CBLA 5K89A 1CNPA 1UP5A 1F54A 1JF2A 4NDCA 1OSAA 3O4XA 2R2IA 1EXRA 3SS3A 2LMUA 4PE0A 1IGVA 2K60A 1K94A 2I2RE 1SRAA 1L2OC 2BCAA 3B7AA 4PE1A 1W9ZA 3TUYC 1CLMA 4PHJA 3E3RA 4F7FA 2L51A 1P28A 2JWWA 3BOWA 2L98A 1S6IA 5PALA 2LMTA 4CIDA 5AANA 1CFCA 1TRFA 1ALWA 2ZRSA 2B1UA 5FYXA 3I5HB 1DT7B 1R2UA 3BUXB 4GGFC 5HKYA 3CGAA 1A75A 3IF7A 1CFDA 1OZSA 1RECA 2GGZA 1DJGA 3I5HC 2JT8A 2H61C 1NPQA 2F8PA 2FCEA 2FOTA 2M3WA 2MRDA 4GAOA 1OZOA
chains in the Genus database with same CATH topology
2NCPA 2NXQA 2K61A 2KQYA 3A4UB 1EJ3A 4DS7A 3O78A 1DJWA 1J55A 4NDDA 2MLEC 3DVJA 3PLFB 4C0LA 4ORBB 4R1EA 2KFHA 2KSPA 2ZNDA 2CNPA 2I18A 5CSFA 1XK4C 4MBEA 5FI2A 1XYDA 3I5GC 1ZMZA 3O2PA 4P2YB 1NUBA 3I5FC 1K9PA 1ZOTB 2K7CA 1OMDA 2Y1MA 4MVFA 4YGDB 5AEQA 1BLQA 1S3PA 2JT0A 2LUXA 3BOWB 1IWQA 1EG3A 1NWDA 3OX6A 2MLFC 2K7OA 2CT9A 2BCBA 2NCOA 4UPGA 2O5GA 1JSAA 1KFXS 1S36A 1A75B 4CFRA 3RM1A 3AAKA 1XFXO 2G2BA 4I5LB 1CMFA 2BL0B 1SK6D 1RK9A 3DVMA 3KEVA 3VRNA 1LA0A 2KGRA 3EG5B 2PVBA 1UHJA 2HPSA 1KWOC 1QASA 2JTZA 3AKBA 1DF0A 4P5OE 2A4JA 3SG6A 1GJYA 1HQVA 2BE4A 2K0JA 4L9MA 2MBXA 2O60A 3ZWHA 2JULA 2JT3A 2FJUB 3LK1A 1DC1A 3IVTA 4OCIA 4QJ5B 1BG1A 2EHBA 3PATA 1B7TZ 1JF0A 1NX3A 4PDZA 3EVRA 1BJFA 1R6PA 1K90D 3DD4A 1DGUA 2SCPA 4YGBB 1CDLA 1BR4B 4MN0A 3SJSA 2CXJA 1SR6B 1BT6A 1PULA 2BKHB 2BKIB 1L7ZA 1TCOB 1TNQA 2LP2A 1QXPA 5KTYA 2PASA 4BY5A 1IQ5A 1H8BA 1WRLA 2MHHA 1Y1AA 5FI7A 3CR4X 3M0WA 3RLZA 3KF9A 1LVCD 4MZJA 1NCYA 2BAPA 3TDZA 5D3OA 1QX2A 4PHNA 1K95A 1LINA 3D10A 5TNCA 3VRPA 1MXLC 3GK2A 3WHTB 3SG5A 1DF0B 4WQ2A 5KSZA 1CTRA 2DOQA 2ISDA 1J7PA 1SYMA 3AKAA 2IS9A 1YRTB 3BXKA 5KU1A 5FI6A 2JQ6A 3BYAA 4HRHA 1Y6WA 1LXFC 1UHKA 2EC6B 1IJ5A 5CSIA 1RJVA 1LKJA 1SY9A 5AXIA 2EC6C 2COLB 2VRGA 1F4OA 1U5IA 2LM5A 2WCBA 2KAVA 3LL8B 4PHMA 1EH2A 1PVAA 2QACA 3SS5A 4PE7A 2KYCA 1AJ4A 1NSHA 1XFVO 1DJHA 2GGMA 1CM1A 2F33A 4HRGA 1QX7A 1YUSA 3PM2A 4IJ7A 2MAZA 1QLSA 3H4SE 1D1OA 1CKKA 1B1GA 1QATA 1SKTA 1YVLA 2JNFA 4XYNA 1AK8A 4JKTA 1Y1UA 1E8AA 1DJIA 4YI8A 4I5JA 3VROA 1S5GY 3D0YB 4WQ3A 1C07A 5I2LA 2PRUA 1BODA 1ZUZA 4MRXA 2KDHA 1BMOA 3IQQA 3NXAA 1J1DA 1RTP1 2MJWB 1ALVA 2L5XB 2KAXA 3GK4X 5F6TA 4DIRA 3CS1A 2M97A 1A03A 1AHRA 1JFKA 2JOJA 1S6CA 1U5IB 2KOTA 1FI6A 2FCDA 3LLEA 1AVSA 1BR1B 1VRKA 1OOJA 1YTZC 1TNXA 3NSOA 3BUMB 1QVIY 1SL9A 3O6BA 4MLWA 4JQ0D 1KCYA 3IQOA 2PSRA 3GOFA 1EL4A 1K9UA 5HLVA 3SG7A 2PMYA 1H4BA 1CDMA 3NSLA 3CWGA 1BU3A 1ODBA 1J7QA 2M7LA 1GGZA 4JPZB 2SASA 1YX8A 2M29A 2LNKA 4DUQA 2ZFDA 1J1EA 1A29A 2KAYA 5I2OA 1CM4A 1WY9A 3SIBA 2F2OA 4HREE 3EK4A 4YGCB 3A8RA 3SS4A 2JTTA 1F55A 2M49B 3NSKA 2I7AA 1OQPA 2WORA 4F0ZB 4A4CA 1M45A 2LP3A 1UUSA 1TTXA 5GQQC 3QRXA 1CLBA 1NX2A 1GQMA 3OX5A 3EVVA 4HSZA 1QJTA 2BL0C 1IG5A 2LCPA 1EG4A 1ZFSA 4BY4A 2KBMA 1NCZA 2LVKA 3FWCA 2OPOA 1CFFA 1B8CA 1TNPA 3JTDB 1AJ5A 1NIWA 2H2KA 3CR5X 1TCFA 2Y1NA 2HQ8A 5AERA 2JXCA 1AP4A 2KQ6A 2M1KB 2ZRTA 1NX0A 1K96A 3WXAA 1F4QA 1C7VA 1SBJA 1DMOA 3DVEA 1B7TY 1DJZA 2L50A 1YUTA 1V1FA 2LHIA 1KK8B 4ICBA 5HYDA 1Q80A 4IL1A 3VGOA 1DELA 2JC2A 2L0PA 1UHHA 1OE9B 2JPTA 4YBHB 4USLA 1KK8C 1MXEA 4NDBA 3TDUA 4QJ4B 1SR6C 1TN4A 2F2PA 2ZNEA 4PE4A 1B9AA 1PSRA 3BUOB 1CDPA 4TNCA 1DTLA 1SL7A 1G4YR 1J7RA 2BE6A 1Z4HA 4Q04A 3FS7A 1M39A 1CMGA 2CTNA 4MZLA 4GFTA 2KGBC 3CR2A 1XO5A 1QIVA 4I5KA 1UURA 2M0RA 1FBVA 3OB2B 1N0YA 4N5XA 1J7OA 2P6BB 2LMVA 4M2QA 1C7WA 2HF5A 3TS5B 4XJKA 1CFPA 1B8LA 2MA2A 4PCWA 4N1FA 1DVIA 1XFZO 2L4IA 2KI6D 2Q4UA 1OMVA 1CB1A 2NZ0A 4AOMA 3DF0A 3SIAA 5BPJA 1KK7Z 4MZKA 2KNEA 1B47A 3NSIA 4YGAA 1K9KA 1FW4A 2OS8B 4ZCUA 3TDIA 1RROA 2L5YA 5D69A 4ETOA 1JBAA 4GGFA 1PVBA 1SPYA 1WDCB 2LANA 5CSNA 4C0KA 5JJGA 2LAPA 1SCVA 2LHLA 1XFYO 4GUKA 2H61A 4YI9A 3SG3A 1YVHA 1XFUO 3KPXA 4ZCVA 1IQ3A 1XA5A 1K8UA 1IH0A 1NCXA 1IKUA 1SW8A 4YRUA 1PRWA 1JC2A 1N65A 3JVTB 2F3ZA 4QJ3B 3BUNB 2Q91A 1XVJA 2K7DA 1PK0D 2KHNA 4M2OA 4XJKB 3KO0A 2K2FA 1NYAA 3I5IB 2RGIA 4CLNA 4MSPA 1YRUB 4GPLB 5G08A 1RFJA 1B4CA 5DKRA 3I5IC 1L2OB 1XK4A 3PSRA 5DKNA 4N1GA 3WNXB 1YUUA 1W7JB 2KFFA 2K8MB 2KYFA 2L4HA 2LVVA 3EVUA 3TUYB 3UNWA 3DVKA 3DF0B 3MSEB 4MEWA 2NLNA 2CCMA 2JXLA 3VRQA 4DCKA 1QIWA 2K7BA 1S5GZ 1F8HA 1N2DA 1M31A 2AAOA 3AAJA 4OVNF 4I5NB 5HL1A 2BNXA 3WHUB 1FF1A 3KHEA 4AQJA 1NX1A 1ZACA 2ZN9A 1DJXA 1Y0VH 2OTGB 1G8IA 1QV0A 2JRFA 1YR5A 1MQ1A 1Y1XA 2OTGC 2Y4QA 2LV7A 3CTNA 1YX7A 3CZTX 1NP8A 1OMRA 2KBIA 1SMGA 1QV1A 1S1EA 2LLTA 4OKHA 2HQWA 1A2XA 1KSMA 1QVIZ 4FTGA 2BCXA 4CFQA 5AFPA 5HKZA 2LUCA 2ZKMX 2WCEA 1SCMB 2D8NA 1S26D 1WLMA 2E6WA 1PALA 2AUCA 3I5GB 2M7NA 5IBWA 1KSOA 2YGUA 1SCMC 3I5FB 4GBAA 1KFUL 3PFVA 5I94A 4FQOA 2ZN8A 3PN7B 3HX4A 1F71A 1KFUS 2QPTA 1UHNA 2KLEA 3FWBA 3FIAA 3K21A 3PN7C 4A4BA 5CSJA 1QLKA 1BF5A 2PALA 1KFXL 1B8RA 3JTDC 4CPVA 4D1EA 2M8UA 2BECA 1V1GA 5JOLA 2JNXA 1KWOB 2BBNA 1BOCA 1K93D 2LC5A 1UWOA 4E68A 5I2QA 3PALA 3OHMB 4JWQA 4WRIA 1FI5A 3EKHA 4PHKA 2KI6C 5I8NA 4PALA 1CLLA 1QS7A 2M9GA 1SNLA 2TN4A 1IRJA 3SG2A 4C0JA 4U8DA 2WOSA 1KQMB 1PSBA 4YGEB 3UO9A 2F3YA 3EK7A 1A4PA 2LLUA 2L2EA 1KQMC 3EKJA 1LA3A 5J3XA 4M2PA 1KQVA 1JFJA 3O4YA 1JWDA 1GGWA 1G33A 3GK1A 1SL8A 1Z2CB 1MF8B 3OBVA 3ICBA 1DEKA 3C1VA 5D7FA 1DJYA 2K2AA 2E30A 1RWYA 1HT9A 5CPVA 3TS5C 3TZ1A 1MR8A 1M46A 2M1UA 3CLNA 3LK0A 3BQ3A 1MWNA 2LVJA 4DRWA 1MUXA 3ZNIA 2LVIA 4AQIA 1XFWO 1QTXA 1YURA 5HKWA 2HETA 3EK8A 1KK7Y 2LLSA 2Y5IA 3VRRA 1DGVA 1QX5B 3D0YA 1JUOA 5DKQA 5B8IB 2LE9B 3PM8A 2WC8A 5HLOA 4ORCB 2KI4B 2OS8C 3LCPC 3OP0A 1FPWA 4KYNA 4ORAB 1WRKA 1M63B 1AUIB 2JZIA 2G9BA 5ER4X 2KI4C 2KFGA 2EGDA 2KLDA 1WDCC 1IJ6A 4GNKB 3HCMA 2JU0A 1S6JA 2GV5A 3OB1B 1F70A 1K2HA 2BBMA 1UHIA 4GGNA 2I94A 3BUWB 3F45A 2WCFA 1WRZA 5ER5A 2V53A 4MRYA 1CDNA 1TOPA 1TNWA 1X02A 1W7IB 1WLZA 3JVTC 1MHOA 3SG4A 2AMIA 1TIZA 4NQGA 4OR9B 4OV2A 2WNDA 2CBLA 5K89A 1CNPA 1UP5A 1F54A 1JF2A 4NDCA 1OSAA 3O4XA 2R2IA 1EXRA 3SS3A 2LMUA 4PE0A 1IGVA 2K60A 1K94A 2I2RE 1SRAA 1L2OC 2BCAA 4PE1A 1W9ZA 3TUYC 1CLMA 4PHJA 3E3RA 2L51A 2JWWA 3BOWA 2L98A 1S6IA 5PALA 2LMTA 4CIDA 5AANA 1CFCA 1TRFA 1ALWA 2ZRSA 2B1UA 5FYXA 3I5HB 1DT7B 1R2UA 3BUXB 4GGFC 5HKYA 3CGAA 1A75A 3IF7A 1CFDA 1OZSA 1RECA 2GGZA 1DJGA 3I5HC 2JT8A 2H61C 1NPQA 2F8PA 2FCEA 2FOTA 2M3WA 2MRDA 4GAOA 1OZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCP A;  2NXQ A;  2K61 A;  2KQY A;  3A4U B;  1EJ3 A;  4DS7 A;  3O78 A;  1DJW A;  1J55 A;  4NDD A;  2MLE C;  3DVJ A;  3PLF B;  4C0L A;  4ORB B;  4R1E A;  2KFH A;  2KSP A;  2ZND A;  2CNP A;  2I18 A;  5CSF A;  1XK4 C;  4MBE A;  1XYD A;  3I5G C;  1ZMZ A;  3O2P A;  4P2Y B;  1NUB A;  3I5F C;  1K9P A;  1ZOT B;  2K7C A;  1OMD A;  2Y1M A;  4MVF A;  4YGD B;  5AEQ A;  1BLQ A;  1S3P A;  2JT0 A;  2LUX A;  3BOW B;  1IWQ A;  1EG3 A;  1NWD A;  3OX6 A;  2MLF C;  2K7O A;  2CT9 A;  2BCB A;  2NCO A;  4UPG A;  2O5G A;  1JSA A;  1KFX S;  1S36 A;  1A75 B;  4CFR A;  3RM1 A;  3AAK A;  1XFX O;  2G2B A;  4I5L B;  1CMF A;  2BL0 B;  1SK6 D;  1RK9 A;  3DVM A;  3KEV A;  3VRN A;  1LA0 A;  2KGR A;  2PVB A;  1UHJ A;  2HPS A;  1KWO C;  1QAS A;  2JTZ A;  3AKB A;  1DF0 A;  4P5O E;  2A4J A;  3SG6 A;  1GJY A;  1HQV A;  2BE4 A;  2K0J A;  4L9M A;  2MBX A;  2O60 A;  3ZWH A;  2JUL A;  2JT3 A;  2FJU B;  3LK1 A;  4OCI A;  4QJ5 B;  1BG1 A;  2EHB A;  3PAT A;  1B7T Z;  1JF0 A;  1NX3 A;  4PDZ A;  3EVR A;  1BJF A;  1R6P A;  1K90 D;  3DD4 A;  1DGU A;  2SCP A;  4YGB B;  1CDL A;  1BR4 B;  4MN0 A;  3SJS A;  2CXJ A;  1SR6 B;  1BT6 A;  1PUL A;  2BKH B;  2BKI B;  1L7Z A;  1TCO B;  1TNQ A;  2LP2 A;  1QXP A;  5KTY A;  2PAS A;  4BY5 A;  1IQ5 A;  1H8B A;  1WRL A;  2MHH A;  1Y1A A;  3CR4 X;  3M0W A;  3RLZ A;  3KF9 A;  1LVC D;  4MZJ A;  1NCY A;  3TDZ A;  1QX2 A;  4PHN A;  1K95 A;  1LIN A;  3D10 A;  5TNC A;  3VRP A;  1MXL C;  3GK2 A;  3WHT B;  3SG5 A;  1DF0 B;  4WQ2 A;  5KSZ A;  1CTR A;  2DOQ A;  2ISD A;  1J7P A;  1SYM A;  3AKA A;  2IS9 A;  1YRT B;  3BXK A;  5KU1 A;  2JQ6 A;  3BYA A;  4HRH A;  1Y6W A;  1LXF C;  1UHK A;  2EC6 B;  1IJ5 A;  5CSI A;  1RJV A;  1LKJ A;  1SY9 A;  5AXI A;  2EC6 C;  2COL B;  2VRG A;  1F4O A;  1U5I A;  2LM5 A;  2WCB A;  2KAV A;  3LL8 B;  4PHM A;  1EH2 A;  1PVA A;  2QAC A;  4PE7 A;  2KYC A;  1AJ4 A;  1NSH A;  1XFV O;  1DJH A;  2GGM A;  1CM1 A;  2F33 A;  4HRG A;  1QX7 A;  1YUS A;  2MAZ A;  1QLS A;  3H4S E;  1D1O A;  1CKK A;  1B1G A;  1QAT A;  1SKT A;  1YVL A;  2JNF A;  4XYN A;  1AK8 A;  1Y1U A;  1E8A A;  1DJI A;  4YI8 A;  4I5J A;  3VRO A;  1S5G Y;  3D0Y B;  4WQ3 A;  1C07 A;  5I2L A;  2PRU A;  1BOD A;  1ZUZ A;  4MRX A;  2KDH A;  1BMO A;  3IQQ A;  3NXA A;  1J1D A;  1RTP 1;  2MJW B;  1ALV A;  2L5X B;  2KAX A;  3GK4 X;  5F6T A;  4DIR A;  3CS1 A;  2M97 A;  1A03 A;  1AHR A;  1JFK A;  2JOJ A;  1S6C A;  1U5I B;  2KOT A;  1FI6 A;  2FCD A;  3LLE A;  1AVS A;  1BR1 B;  1VRK A;  1OOJ A;  1YTZ C;  1TNX A;  3NSO A;  3BUM B;  1QVI Y;  1SL9 A;  3O6B A;  4MLW A;  4JQ0 D;  1KCY A;  3IQO A;  2PSR A;  3GOF A;  1EL4 A;  1K9U A;  5HLV A;  3SG7 A;  2PMY A;  1H4B A;  1CDM A;  3NSL A;  3CWG A;  1BU3 A;  1ODB A;  1J7Q A;  2M7L A;  1GGZ A;  4JPZ B;  2SAS A;  1YX8 A;  2M29 A;  2LNK A;  4DUQ A;  2ZFD A;  1J1E A;  1A29 A;  2KAY A;  5I2O A;  1CM4 A;  1WY9 A;  3SIB A;  2F2O A;  4HRE E;  3EK4 A;  4YGC B;  3A8R A;  2JTT A;  1F55 A;  2M49 B;  3NSK A;  2I7A A;  1OQP A;  2WOR A;  4F0Z B;  4A4C A;  1M45 A;  2LP3 A;  1UUS A;  1TTX A;  5GQQ C;  3QRX A;  1CLB A;  1NX2 A;  1GQM A;  3OX5 A;  3EVV A;  4HSZ A;  1QJT A;  2BL0 C;  1IG5 A;  2LCP A;  1EG4 A;  1ZFS A;  4BY4 A;  2KBM A;  1NCZ A;  2LVK A;  3FWC A;  2OPO A;  1CFF A;  1B8C A;  1TNP A;  3JTD B;  1AJ5 A;  1NIW A;  2H2K A;  3CR5 X;  1TCF A;  2Y1N A;  2HQ8 A;  5AER A;  2JXC A;  1AP4 A;  2KQ6 A;  2M1K B;  2ZRT A;  1NX0 A;  1K96 A;  3WXA A;  1F4Q A;  1C7V A;  1SBJ A;  1DMO A;  3DVE A;  1B7T Y;  1DJZ A;  2L50 A;  1YUT A;  1V1F A;  2LHI A;  1KK8 B;  4ICB A;  5HYD A;  1Q80 A;  4IL1 A;  3VGO A;  2JC2 A;  2L0P A;  1UHH A;  1OE9 B;  2JPT A;  4YBH B;  4USL A;  1KK8 C;  1MXE A;  4NDB A;  3TDU A;  4QJ4 B;  1SR6 C;  1TN4 A;  2F2P A;  2ZNE A;  4PE4 A;  1B9A A;  1PSR A;  3BUO B;  1CDP A;  4TNC A;  1DTL A;  1SL7 A;  1G4Y R;  1J7R A;  2BE6 A;  4Q04 A;  3FS7 A;  1M39 A;  1CMG A;  2CTN A;  4MZL A;  4GFT A;  2KGB C;  3CR2 A;  1XO5 A;  1QIV A;  4I5K A;  1UUR A;  2M0R A;  1FBV A;  3OB2 B;  1N0Y A;  4N5X A;  1J7O A;  2P6B B;  2LMV A;  4M2Q A;  1C7W A;  2HF5 A;  3TS5 B;  4XJK A;  1CFP A;  1B8L A;  2MA2 A;  4PCW A;  4N1F A;  1DVI A;  1XFZ O;  2L4I A;  2KI6 D;  2Q4U A;  1OMV A;  1CB1 A;  2NZ0 A;  4AOM A;  3DF0 A;  3SIA A;  5BPJ A;  1KK7 Z;  4MZK A;  2KNE A;  1B47 A;  3NSI A;  4YGA A;  1K9K A;  1FW4 A;  2OS8 B;  4ZCU A;  3TDI A;  1RRO A;  5D69 A;  4ETO A;  1JBA A;  4GGF A;  1PVB A;  1SPY A;  1WDC B;  2LAN A;  5CSN A;  4C0K A;  5JJG A;  2LAP A;  1SCV A;  2LHL A;  1XFY O;  4GUK A;  2H61 A;  4YI9 A;  3SG3 A;  1YVH A;  1XFU O;  3KPX A;  4ZCV A;  1IQ3 A;  1XA5 A;  1K8U A;  1IH0 A;  1NCX A;  1IKU A;  1SW8 A;  4YRU A;  1PRW A;  1JC2 A;  1N65 A;  3JVT B;  2F3Z A;  4QJ3 B;  3BUN B;  2Q91 A;  1XVJ A;  2K7D A;  1PK0 D;  2KHN A;  4M2O A;  4XJK B;  3KO0 A;  2K2F A;  1NYA A;  3I5I B;  2RGI A;  4CLN A;  4MSP A;  1YRU B;  4GPL B;  5G08 A;  1RFJ A;  1B4C A;  5DKR A;  3I5I C;  1L2O B;  1XK4 A;  3PSR A;  5DKN A;  4N1G A;  3WNX B;  1YUU A;  1W7J B;  2KFF A;  2K8M B;  2KYF A;  2L4H A;  2LVV A;  3EVU A;  3TUY B;  3DVK A;  3DF0 B;  3MSE B;  4MEW A;  2NLN A;  2CCM A;  2JXL A;  3VRQ A;  4DCK A;  1QIW A;  2K7B A;  1S5G Z;  1F8H A;  1N2D A;  1M31 A;  2AAO A;  3AAJ A;  4OVN F;  4I5N B;  3WHU B;  1FF1 A;  3KHE A;  4AQJ A;  1NX1 A;  1ZAC A;  2ZN9 A;  1DJX A;  1Y0V H;  2OTG B;  1G8I A;  1QV0 A;  2JRF A;  1YR5 A;  1MQ1 A;  1Y1X A;  2OTG C;  2Y4Q A;  2LV7 A;  3CTN A;  1YX7 A;  3CZT X;  1NP8 A;  1OMR A;  2KBI A;  1SMG A;  1QV1 A;  1S1E A;  2LLT A;  4OKH A;  2HQW A;  1A2X A;  1KSM A;  1QVI Z;  4FTG A;  2BCX A;  4CFQ A;  5AFP A;  5HKZ A;  2LUC A;  2ZKM X;  2WCE A;  1SCM B;  2D8N A;  1S26 D;  1WLM A;  2E6W A;  1PAL A;  2AUC A;  3I5G B;  2M7N A;  5IBW A;  1KSO A;  1SCM C;  3I5F B;  4GBA A;  1KFU L;  3PFV A;  4FQO A;  2ZN8 A;  3PN7 B;  3HX4 A;  1F71 A;  1KFU S;  2QPT A;  1UHN A;  3FWB A;  3FIA A;  3K21 A;  3PN7 C;  4A4B A;  5CSJ A;  1QLK A;  1BF5 A;  2PAL A;  1KFX L;  1B8R A;  3JTD C;  4CPV A;  4D1E A;  2M8U A;  2BEC A;  1V1G A;  5JOL A;  2JNX A;  1KWO B;  2BBN A;  1BOC A;  1K93 D;  2LC5 A;  1UWO A;  4E68 A;  5I2Q A;  3PAL A;  3OHM B;  4JWQ A;  4WRI A;  1FI5 A;  3EKH A;  4PHK A;  2KI6 C;  5I8N A;  4PAL A;  1CLL A;  1QS7 A;  2M9G A;  1SNL A;  2TN4 A;  1IRJ A;  3SG2 A;  4C0J A;  4U8D A;  2WOS A;  1KQM B;  1PSB A;  4YGE B;  2F3Y A;  3EK7 A;  1A4P A;  2LLU A;  2L2E A;  1KQM C;  3EKJ A;  1LA3 A;  5J3X A;  4M2P A;  1KQV A;  1JFJ A;  3O4Y A;  1JWD A;  1GGW A;  1G33 A;  3GK1 A;  1SL8 A;  1MF8 B;  3ICB A;  3C1V A;  5D7F A;  1DJY A;  2K2A A;  2E30 A;  1RWY A;  1HT9 A;  5CPV A;  3TS5 C;  3TZ1 A;  1MR8 A;  1M46 A;  2M1U A;  3CLN A;  3LK0 A;  3BQ3 A;  1MWN A;  2LVJ A;  4DRW A;  1MUX A;  3ZNI A;  2LVI A;  4AQI A;  1XFW O;  1QTX A;  1YUR A;  5HKW A;  2HET A;  3EK8 A;  1KK7 Y;  2LLS A;  2Y5I A;  3VRR A;  1DGV A;  1QX5 B;  3D0Y A;  1JUO A;  5DKQ A;  5B8I B;  2LE9 B;  3PM8 A;  2WC8 A;  5HLO A;  4ORC B;  2KI4 B;  2OS8 C;  3LCP C;  3OP0 A;  1FPW A;  4ORA B;  1WRK A;  1M63 B;  1AUI B;  2JZI A;  2G9B A;  5ER4 X;  2KI4 C;  2KFG A;  2EGD A;  1WDC C;  1IJ6 A;  4GNK B;  3HCM A;  2JU0 A;  1S6J A;  2GV5 A;  3OB1 B;  1F70 A;  1K2H A;  2BBM A;  1UHI A;  4GGN A;  2I94 A;  3BUW B;  3F45 A;  2WCF A;  1WRZ A;  5ER5 A;  2V53 A;  4MRY A;  1CDN A;  1TOP A;  1TNW A;  1X02 A;  1W7I B;  1WLZ A;  3JVT C;  1MHO A;  3SG4 A;  2AMI A;  1TIZ A;  4NQG A;  4OR9 B;  4OV2 A;  2WND A;  2CBL A;  5K89 A;  1CNP A;  1UP5 A;  1F54 A;  1JF2 A;  4NDC A;  1OSA A;  2R2I A;  1EXR A;  2LMU A;  4PE0 A;  1IGV A;  1K94 A;  2I2R E;  1SRA A;  1L2O C;  2BCA A;  4PE1 A;  3TUY C;  1CLM A;  4PHJ A;  3E3R A;  2L51 A;  2JWW A;  3BOW A;  2L98 A;  1S6I A;  5PAL A;  2LMT A;  4CID A;  5AAN A;  1CFC A;  1TRF A;  1ALW A;  2ZRS A;  2B1U A;  5FYX A;  3I5H B;  1DT7 B;  1R2U A;  3BUX B;  4GGF C;  5HKY A;  3CGA A;  1A75 A;  3IF7 A;  1CFD A;  1OZS A;  1REC A;  2GGZ A;  1DJG A;  3I5H C;  2JT8 A;  2H61 C;  1NPQ A;  2F8P A;  2FCE A;  2FOT A;  2M3W A;  2MRD A;  4GAO A;  1OZO A; 
#chains in the Genus database with same CATH topology
 2NCP A;  3NHT A;  2NXQ A;  2K61 A;  2KQY A;  3A4U B;  1EJ3 A;  4DS7 A;  2QEO A;  3O78 A;  1DJW A;  1J55 A;  4NDD A;  2MLE C;  3DVJ A;  5EL2 A;  3PLF B;  4C0L A;  4ORB B;  4R1E A;  1OOF A;  2KFH A;  2KSP A;  2ZND A;  2CNP A;  2I18 A;  1DQE A;  3L4A A;  4PT1 A;  5CSF A;  1XK4 C;  4MBE A;  5FI2 A;  1ORG A;  1XYD A;  1ZMZ A;  3I5G C;  3O2P A;  4P2Y B;  1NUB A;  3I5F C;  1K9P A;  1ZOT B;  2K7C A;  1OMD A;  2Y1M A;  4MVF A;  4YGD B;  5AEQ A;  1BLQ A;  3BFA A;  1S3P A;  2JT0 A;  2LUX A;  3BOW B;  1IWQ A;  1EG3 A;  1NWD A;  3OX6 A;  1GM0 A;  2MLF C;  2K7O A;  2CT9 A;  2BCB A;  2NCO A;  4UPG A;  2O5G A;  1JSA A;  1KFX S;  1S36 A;  1A75 B;  4CFR A;  2PYQ A;  3AAK A;  1XFX O;  2G2B A;  2WC6 A;  4I5L B;  3RM1 A;  1CMF A;  2BL0 B;  1SK6 D;  2JPO A;  1RK9 A;  3DVM A;  3KEV A;  3VRN A;  1LA0 A;  2KGR A;  3EG5 B;  2PVB A;  1UHJ A;  2HPS A;  1KWO C;  1QAS A;  2JTZ A;  3AKB A;  1DF0 A;  3DYE A;  1OOH A;  2A4J A;  4P5O E;  1GJY A;  1HQV A;  2QEH A;  3SG6 A;  2BE4 A;  2K0J A;  4L9M A;  2MBX A;  2O60 A;  3FE6 A;  3ZWH A;  2JUL A;  2JT3 A;  2FJU B;  3LK1 A;  1DC1 A;  3IVT A;  4OCI A;  4QJ5 B;  1BG1 A;  2KPH A;  2EHB A;  3PAT A;  1B7T Z;  1JF0 A;  1NX3 A;  4PDZ A;  3EVR A;  1BJF A;  3B6X A;  1R6P A;  1K90 D;  2QDI A;  3BFH A;  3DD4 A;  1DGU A;  2SCP A;  4YGB B;  1CDL A;  1BR4 B;  4MN0 A;  3SJS A;  2CXJ A;  1SR6 B;  2P71 A;  3S0D A;  1BT6 A;  1PUL A;  2BKH B;  2BKI B;  3OGN A;  1L7Z A;  1TCO B;  1TNQ A;  2LP2 A;  1QXP A;  5KTY A;  2PAS A;  4BY5 A;  1IQ5 A;  1H8B A;  1WRL A;  2MHH A;  2WC5 A;  1Y1A A;  5FI7 A;  3CR4 X;  3M0W A;  3RLZ A;  3KF9 A;  1LVC D;  4MZJ A;  1NCY A;  2BAP A;  3TDZ A;  5D3O A;  1QX2 A;  3D78 A;  4PHN A;  1K95 A;  1LIN A;  3D10 A;  3N7H A;  5TNC A;  1MXL C;  3GK2 A;  3VRP A;  3SG5 A;  3WHT B;  1DF0 B;  3NHI A;  4INX A;  4WQ2 A;  5KSZ A;  1CTR A;  2DOQ A;  2ISD A;  1J7P A;  1SYM A;  2WCH A;  3AKA A;  3D76 A;  2IS9 A;  1YRT B;  3BXK A;  5FI6 A;  1SSE B;  5KU1 A;  2JQ6 A;  3BYA A;  4HRH A;  1Y6W A;  1LXF C;  1UHK A;  2EC6 B;  1IJ5 A;  5CSI A;  1C3Y A;  1RJV A;  1LKJ A;  3S0E A;  1SY9 A;  5AXI A;  2EC6 C;  2COL B;  2VRG A;  1F4O A;  1U5I A;  2LM5 A;  2WCB A;  2KAV A;  3LL8 B;  4PHM A;  1EH2 A;  1PVA A;  2QAC A;  3SS5 A;  4PE7 A;  2KYC A;  1AJ4 A;  1NSH A;  1XFV O;  1DJH A;  2GGM A;  1CM1 A;  2F33 A;  4HRG A;  1QX7 A;  1YUS A;  3PM2 A;  4IJ7 A;  2MAZ A;  1QLS A;  3H4S E;  1D1O A;  1CKK A;  1B1G A;  1QAT A;  1SKT A;  1YVL A;  2JNF A;  4XYN A;  1AK8 A;  3BJH A;  4JKT A;  1Y1U A;  1E8A A;  1DJI A;  4YI8 A;  4I5J A;  3VRO A;  1S5G Y;  3S0F A;  3D0Y B;  4WQ3 A;  3V2L A;  5I2L A;  1C07 A;  2PRU A;  1C3Z A;  3S0G A;  1BOD A;  1ZUZ A;  4MRX A;  2KDH A;  1BMO A;  3IQQ A;  3NXA A;  1J1D A;  1RTP 1;  3FE8 A;  2MJW B;  1ALV A;  2L5X B;  2KAX A;  3GK4 X;  5F6T A;  4DIR A;  3CS1 A;  2M97 A;  1A03 A;  1AHR A;  1JFK A;  2JOJ A;  1S6C A;  1OOG A;  1U5I B;  2KOT A;  1QWV A;  2FCD A;  1FI6 A;  3LLE A;  1AVS A;  1BR1 B;  1VRK A;  1OOJ A;  1YTZ C;  1TNX A;  3NSO A;  3BUM B;  3QME A;  1QVI Y;  1SL9 A;  3O6B A;  1OW4 A;  4JQ0 D;  4MLW A;  1KCY A;  3IQO A;  3CZ1 A;  2PSR A;  3GOF A;  1EL4 A;  1K9U A;  3R1P A;  5HLV A;  3SG7 A;  2PMY A;  1H4B A;  1CDM A;  3NSL A;  2WCK A;  1BU3 A;  1ODB A;  3CWG A;  2M7L A;  1J7Q A;  1GGZ A;  4JPZ B;  2SAS A;  1YX8 A;  2M29 A;  2LNK A;  4DUQ A;  2ZFD A;  1J1E A;  1A29 A;  2KAY A;  5I2O A;  1CM4 A;  1WY9 A;  3SIB A;  2F2O A;  4HRE E;  3EK4 A;  4YGC B;  3A8R A;  3SS4 A;  2JTT A;  3CZ0 A;  1F55 A;  2M49 B;  3NSK A;  2I7A A;  1OQP A;  2WOR A;  4F0Z B;  4A4C A;  1M45 A;  2LP3 A;  1UUS A;  1TTX A;  5GQQ C;  3QRX A;  1CLB A;  1NX2 A;  1GQM A;  3OX5 A;  3EVV A;  4HSZ A;  1QJT A;  2BL0 C;  1IG5 A;  2LCP A;  1EG4 A;  1ZFS A;  4BY4 A;  2KBM A;  2WCM A;  2WCL A;  3PJI A;  1NCZ A;  2LVK A;  3FWC A;  2OPO A;  1CFF A;  1B8C A;  1TNP A;  3JTD B;  1AJ5 A;  1NIW A;  2H2K A;  3CR5 X;  1TCF A;  2Y1N A;  2HQ8 A;  5AER A;  3R1O A;  2JXC A;  1AP4 A;  2KQ6 A;  2M1K B;  2ERB A;  2ZRT A;  1NX0 A;  1K96 A;  3WXA A;  1F4Q A;  1C7V A;  1SBJ A;  1DMO A;  3DVE A;  1B7T Y;  2L2C A;  1DJZ A;  2L50 A;  1YUT A;  1V1F A;  2LHI A;  1T14 A;  1KK8 B;  1DEL A;  4ICB A;  1Q80 A;  4IL1 A;  3VGO A;  5HYD A;  2JC2 A;  2L0P A;  1UHH A;  1OE9 B;  2JPT A;  3D74 A;  3DXL A;  4YBH B;  4USL A;  1KK8 C;  1MXE A;  3VB1 A;  4NDB A;  3TDU A;  4QJ4 B;  1SR6 C;  1TN4 A;  2F2P A;  2ZNE A;  4PE4 A;  1B9A A;  1PSR A;  3BUO B;  1CDP A;  4TNC A;  1DTL A;  4OZD A;  1SL7 A;  1G4Y R;  1J7R A;  1Z4H A;  2BE6 A;  4Q04 A;  3FS7 A;  1M39 A;  1CMG A;  2CTN A;  4MZL A;  4GFT A;  2KGB C;  3CR2 A;  1XO5 A;  1QIV A;  4I5K A;  1UUR A;  3K1E A;  2M0R A;  1FBV A;  3OB2 B;  1N0Y A;  4N5X A;  1J7O A;  2P6B B;  2QEV A;  2LMV A;  4M2Q A;  1C7W A;  2HF5 A;  3TS5 B;  4XJK A;  1CFP A;  1B8L A;  2MA2 A;  4PCW A;  4N1F A;  1DVI A;  1IIO A;  1XFZ O;  2L4I A;  2KI6 D;  2Q4U A;  1OMV A;  3CYZ A;  1CB1 A;  2NZ0 A;  4AOM A;  3DF0 A;  3SIA A;  5BPJ A;  1KK7 Z;  4MZK A;  2KNE A;  1B47 A;  3NSI A;  4YGA A;  1K9K A;  1FW4 A;  2OS8 B;  4ZCU A;  3TDI A;  1RRO A;  2L5Y A;  5D69 A;  4ETO A;  3CAB A;  1JBA A;  3R1V A;  4GGF A;  1PVB A;  1SPY A;  1WDC B;  2LAN A;  5CSN A;  4C0K A;  5JJG A;  2LAP A;  1SCV A;  2LHL A;  1XFY O;  4GUK A;  2H61 A;  4YI9 A;  3SG3 A;  1YVH A;  1XFU O;  3KPX A;  4ZCV A;  1IQ3 A;  1XA5 A;  1K8U A;  1IH0 A;  1NCX A;  4FQT A;  1IKU A;  1SW8 A;  4YRU A;  1PRW A;  1JC2 A;  1N65 A;  2PQL A;  3JVT B;  2F3Z A;  4QJ3 B;  3BUN B;  2Q91 A;  1XVJ A;  2K7D A;  1PK0 D;  2KHN A;  4M2O A;  4XJK B;  3KO0 A;  2K2F A;  1NYA A;  3I5I B;  2RGI A;  4CLN A;  4MSP A;  3B87 A;  1YRU B;  4GPL B;  5G08 A;  1RFJ A;  1B4C A;  5DKR A;  3I5I C;  1L2O B;  1XK4 A;  3PSR A;  5DKN A;  4N1G A;  3WNX B;  1YUU A;  1W7J B;  2KFF A;  2K8M B;  2KYF A;  2L4H A;  2LVV A;  3EVU A;  3TUY B;  3UNW A;  3DVK A;  3DF0 B;  3MSE B;  4MEW A;  2NLN A;  2CCM A;  2JXL A;  3VRQ A;  4DCK A;  1QIW A;  2K7B A;  1S5G Z;  1F8H A;  1N2D A;  1M31 A;  2AAO A;  3AAJ A;  4OVN F;  1TWO A;  3S0A A;  4I5N B;  5HL1 A;  2BNX A;  3WHU B;  1FF1 A;  3KHE A;  3Q8I A;  5DIC A;  1NX1 A;  4AQJ A;  1ZAC A;  2ZN9 A;  1DJX A;  1Y0V H;  2OTG B;  1G8I A;  1QV0 A;  3NGV A;  2JRF A;  3CZ2 A;  1YR5 A;  1MQ1 A;  1Y1X A;  2OTG C;  2Y4Q A;  2LV7 A;  3CTN A;  1YX7 A;  3CZT X;  1NP8 A;  2WCJ A;  1OMR A;  2KBI A;  1SMG A;  1QV1 A;  1S1E A;  2LLT A;  4OKH A;  2HQW A;  1A2X A;  1KSM A;  1QVI Z;  4FTG A;  2BCX A;  4CFQ A;  5AFP A;  5HKZ A;  2LUC A;  2ZKM X;  3R72 A;  2WCE A;  1SCM B;  2D8N A;  3FE9 A;  1S26 D;  1WLM A;  2E6W A;  1PAL A;  2AUC A;  3I5G B;  2M7N A;  5IBW A;  1KSO A;  2YGU A;  1SCM C;  3I5F B;  4GBA A;  1KFU L;  3PFV A;  5I94 A;  1TUJ A;  4FQO A;  2ZN8 A;  3PN7 B;  3HX4 A;  1F71 A;  1KFU S;  2FJY A;  2QPT A;  1UHN A;  3L47 A;  2KLE A;  3FWB A;  3FIA A;  3K21 A;  3PN7 C;  4A4B A;  5CSJ A;  1QLK A;  1BF5 A;  2PAL A;  1KFX L;  1B8R A;  2QEB A;  3JTD C;  4CPV A;  4D1E A;  3L4L A;  3BFB A;  2GTE A;  2M8U A;  2BEC A;  1V1G A;  5JOL A;  2JNX A;  1KWO B;  1XFR A;  2BBN A;  1BOC A;  1K93 D;  2LC5 A;  1UWO A;  4E68 A;  5I2Q A;  3PAL A;  3B86 A;  3DZT A;  3OHM B;  4JWQ A;  4WRI A;  1FI5 A;  3EKH A;  4PHK A;  2KI6 C;  5I8N A;  3RZS A;  4PAL A;  1CLL A;  1QS7 A;  2M9G A;  1SNL A;  2TN4 A;  1IRJ A;  3D75 A;  3SG2 A;  1OOI X;  4C0J A;  4U8D A;  2WOS A;  1KQM B;  1PSB A;  4YGE B;  3UO9 A;  2F3Y A;  3EK7 A;  1A4P A;  1TUZ A;  2LLU A;  2L2E A;  1KQM C;  3EKJ A;  1LA3 A;  5J3X A;  4M2P A;  1KQV A;  1JFJ A;  3O4Y A;  1JWD A;  1GGW A;  1G33 A;  3GK1 A;  1SL8 A;  1Z2C B;  1MF8 B;  3OBV A;  3ICB A;  1DEK A;  3C1V A;  5D7F A;  1DJY A;  2K2A A;  2E30 A;  1RWY A;  1HT9 A;  5CPV A;  3TS5 C;  3TZ1 A;  1MR8 A;  1M46 A;  2M1U A;  3CLN A;  3LK0 A;  3BQ3 A;  1MWN A;  2LVJ A;  4DRW A;  1MUX A;  3ZNI A;  2LVI A;  4AQI A;  1XFW O;  1QTX A;  1YUR A;  5HKW A;  2HET A;  3EK8 A;  1KK7 Y;  2LLS A;  2Y5I A;  3VRR A;  3S0B A;  1DGV A;  1QX5 B;  3D0Y A;  1JUO A;  5DKQ A;  5B8I B;  2LE9 B;  3PM8 A;  2WC8 A;  5HLO A;  4ORC B;  2KI4 B;  2OS8 C;  3LCP C;  3OP0 A;  4KYN A;  1FPW A;  4ORA B;  3B88 A;  1WRK A;  1M63 B;  1AUI B;  2JZI A;  2G9B A;  5ER4 X;  2KI4 C;  2KFG A;  2EGD A;  2KLD A;  2P70 A;  1WDC C;  1IJ6 A;  4GNK B;  3HCM A;  1LS8 A;  2JU0 A;  3DY9 A;  1S6J A;  2GV5 A;  2H8V A;  3D73 A;  3D77 A;  2BBM A;  3OB1 B;  1UHI A;  4JD9 A;  4GGN A;  1F70 A;  2I94 A;  1K2H A;  3BUW B;  3F45 A;  2WCF A;  3CDN A;  1WRZ A;  5ER5 A;  2V53 A;  4MRY A;  1CDN A;  1TOP A;  1TNW A;  1X02 A;  1W7I B;  1WLZ A;  3JVT C;  1MHO A;  4INW A;  3SG4 A;  2AMI A;  1TIZ A;  4NQG A;  4OR9 B;  4OV2 A;  2WND A;  2CBL A;  5K89 A;  1CNP A;  1UP5 A;  1F54 A;  1JF2 A;  4NDC A;  1OSA A;  3O4X A;  2R2I A;  1EXR A;  3SS3 A;  2LMU A;  4PE0 A;  1IGV A;  2K60 A;  1K94 A;  2I2R E;  1SRA A;  1L2O C;  2BCA A;  3B7A A;  4PE1 A;  1W9Z A;  3TUY C;  1CLM A;  4PHJ A;  3E3R A;  4F7F A;  2L51 A;  1P28 A;  2JWW A;  3BOW A;  2L98 A;  1S6I A;  5PAL A;  2LMT A;  4CID A;  5AAN A;  1CFC A;  1TRF A;  1ALW A;  2ZRS A;  2B1U A;  5FYX A;  3I5H B;  1DT7 B;  1R2U A;  3BUX B;  4GGF C;  5HKY A;  3CGA A;  1A75 A;  3IF7 A;  1CFD A;  1OZS A;  1REC A;  2GGZ A;  1DJG A;  3I5H C;  2JT8 A;  2H61 C;  1NPQ A;  2F8P A;  2FCE A;  2FOT A;  2M3W A;  2MRD A;  4GAO A;  1OZO A; 
#chains in the Genus database with same CATH homology
 2NCP A;  2NXQ A;  2K61 A;  2KQY A;  3A4U B;  1EJ3 A;  4DS7 A;  3O78 A;  1DJW A;  1J55 A;  4NDD A;  2MLE C;  3DVJ A;  3PLF B;  4C0L A;  4ORB B;  4R1E A;  2KFH A;  2KSP A;  2ZND A;  2CNP A;  2I18 A;  5CSF A;  1XK4 C;  4MBE A;  5FI2 A;  1XYD A;  3I5G C;  1ZMZ A;  3O2P A;  4P2Y B;  1NUB A;  3I5F C;  1K9P A;  1ZOT B;  2K7C A;  1OMD A;  2Y1M A;  4MVF A;  4YGD B;  5AEQ A;  1BLQ A;  1S3P A;  2JT0 A;  2LUX A;  3BOW B;  1IWQ A;  1EG3 A;  1NWD A;  3OX6 A;  2MLF C;  2K7O A;  2CT9 A;  2BCB A;  2NCO A;  4UPG A;  2O5G A;  1JSA A;  1KFX S;  1S36 A;  1A75 B;  4CFR A;  3RM1 A;  3AAK A;  1XFX O;  2G2B A;  4I5L B;  1CMF A;  2BL0 B;  1SK6 D;  1RK9 A;  3DVM A;  3KEV A;  3VRN A;  1LA0 A;  2KGR A;  3EG5 B;  2PVB A;  1UHJ A;  2HPS A;  1KWO C;  1QAS A;  2JTZ A;  3AKB A;  1DF0 A;  4P5O E;  2A4J A;  3SG6 A;  1GJY A;  1HQV A;  2BE4 A;  2K0J A;  4L9M A;  2MBX A;  2O60 A;  3ZWH A;  2JUL A;  2JT3 A;  2FJU B;  3LK1 A;  1DC1 A;  3IVT A;  4OCI A;  4QJ5 B;  1BG1 A;  2EHB A;  3PAT A;  1B7T Z;  1JF0 A;  1NX3 A;  4PDZ A;  3EVR A;  1BJF A;  1R6P A;  1K90 D;  3DD4 A;  1DGU A;  2SCP A;  4YGB B;  1CDL A;  1BR4 B;  4MN0 A;  3SJS A;  2CXJ A;  1SR6 B;  1BT6 A;  1PUL A;  2BKH B;  2BKI B;  1L7Z A;  1TCO B;  1TNQ A;  2LP2 A;  1QXP A;  5KTY A;  2PAS A;  4BY5 A;  1IQ5 A;  1H8B A;  1WRL A;  2MHH A;  1Y1A A;  5FI7 A;  3CR4 X;  3M0W A;  3RLZ A;  3KF9 A;  1LVC D;  4MZJ A;  1NCY A;  2BAP A;  3TDZ A;  5D3O A;  1QX2 A;  4PHN A;  1K95 A;  1LIN A;  3D10 A;  5TNC A;  3VRP A;  1MXL C;  3GK2 A;  3WHT B;  3SG5 A;  1DF0 B;  4WQ2 A;  5KSZ A;  1CTR A;  2DOQ A;  2ISD A;  1J7P A;  1SYM A;  3AKA A;  2IS9 A;  1YRT B;  3BXK A;  5KU1 A;  5FI6 A;  2JQ6 A;  3BYA A;  4HRH A;  1Y6W A;  1LXF C;  1UHK A;  2EC6 B;  1IJ5 A;  5CSI A;  1RJV A;  1LKJ A;  1SY9 A;  5AXI A;  2EC6 C;  2COL B;  2VRG A;  1F4O A;  1U5I A;  2LM5 A;  2WCB A;  2KAV A;  3LL8 B;  4PHM A;  1EH2 A;  1PVA A;  2QAC A;  3SS5 A;  4PE7 A;  2KYC A;  1AJ4 A;  1NSH A;  1XFV O;  1DJH A;  2GGM A;  1CM1 A;  2F33 A;  4HRG A;  1QX7 A;  1YUS A;  3PM2 A;  4IJ7 A;  2MAZ A;  1QLS A;  3H4S E;  1D1O A;  1CKK A;  1B1G A;  1QAT A;  1SKT A;  1YVL A;  2JNF A;  4XYN A;  1AK8 A;  4JKT A;  1Y1U A;  1E8A A;  1DJI A;  4YI8 A;  4I5J A;  3VRO A;  1S5G Y;  3D0Y B;  4WQ3 A;  1C07 A;  5I2L A;  2PRU A;  1BOD A;  1ZUZ A;  4MRX A;  2KDH A;  1BMO A;  3IQQ A;  3NXA A;  1J1D A;  1RTP 1;  2MJW B;  1ALV A;  2L5X B;  2KAX A;  3GK4 X;  5F6T A;  4DIR A;  3CS1 A;  2M97 A;  1A03 A;  1AHR A;  1JFK A;  2JOJ A;  1S6C A;  1U5I B;  2KOT A;  1FI6 A;  2FCD A;  3LLE A;  1AVS A;  1BR1 B;  1VRK A;  1OOJ A;  1YTZ C;  1TNX A;  3NSO A;  3BUM B;  1QVI Y;  1SL9 A;  3O6B A;  4MLW A;  4JQ0 D;  1KCY A;  3IQO A;  2PSR A;  3GOF A;  1EL4 A;  1K9U A;  5HLV A;  3SG7 A;  2PMY A;  1H4B A;  1CDM A;  3NSL A;  3CWG A;  1BU3 A;  1ODB A;  1J7Q A;  2M7L A;  1GGZ A;  4JPZ B;  2SAS A;  1YX8 A;  2M29 A;  2LNK A;  4DUQ A;  2ZFD A;  1J1E A;  1A29 A;  2KAY A;  5I2O A;  1CM4 A;  1WY9 A;  3SIB A;  2F2O A;  4HRE E;  3EK4 A;  4YGC B;  3A8R A;  3SS4 A;  2JTT A;  1F55 A;  2M49 B;  3NSK A;  2I7A A;  1OQP A;  2WOR A;  4F0Z B;  4A4C A;  1M45 A;  2LP3 A;  1UUS A;  1TTX A;  5GQQ C;  3QRX A;  1CLB A;  1NX2 A;  1GQM A;  3OX5 A;  3EVV A;  4HSZ A;  1QJT A;  2BL0 C;  1IG5 A;  2LCP A;  1EG4 A;  1ZFS A;  4BY4 A;  2KBM A;  1NCZ A;  2LVK A;  3FWC A;  2OPO A;  1CFF A;  1B8C A;  1TNP A;  3JTD B;  1AJ5 A;  1NIW A;  2H2K A;  3CR5 X;  1TCF A;  2Y1N A;  2HQ8 A;  5AER A;  2JXC A;  1AP4 A;  2KQ6 A;  2M1K B;  2ZRT A;  1NX0 A;  1K96 A;  3WXA A;  1F4Q A;  1C7V A;  1SBJ A;  1DMO A;  3DVE A;  1B7T Y;  1DJZ A;  2L50 A;  1YUT A;  1V1F A;  2LHI A;  1KK8 B;  4ICB A;  5HYD A;  1Q80 A;  4IL1 A;  3VGO A;  1DEL A;  2JC2 A;  2L0P A;  1UHH A;  1OE9 B;  2JPT A;  4YBH B;  4USL A;  1KK8 C;  1MXE A;  4NDB A;  3TDU A;  4QJ4 B;  1SR6 C;  1TN4 A;  2F2P A;  2ZNE A;  4PE4 A;  1B9A A;  1PSR A;  3BUO B;  1CDP A;  4TNC A;  1DTL A;  1SL7 A;  1G4Y R;  1J7R A;  2BE6 A;  1Z4H A;  4Q04 A;  3FS7 A;  1M39 A;  1CMG A;  2CTN A;  4MZL A;  4GFT A;  2KGB C;  3CR2 A;  1XO5 A;  1QIV A;  4I5K A;  1UUR A;  2M0R A;  1FBV A;  3OB2 B;  1N0Y A;  4N5X A;  1J7O A;  2P6B B;  2LMV A;  4M2Q A;  1C7W A;  2HF5 A;  3TS5 B;  4XJK A;  1CFP A;  1B8L A;  2MA2 A;  4PCW A;  4N1F A;  1DVI A;  1XFZ O;  2L4I A;  2KI6 D;  2Q4U A;  1OMV A;  1CB1 A;  2NZ0 A;  4AOM A;  3DF0 A;  3SIA A;  5BPJ A;  1KK7 Z;  4MZK A;  2KNE A;  1B47 A;  3NSI A;  4YGA A;  1K9K A;  1FW4 A;  2OS8 B;  4ZCU A;  3TDI A;  1RRO A;  2L5Y A;  5D69 A;  4ETO A;  1JBA A;  4GGF A;  1PVB A;  1SPY A;  1WDC B;  2LAN A;  5CSN A;  4C0K A;  5JJG A;  2LAP A;  1SCV A;  2LHL A;  1XFY O;  4GUK A;  2H61 A;  4YI9 A;  3SG3 A;  1YVH A;  1XFU O;  3KPX A;  4ZCV A;  1IQ3 A;  1XA5 A;  1K8U A;  1IH0 A;  1NCX A;  1IKU A;  1SW8 A;  4YRU A;  1PRW A;  1JC2 A;  1N65 A;  3JVT B;  2F3Z A;  4QJ3 B;  3BUN B;  2Q91 A;  1XVJ A;  2K7D A;  1PK0 D;  2KHN A;  4M2O A;  4XJK B;  3KO0 A;  2K2F A;  1NYA A;  3I5I B;  2RGI A;  4CLN A;  4MSP A;  1YRU B;  4GPL B;  5G08 A;  1RFJ A;  1B4C A;  5DKR A;  3I5I C;  1L2O B;  1XK4 A;  3PSR A;  5DKN A;  4N1G A;  3WNX B;  1YUU A;  1W7J B;  2KFF A;  2K8M B;  2KYF A;  2L4H A;  2LVV A;  3EVU A;  3TUY B;  3UNW A;  3DVK A;  3DF0 B;  3MSE B;  4MEW A;  2NLN A;  2CCM A;  2JXL A;  3VRQ A;  4DCK A;  1QIW A;  2K7B A;  1S5G Z;  1F8H A;  1N2D A;  1M31 A;  2AAO A;  3AAJ A;  4OVN F;  4I5N B;  5HL1 A;  2BNX A;  3WHU B;  1FF1 A;  3KHE A;  4AQJ A;  1NX1 A;  1ZAC A;  2ZN9 A;  1DJX A;  1Y0V H;  2OTG B;  1G8I A;  1QV0 A;  2JRF A;  1YR5 A;  1MQ1 A;  1Y1X A;  2OTG C;  2Y4Q A;  2LV7 A;  3CTN A;  1YX7 A;  3CZT X;  1NP8 A;  1OMR A;  2KBI A;  1SMG A;  1QV1 A;  1S1E A;  2LLT A;  4OKH A;  2HQW A;  1A2X A;  1KSM A;  1QVI Z;  4FTG A;  2BCX A;  4CFQ A;  5AFP A;  5HKZ A;  2LUC A;  2ZKM X;  2WCE A;  1SCM B;  2D8N A;  1S26 D;  1WLM A;  2E6W A;  1PAL A;  2AUC A;  3I5G B;  2M7N A;  5IBW A;  1KSO A;  2YGU A;  1SCM C;  3I5F B;  4GBA A;  1KFU L;  3PFV A;  5I94 A;  4FQO A;  2ZN8 A;  3PN7 B;  3HX4 A;  1F71 A;  1KFU S;  2QPT A;  1UHN A;  2KLE A;  3FWB A;  3FIA A;  3K21 A;  3PN7 C;  4A4B A;  5CSJ A;  1QLK A;  1BF5 A;  2PAL A;  1KFX L;  1B8R A;  3JTD C;  4CPV A;  4D1E A;  2M8U A;  2BEC A;  1V1G A;  5JOL A;  2JNX A;  1KWO B;  2BBN A;  1BOC A;  1K93 D;  2LC5 A;  1UWO A;  4E68 A;  5I2Q A;  3PAL A;  3OHM B;  4JWQ A;  4WRI A;  1FI5 A;  3EKH A;  4PHK A;  2KI6 C;  5I8N A;  4PAL A;  1CLL A;  1QS7 A;  2M9G A;  1SNL A;  2TN4 A;  1IRJ A;  3SG2 A;  4C0J A;  4U8D A;  2WOS A;  1KQM B;  1PSB A;  4YGE B;  3UO9 A;  2F3Y A;  3EK7 A;  1A4P A;  2LLU A;  2L2E A;  1KQM C;  3EKJ A;  1LA3 A;  5J3X A;  4M2P A;  1KQV A;  1JFJ A;  3O4Y A;  1JWD A;  1GGW A;  1G33 A;  3GK1 A;  1SL8 A;  1Z2C B;  1MF8 B;  3OBV A;  3ICB A;  1DEK A;  3C1V A;  5D7F A;  1DJY A;  2K2A A;  2E30 A;  1RWY A;  1HT9 A;  5CPV A;  3TS5 C;  3TZ1 A;  1MR8 A;  1M46 A;  2M1U A;  3CLN A;  3LK0 A;  3BQ3 A;  1MWN A;  2LVJ A;  4DRW A;  1MUX A;  3ZNI A;  2LVI A;  4AQI A;  1XFW O;  1QTX A;  1YUR A;  5HKW A;  2HET A;  3EK8 A;  1KK7 Y;  2LLS A;  2Y5I A;  3VRR A;  1DGV A;  1QX5 B;  3D0Y A;  1JUO A;  5DKQ A;  5B8I B;  2LE9 B;  3PM8 A;  2WC8 A;  5HLO A;  4ORC B;  2KI4 B;  2OS8 C;  3LCP C;  3OP0 A;  1FPW A;  4KYN A;  4ORA B;  1WRK A;  1M63 B;  1AUI B;  2JZI A;  2G9B A;  5ER4 X;  2KI4 C;  2KFG A;  2EGD A;  2KLD A;  1WDC C;  1IJ6 A;  4GNK B;  3HCM A;  2JU0 A;  1S6J A;  2GV5 A;  3OB1 B;  1F70 A;  1K2H A;  2BBM A;  1UHI A;  4GGN A;  2I94 A;  3BUW B;  3F45 A;  2WCF A;  1WRZ A;  5ER5 A;  2V53 A;  4MRY A;  1CDN A;  1TOP A;  1TNW A;  1X02 A;  1W7I B;  1WLZ A;  3JVT C;  1MHO A;  3SG4 A;  2AMI A;  1TIZ A;  4NQG A;  4OR9 B;  4OV2 A;  2WND A;  2CBL A;  5K89 A;  1CNP A;  1UP5 A;  1F54 A;  1JF2 A;  4NDC A;  1OSA A;  3O4X A;  2R2I A;  1EXR A;  3SS3 A;  2LMU A;  4PE0 A;  1IGV A;  2K60 A;  1K94 A;  2I2R E;  1SRA A;  1L2O C;  2BCA A;  4PE1 A;  1W9Z A;  3TUY C;  1CLM A;  4PHJ A;  3E3R A;  2L51 A;  2JWW A;  3BOW A;  2L98 A;  1S6I A;  5PAL A;  2LMT A;  4CID A;  5AAN A;  1CFC A;  1TRF A;  1ALW A;  2ZRS A;  2B1U A;  5FYX A;  3I5H B;  1DT7 B;  1R2U A;  3BUX B;  4GGF C;  5HKY A;  3CGA A;  1A75 A;  3IF7 A;  1CFD A;  1OZS A;  1REC A;  2GGZ A;  1DJG A;  3I5H C;  2JT8 A;  2H61 C;  1NPQ A;  2F8P A;  2FCE A;  2FOT A;  2M3W A;  2MRD A;  4GAO A;  1OZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...