1WY9A

Crystal structure of microglia-specific protein, iba1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allograft inflammatory factor 1
publication title X-ray Structures of the Microglia/Macrophage-specific Protein Iba1 from Human and Mouse Demonstrate Novel Molecular Conformation Change Induced by Calcium binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 38
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wy9A00
1XFWO 1OZOA 4ICBA 2EC6C 1QV0A 3QRXA 1LVCD 3E3RA 1KFUL 1NSHA 2LE9B 1OSAA 4AOMA 1NYAA 1SL8A 1NCZA 2LNKA 1R6PA 5HKZA 4DS7A 5KSZA 1CDNA 2KFGA 1S1EA 4N5XA 1RWYA 1KCYA 1YVLA 2M8UA 4MBEA 1TCFA 3BQ3A 1AJ4A 1CTRA 4USLA 1S6IA 1SK6D 2WC8A 5I2LA 1JFJA 2V53A 2CXJA 4PDZA 5JOLA 3CR5X 2GGZA 4MZLA 1IRJA 3IQQA 2M1KB 2Q4UA 1QIVA 3PLFB 1MXLC 5CPVA 2K2FA 2L51A 2ZKMX 3SG7A 1ZMZA 1UURA 1CDMA 1KSOA 3EKJA 3VRQA 3GK4X 1B8LA 1NPQA 1RFJA 1TNWA 2KQYA 3DVEA 1J7PA 2KNEA 4CLNA 1EG4A 4BY4A 1QTXA 4YBHB 5HKYA 1A75A 2M7NA 1A75B 1B1GA 3TZ1A 1MUXA 2HPSA 1N2DA 2KYCA 2LLUA 1K95A 3EK7A 1QVIZ 1CFDA 5F6TA 1WLMA 1G33A 2BCBA 1B8RA 3SIAA 1QLKA 1SL7A 2LP3A 3WHTB 1S6JA 3FS7A 1MF8B 2K61A 1PSBA 1KK8C 1IWQA 2G9BA 2L4HA 2LHLA 2BKIB 2ZFDA 4GUKA 4HSZA 3CZTX 4A4BA 1OMVA 1SL9A 4PCWA 1NX3A 1J7RA 1KQMB 3TUYB 1S26D 2AMIA 2OS8C 4IL1A 1JBAA 2BCXA 1ZOTB 1OZSA 1CFCA 1LA0A 1KSMA 1A29A 1OE9B 5K89A 1MQ1A 4JQ0D 2LLTA 1K9PA 4MZKA 2H61C 1BG1A 3D0YB 2RGIA 3O6BA 5AXIA 1ALVA 2ZN8A 4I5JA 1J1DA 1HT9A 1EJ3A 2JTZA 1JF2A 1K93D 1PULA 1WRLA 1RK9A 1YUSA 3EVRA 3H4SE 4YGEB 1WLZA 3LCPC 3TDZA 1BR4B 4XJKB 1SR6C 4C0KA 2OTGC 2JC2A 3AKAA 1B7TZ 4F0ZB 1NIWA 2KFFA 1FI5A 3AAJA 2BBMA 1QVIY 4PHNA 4NDCA 3EVVA 2KI6C 1SRAA 1U5IA 2QACA 3GK2A 1DJWA 1Q80A 1LINA 2MLEC 1SKTA 1J55A 1XK4A 1CLBA 4CFRA 2NCOA 2WCBA 2LAPA 1IJ6A 4OR9B 2OPOA 1J1EA 5I8NA 1YRTB 1SCMB 2BBNA 3O2PA 2LM5A 2LANA 1CMGA 1FW4A 1GGZA 1RECA 2F2OA 1TN4A 2M0RA 1M45A 2CT9A 1EG3A 1DGUA 4N1GA 3CLNA 3PALA 1A2XA 1UWOA 2MAZA 1FI6A 1KWOC 4QJ4B 5DKRA 2WCEA 2F8PA 4YGAA 1UHKA 4HREE 1DT7B 1DTLA 5AERA 2ZNEA 4MVFA 3WNXB 4MRYA 3O4YA 3ICBA 1KQVA 4YRUA 1B7TY 1NCYA 2R2IA 3NSKA 4AQJA 2G2BA 3D10A 3I5FC 3I5IB 5PALA 3TDUA 4PE7A 2L0PA 1W7IB 4ORAB 1L7ZA 5JJGA 1EL4A 2BCAA 1L2OC 2TN4A 2JPTA 4MZJA 2O5GA 1C07A 2L2EA 1IG5A 1CM1A 2E6WA 1TNPA 1XVJA 2PALA 1SYMA 2K7CA 2IS9A 2FOTA 2D8NA 5FYXA 1G4YR 2SCPA 4OKHA 1JF0A 2LC5A 4CPVA 2EHBA 2NCPA 3TS5C 1CFFA 3LL8B 3JVTC 2H2KA 3OB1B 2F2PA 3SG6A 1DJZA 1V1GA 2KI4B 3DF0B 1UHHA 1XFVO 2FCDA 1CLLA 2I94A 3OX6A 1QATA 2K7DA 1NX0A 1YX8A 2M7LA 1CNPA 1N0YA 3I5GC 2BL0B 1K94A 3KO0A 1NUBA 3JTDB 4CIDA 4R1EA 1QX5B 2LHIA 1KFUS 3NXAA 2KAVA 3PN7C 3A4UB 2HQWA 1WDCB 2WOSA 2L4IA 3IF7A 1KFXL 3NSLA 1F55A 1QX7A 2L5XB 4I5LB 1XA5A 4PHMA 1S6CA 1XK4C 2JXLA 1CKKA 1MXEA 1DMOA 2JULA 2LP2A 3AKBA 2M97A 5D7FA 1UHJA 1SCMC 4AQIA 2KAYA 2MA2A 4DRWA 1QLSA 4XYNA 1TNQA 2PVBA 2M29A 2LVKA 1GGWA 3SG2A 3BUOB 2EC6B 2JT0A 2KDHA 2Y5IA 3DVKA 1IJ5A 3IQOA 1J7QA 4E68A 1QS7A 3KHEA 3BYAA 1OMRA 3D0YA 2KOTA 2JT3A 2L50A 2M1UA 3EK8A 1SCVA 1TTXA 1A03A 1CLMA 2F33A 4NDBA 5HLOA 4XJKA 2KSPA 2ISDA 4N1FA 3PSRA 1PALA 4YI8A 2QPTA 2KFHA 2JQ6A 1ZUZA 1SMGA 2JT8A 2CTNA 1XYDA 4PE4A 4GBAA 4UPGA 1OMDA 1V1FA 1YRUB 1QJTA 1NWDA 4PE0A 2WNDA 3KPXA 2CNPA 3NSOA 4ZCVA 5HKWA 2PRUA 1LA3A 2JOJA 4WRIA 1SW8A 1QX2A 3WXAA 3OB2B 1NX2A 2L98A 4MSPA 5I2QA 1PVAA 3BUXB 1M31A 2AUCA 1PK0D 3KF9A 1B47A 1DJXA 2A4JA 3SIBA 3CGAA 2HF5A 1KK7Z 1BODA 4GGFA 2JNFA 1DF0A 3CR2A 1DF0B 3CS1A 5CSJA 1Y1UA 1WRZA 1AVSA 1GQMA 1TIZA 2FCEA 1IQ5A 3ZNIA 5B8IB 1YUUA 4WQ3A 4D1EA 3EK4A 2KHNA 4P2YB 4ZCUA 2KI4C 2PSRA 2MBXA 2P6BB 2LMUA 4TNCA 4I5KA 1H8BA 1BLQA 2I7AA 2NZ0A 1XFXO 1KK8B 1K9UA 4FQOA 5DKNA 1JC2A 1B9AA 2K7BA 4C0LA 2SASA 1JFKA 1SPYA 1HQVA 1AK8A 2MRDA 4OCIA 4PHKA 3ZWHA 2ZRSA 5I2OA 2LVVA 3BUWB 3CR4X 4DIRA 3LK0A 1IGVA 1F71A 1DJGA 4YGBB 2BE6A 3M0WA 3EVUA 2LVIA 1DGVA 2KGRA 4HRHA 1D1OA 1A4PA 5CSFA 1AJ5A 1SBJA 2JNXA 1K90D 3BXKA 3FWBA 3C1VA 3O78A 5ER5A 2KGBC 3SJSA 4NQGA 3CWGA 3OP0A 1TOPA 3KEVA 2HQ8A 1DVIA 5CSNA 1CMFA 1KK7Y 1SNLA 2FJUB 2OTGB 1CB1A 2GGMA 1DJHA 3BUNB 3SG4A 1G8IA 1NCXA 3DF0A 1ZACA 1KQMC 1EH2A 3CTNA 1PRWA 2LUXA 1XO5A 1C7WA 5G08A 3TUYC 1FF1A 1S36A 1F54A 1JWDA 5CSIA 2Y1MA 2WORA 3BUMB 1EXRA 1YVHA 1QASA 2JTTA 2KBIA 2Y4QA 1J7OA 2AAOA 4CFQA 5DKQA 5BPJA 4PE1A 2JU0A 2ZNDA 1XFUO 4YGCB 3I5HB 5J3XA 3RM1A 1IKUA 2KQ6A 2K2AA 3PFVA 4DCKA 1B4CA 3PM8A 1Y0VH 4M2QA 4M2OA 3TDIA 1QIWA 3DVJA 3SG5A 3LK1A 1M39A 4ORBB 1RROA 1PVBA 2PASA 1R2UA 2K7OA 1YTZC 3SG3A 1MHOA 1K96A 2NLNA 1M63B 1Y1XA 1KWOB 2BKHB 1NX1A 4Q04A 4YI9A 4A4CA 5KU1A 1AUIB 3HX4A 2F3YA 3WHUB 4C0JA 1RJVA 2JRFA 1WY9A 5KTYA 4GGNA 1C7VA 1K2HA 1BT6A 2HETA 2M3WA 3VROA 4NDDA 3GK1A 1VRKA 2DOQA 2I18A 1XFZO 4DUQA 1S3PA 2COLB 1DJYA 3I5FB 2MJWB 1BR1B 4MLWA 3VRNA 4GPLB 5D69A 4GGFC 5IBWA 1F4QA 4ETOA 1L2OB 4OV2A 1LKJA 3VGOA 4ORCB 1ODBA 1UUSA 5GQQC 1TCOB 1UHNA 2LMTA 2LUCA 1FBVA 2B1UA 1OQPA 2Q91A 3NSIA 1MR8A 1TNXA 1PSRA 2EGDA 2LCPA 1F4OA 4I5NB 1F70A 2KYFA 4BY5A 3K21A 3TS5B 1CM4A 2I2RE 4M2PA 2KI6D 3OHMB 1B8CA 1BF5A 4MEWA 3JVTB 1E8AA 1KFXS 1YURA 2M49B 4OVNF 2VRGA 3FWCA 4GFTA 2KAXA 2E30A 5ER4X 1YR5A 3I5IC 3DVMA 3VRPA 2JXCA 4FTGA 2LVJA 1F8HA 1Y1AA 4QJ5B 3PATA 2ZN9A 5AFPA 4GAOA 3VRRA 3I5GB 5TNCA 1JUOA 4U8DA 4QJ3B 1OOJA 1UHIA 1XFYO 1SY9A 2K8MB 1BU3A 1YUTA 1N65A 1K9KA 3PN7B 5HLVA 3RLZA 4WQ2A 2K0JA 1X02A 1WRKA 1MWNA 4HRGA 1S5GZ 3OX5A 2WCFA 3A8RA 2JZIA 3FIAA 1ZFSA 2CCMA 1U5IB 1AP4A 3DD4A 1IQ3A 2BECA 1K8UA 2LLSA 2LV7A 2LMVA 1W7JB 1QXPA 1NP8A 1CDPA 5AANA 3AAKA 4P5OE 4MRXA 2ZRTA 3I5HC 1TRFA 1BMOA 1CFPA 4PALA 2M9GA 2BL0C 1YX7A 2JWWA 4MN0A 2CBLA 1GJYA 1LXFC 2OS8B 2PMYA 3JTDC 3MSEB 5HYDA 1QV1A 2GV5A 2Y1NA 3EKHA 1FPWA 2NXQA 1DJIA 1H4BA 3GOFA 2H61A 5AEQA 3F45A 1IH0A 2MHHA 3HCMA 1WDCC 4GNKB 4L9MA 1AHRA 4JWQA 4JPZB 1JSAA 2MLFC 1M46A 1BOCA 2F3ZA 1SR6B 3BOWA 1RTP1 1Y6WA 3BOWB 1BJFA 2KBMA 1ALWA 1CDLA 4YGDB 1S5GY 4PHJA 3LLEA 2BE4A 1UP5A 2O60A
chains in the Genus database with same CATH superfamily
1XFWO 1OZOA 4ICBA 2EC6C 3RZSA 1QV0A 3QRXA 1LVCD 3E3RA 1KFUL 1NSHA 2LE9B 1OSAA 4AOMA 4JD9A 1NYAA 1SL8A 1NCZA 2LNKA 1R6PA 5HKZA 4DS7A 5KSZA 1CDNA 2KFGA 1S1EA 4N5XA 1RWYA 1KCYA 2QEHA 1P28A 1YVLA 2M8UA 4MBEA 1TCFA 3BQ3A 1AJ4A 1CTRA 4USLA 1S6IA 1SK6D 2WC8A 5I2LA 1JFJA 2V53A 2CXJA 3D74A 4PDZA 5JOLA 3CR5X 2ERBA 2GGZA 4MZLA 1IRJA 2PYQA 3IQQA 2M1KB 2Q4UA 1QIVA 3D77A 1MXLC 3PLFB 2K2FA 2L51A 2ZKMX 5CPVA 3SG7A 2KLEA 1ZMZA 1UURA 1CDMA 1KSOA 2WC6A 3EKJA 3VRQA 3GK4X 1B8LA 1NPQA 1OW4A 1RFJA 1TNWA 2KQYA 3DVEA 1J7PA 2KNEA 4CLNA 3Q8IA 1EG4A 4BY4A 1QTXA 4YBHB 5HKYA 1A75A 2M7NA 1A75B 1B1GA 3TZ1A 1MUXA 2HPSA 1N2DA 2KYCA 2LLUA 1K95A 1SSEB 3EK7A 1QVIZ 1CFDA 5F6TA 1WLMA 1G33A 2WCMA 2BCBA 1B8RA 2WCJA 3SIAA 1QLKA 1SL7A 2LP3A 3WHTB 1S6JA 3FS7A 1MF8B 2K61A 1C3YA 1PSBA 1KK8C 1IWQA 2G9BA 2L4HA 2LHLA 2BKIB 2ZFDA 4GUKA 4HSZA 3CZTX 4A4BA 2KLDA 3B7AA 1OMVA 1SL9A 4PCWA 3O4XA 1NX3A 1J7RA 1KQMB 3TUYB 1S26D 2AMIA 2OS8C 4IL1A 1JBAA 2BCXA 1ZOTB 1OZSA 1CFCA 1LA0A 1KSMA 1A29A 1OE9B 5K89A 1MQ1A 4JQ0D 2LLTA 1K9PA 4MZKA 1W9ZA 2H61C 1BG1A 3B88A 3D0YB 3SS5A 2RGIA 3O6BA 5AXIA 1ALVA 2ZN8A 4I5JA 1J1DA 1HT9A 1EJ3A 2JTZA 1JF2A 1K93D 1PULA 1YUSA 1RK9A 1WRLA 3EVRA 3H4SE 4YGEB 4INWA 1WLZA 3LCPC 3TDZA 1BR4B 4XJKB 1SR6C 4C0KA 2OTGC 2JC2A 3UNWA 2QEVA 3AKAA 1B7TZ 4F0ZB 1NIWA 2KFFA 3VB1A 1XFRA 1FI5A 3AAJA 2BBMA 1QVIY 4PHNA 4NDCA 2YGUA 3R1OA 3EVVA 2KI6C 1SRAA 1U5IA 2QACA 3GK2A 1DJWA 1Q80A 3PM2A 1LINA 2MLEC 1SKTA 1J55A 1XK4A 1CLBA 4CFRA 2NCOA 2WCBA 2LAPA 1IJ6A 4OR9B 2OPOA 1J1EA 5I8NA 3B86A 1YRTB 3CZ2A 1SCMB 2BBNA 3O2PA 2LM5A 2LANA 3BJHA 1CMGA 1FW4A 3D78A 1GGZA 1RECA 2F2OA 1TN4A 3B6XA 2M0RA 1M45A 2CT9A 1EG3A 1DGUA 4N1GA 3CLNA 3PALA 1A2XA 1UWOA 2MAZA 1FI6A 1KWOC 4QJ4B 5I2OA 5DKRA 2WCEA 2F8PA 2QEOA 4YGAA 1UHKA 4HREE 1DT7B 1DTLA 5AERA 2ZNEA 4MVFA 1OOIX 3WNXB 1TUJA 2BNXA 4MRYA 3O4YA 3ICBA 3DYEA 1KQVA 4YRUA 1B7TY 1NCYA 1QWVA 3DZTA 2R2IA 3NSKA 4AQJA 2G2BA 3D10A 3I5FC 3I5IB 3L4AA 5PALA 3TDUA 4PE7A 2L0PA 1W7IB 4ORAB 1L7ZA 5JJGA 1EL4A 2BCAA 2WCHA 1L2OC 1TWOA 2TN4A 2JPTA 4MZJA 2O5GA 1C07A 2L2EA 1IG5A 1CM1A 2E6WA 1TNPA 3NGVA 1XVJA 3BFBA 1ORGA 2PALA 1SYMA 2K7CA 2IS9A 2FOTA 2D8NA 5FYXA 1G4YR 1GM0A 2SCPA 4OKHA 1JF0A 2LC5A 4CPVA 2EHBA 2NCPA 3TS5C 1CFFA 3LL8B 3JVTC 2H2KA 3OB1B 2F2PA 3SG6A 1DJZA 1V1GA 2KI4B 3DF0B 1UHHA 1XFVO 2FCDA 1DEKA 1CLLA 2I94A 3OX6A 1QATA 2K7DA 1NX0A 1YX8A 2M7LA 1CNPA 1N0YA 3I5GC 2QEBA 2BL0B 1K94A 3KO0A 1NUBA 3CYZA 3JTDB 4CIDA 4R1EA 1QX5B 2LHIA 5D3OA 1KFUS 3NXAA 2KAVA 3PN7C 2FJYA 3A4UB 2HQWA 3R1VA 1WDCB 2WOSA 2L4IA 3IF7A 1KFXL 3NSLA 1F55A 4FQTA 1QX7A 2L5XB 1OOGA 1XA5A 4I5LB 1S6CA 1XK4C 2JXLA 4PHMA 1CKKA 1MXEA 1DMOA 2JULA 3UO9A 2LP2A 4F7FA 3AKBA 2M97A 5D7FA 1UHJA 1SCMC 4AQIA 2KAYA 2MA2A 4DRWA 1LS8A 1QLSA 4XYNA 1TNQA 2PVBA 2M29A 1TUZA 2LVKA 1GGWA 3SG2A 3BUOB 2EC6B 2JT0A 2KDHA 5FI2A 2Y5IA 3DVKA 1IJ5A 3IQOA 3R1PA 1J7QA 4E68A 1QS7A 3KHEA 3BYAA 1OMRA 3D0YA 2KOTA 2JT3A 2L50A 2M1UA 3EK8A 1SCVA 1TTXA 1A03A 1CLMA 2F33A 4INXA 4NDBA 3QMEA 5HLOA 2H8VA 4XJKA 1DELA 2KSPA 2ISDA 4N1FA 3PSRA 1PALA 4YI8A 2QPTA 2KFHA 2JQ6A 1ZUZA 1SMGA 2JT8A 2CTNA 1XYDA 4PE4A 4GBAA 4UPGA 1OMDA 1V1FA 1YRUB 3CABA 1QJTA 1NWDA 4PE0A 2WNDA 3KPXA 2CNPA 3NSOA 4ZCVA 5HKWA 2PRUA 1LA3A 2JOJA 4WRIA 1SW8A 1QX2A 3D76A 3OB2B 1NX2A 3WXAA 2L98A 1OOHA 4MSPA 5I2QA 3FE6A 1PVAA 3BUXB 1M31A 2AUCA 1PK0D 3KF9A 1B47A 1DJXA 2A4JA 3SIBA 3CGAA 2HF5A 1KK7Z 1BODA 4GGFA 2JNFA 1DF0A 3CR2A 1DF0B 3CS1A 5CSJA 1Y1UA 1WRZA 1AVSA 1GQMA 1TIZA 2FCEA 1IQ5A 3ZNIA 5B8IB 1YUUA 4WQ3A 4D1EA 2WCLA 3EK4A 2KHNA 4P2YB 4ZCUA 2KI4C 2PSRA 2BAPA 2MBXA 2P6BB 2LMUA 4TNCA 4I5KA 1H8BA 1BLQA 2I7AA 5FI7A 2NZ0A 1XFXO 1KK8B 1K9UA 4FQOA 5DKNA 1JC2A 1B9AA 2K7BA 4C0LA 2SASA 1JFKA 1SPYA 3S0AA 1HQVA 1AK8A 4JKTA 4KYNA 2MRDA 4OCIA 4PHKA 3ZWHA 2ZRSA 2K60A 2LVVA 3BUWB 3CR4X 4DIRA 3L4LA 3LK0A 1IGVA 1F71A 1DJGA 4YGBB 2BE6A 3M0WA 3EVUA 2LVIA 3OBVA 1DGVA 2KGRA 4HRHA 3S0EA 1D1OA 1A4PA 5CSFA 1AJ5A 1SBJA 2JNXA 1K90D 3BXKA 3FWBA 3C1VA 3O78A 5ER5A 2KGBC 3SJSA 4NQGA 3CWGA 3OP0A 1TOPA 4OZDA 5I94A 3KEVA 2HQ8A 1DVIA 3BFAA 3CZ1A 5CSNA 1CMFA 1KK7Y 1SNLA 2FJUB 2OTGB 2P70A 4IJ7A 1CB1A 2GGMA 1DJHA 3BUNB 3SG4A 1G8IA 1NCXA 3SS4A 3DF0A 1ZACA 1KQMC 1EH2A 3CTNA 1PRWA 2LUXA 1Z2CB 1C7WA 1XO5A 3EG5B 3PJIA 5G08A 3TUYC 1S36A 1F54A 1FF1A 1JWDA 5CSIA 2Y1MA 2WORA 3BUMB 1EXRA 1YVHA 1QASA 2JTTA 2KBIA 2Y4QA 1J7OA 2AAOA 4CFQA 5DKQA 5BPJA 4PE1A 2JU0A 2ZNDA 1XFUO 4YGCB 3I5HB 5J3XA 3RM1A 1IKUA 2KQ6A 2K2AA 3DXLA 2PQLA 3PFVA 4DCKA 1B4CA 3PM8A 1Y0VH 4M2QA 4M2OA 3TDIA 1QIWA 2JPOA 2P71A 3DVJA 1M39A 3LK1A 4ORBB 3SG5A 1RROA 1PVBA 2PASA 1R2UA 3NHTA 2K7OA 1YTZC 3SG3A 1MHOA 1K96A 2NLNA 1M63B 1Y1XA 3R72A 1KWOB 2BKHB 1NX1A 4Q04A 4YI9A 4A4CA 3CDNA 5KU1A 1AUIB 3HX4A 5HL1A 2F3YA 3WHUB 4C0JA 1RJVA 2JRFA 1IIOA 1WY9A 5KTYA 4GGNA 1C7VA 1K2HA 1BT6A 2HETA 2M3WA 2WC5A 3VROA 1DC1A 2QDIA 4NDDA 3GK1A 1VRKA 2DOQA 2I18A 3CZ0A 1XFZO 4DUQA 1S3PA 2COLB 1DJYA 3I5FB 2MJWB 1BR1B 4MLWA 3VRNA 3D73A 3D75A 4GPLB 5D69A 4GGFC 5IBWA 1F4QA 4ETOA 1L2OB 4OV2A 1LKJA 3VGOA 5DICA 4ORCB 1ODBA 1UUSA 5GQQC 1TCOB 1UHNA 2LMTA 2LUCA 1FBVA 2B1UA 1OQPA 2Q91A 3NSIA 1MR8A 1TNXA 1PSRA 2EGDA 2LCPA 1F4OA 4I5NB 1F70A 2KYFA 4BY5A 3K21A 3TS5B 1CM4A 2L2CA 3S0FA 2I2RE 4M2PA 2KI6D 3FE8A 1B8CA 3OHMB 4MEWA 1BF5A 3JVTB 1E8AA 1KFXS 1YURA 2M49B 4OVNF 2VRGA 3SS3A 3FWCA 4GFTA 2KAXA 2E30A 3V2LA 5ER4X 1YR5A 3I5IC 3DVMA 3VRPA 1T14A 2JXCA 4FTGA 2LVJA 1Z4HA 1F8HA 1Y1AA 4QJ5B 3PATA 2ZN9A 5AFPA 4GAOA 3VRRA 3I5GB 1DQEA 5TNCA 1JUOA 4U8DA 4QJ3B 1OOJA 1UHIA 1XFYO 1SY9A 2K8MB 1BU3A 5EL2A 1YUTA 3FE9A 1N65A 3DY9A 1K9KA 3PN7B 5FI6A 5HLVA 3RLZA 4WQ2A 2GTEA 2K0JA 1X02A 1WRKA 2KPHA 1MWNA 4HRGA 1S5GZ 3OX5A 2WCFA 3A8RA 2JZIA 3FIAA 1ZFSA 2CCMA 1U5IB 1AP4A 3DD4A 1IQ3A 2BECA 1K8UA 2L5YA 2LLSA 2LV7A 2LMVA 1W7JB 3NHIA 1QXPA 1NP8A 3N7HA 1CDPA 5AANA 3AAKA 4P5OE 4MRXA 2ZRTA 3OGNA 3I5HC 1TRFA 1BMOA 1CFPA 4PALA 3IVTA 2M9GA 2BL0C 1YX7A 2JWWA 3K1EA 4MN0A 3S0GA 1GJYA 1LXFC 2CBLA 2OS8B 2PMYA 3JTDC 3MSEB 5HYDA 1QV1A 2GV5A 2Y1NA 3EKHA 3L47A 2NXQA 1DJIA 4PT1A 3S0BA 1FPWA 1H4BA 3GOFA 2H61A 3S0DA 5AEQA 3F45A 1IH0A 2MHHA 3HCMA 1OOFA 1WDCC 4GNKB 4L9MA 1C3ZA 1AHRA 4JWQA 4JPZB 1JSAA 2MLFC 1M46A 3B87A 1BOCA 2F3ZA 1SR6B 3BOWA 1RTP1 1Y6WA 3BOWB 1BJFA 2KBMA 1ALWA 1CDLA 3BFHA 4YGDB 2WCKA 1S5GY 4PHJA 3LLEA 2BE4A 1UP5A 2O60A
chains in the Genus database with same CATH topology
1XFWO 1OZOA 4ICBA 2EC6C 1QV0A 3QRXA 1LVCD 3E3RA 1KFUL 1NSHA 2LE9B 1OSAA 4AOMA 1NYAA 1SL8A 1NCZA 2LNKA 1R6PA 5HKZA 4DS7A 5KSZA 1CDNA 2KFGA 1S1EA 4N5XA 1RWYA 1KCYA 1YVLA 2M8UA 4MBEA 1TCFA 3BQ3A 1AJ4A 1CTRA 4USLA 1S6IA 1SK6D 2WC8A 5I2LA 1JFJA 2V53A 2CXJA 4PDZA 5JOLA 3CR5X 2GGZA 4MZLA 1IRJA 3IQQA 2M1KB 2Q4UA 1QIVA 3PLFB 1MXLC 5CPVA 2K2FA 2L51A 2ZKMX 3SG7A 1ZMZA 1UURA 1CDMA 1KSOA 3EKJA 3VRQA 3GK4X 1B8LA 1NPQA 1RFJA 1TNWA 2KQYA 3DVEA 1J7PA 2KNEA 4CLNA 1EG4A 4BY4A 1QTXA 4YBHB 5HKYA 1A75A 2M7NA 1A75B 1B1GA 3TZ1A 1MUXA 2HPSA 1N2DA 2KYCA 2LLUA 1K95A 3EK7A 1QVIZ 1CFDA 5F6TA 1WLMA 1G33A 2BCBA 1B8RA 3SIAA 1QLKA 1SL7A 2LP3A 3WHTB 1S6JA 3FS7A 1MF8B 2K61A 1PSBA 1KK8C 1IWQA 2G9BA 2L4HA 2LHLA 2BKIB 2ZFDA 4GUKA 4HSZA 3CZTX 4A4BA 1OMVA 1SL9A 4PCWA 1NX3A 1J7RA 1KQMB 3TUYB 1S26D 2AMIA 2OS8C 4IL1A 1JBAA 2BCXA 1ZOTB 1OZSA 1CFCA 1LA0A 1KSMA 1A29A 1OE9B 5K89A 1MQ1A 4JQ0D 2LLTA 1K9PA 4MZKA 2H61C 1BG1A 3D0YB 2RGIA 3O6BA 5AXIA 1ALVA 2ZN8A 4I5JA 1J1DA 1HT9A 1EJ3A 2JTZA 1JF2A 1K93D 1PULA 1WRLA 1RK9A 1YUSA 3EVRA 3H4SE 4YGEB 1WLZA 3LCPC 3TDZA 1BR4B 4XJKB 1SR6C 4C0KA 2OTGC 2JC2A 3AKAA 1B7TZ 4F0ZB 1NIWA 2KFFA 1FI5A 3AAJA 2BBMA 1QVIY 4PHNA 4NDCA 3EVVA 2KI6C 1SRAA 1U5IA 2QACA 3GK2A 1DJWA 1Q80A 1LINA 2MLEC 1SKTA 1J55A 1XK4A 1CLBA 4CFRA 2NCOA 2WCBA 2LAPA 1IJ6A 4OR9B 2OPOA 1J1EA 5I8NA 1YRTB 1SCMB 2BBNA 3O2PA 2LM5A 2LANA 1CMGA 1FW4A 1GGZA 1RECA 2F2OA 1TN4A 2M0RA 1M45A 2CT9A 1EG3A 1DGUA 4N1GA 3CLNA 3PALA 1A2XA 1UWOA 2MAZA 1FI6A 1KWOC 4QJ4B 5DKRA 2WCEA 2F8PA 4YGAA 1UHKA 4HREE 1DT7B 1DTLA 5AERA 2ZNEA 4MVFA 3WNXB 4MRYA 3O4YA 3ICBA 1KQVA 4YRUA 1B7TY 1NCYA 2R2IA 3NSKA 4AQJA 2G2BA 3D10A 3I5FC 3I5IB 5PALA 3TDUA 4PE7A 2L0PA 1W7IB 4ORAB 1L7ZA 5JJGA 1EL4A 2BCAA 1L2OC 2TN4A 2JPTA 4MZJA 2O5GA 1C07A 2L2EA 1IG5A 1CM1A 2E6WA 1TNPA 1XVJA 2PALA 1SYMA 2K7CA 2IS9A 2FOTA 2D8NA 5FYXA 1G4YR 2SCPA 4OKHA 1JF0A 2LC5A 4CPVA 2EHBA 2NCPA 3TS5C 1CFFA 3LL8B 3JVTC 2H2KA 3OB1B 2F2PA 3SG6A 1DJZA 1V1GA 2KI4B 3DF0B 1UHHA 1XFVO 2FCDA 1CLLA 2I94A 3OX6A 1QATA 2K7DA 1NX0A 1YX8A 2M7LA 1CNPA 1N0YA 3I5GC 2BL0B 1K94A 3KO0A 1NUBA 3JTDB 4CIDA 4R1EA 1QX5B 2LHIA 1KFUS 3NXAA 2KAVA 3PN7C 3A4UB 2HQWA 1WDCB 2WOSA 2L4IA 3IF7A 1KFXL 3NSLA 1F55A 1QX7A 2L5XB 4I5LB 1XA5A 4PHMA 1S6CA 1XK4C 2JXLA 1CKKA 1MXEA 1DMOA 2JULA 2LP2A 3AKBA 2M97A 5D7FA 1UHJA 1SCMC 4AQIA 2KAYA 2MA2A 4DRWA 1QLSA 4XYNA 1TNQA 2PVBA 2M29A 2LVKA 1GGWA 3SG2A 3BUOB 2EC6B 2JT0A 2KDHA 2Y5IA 3DVKA 1IJ5A 3IQOA 1J7QA 4E68A 1QS7A 3KHEA 3BYAA 1OMRA 3D0YA 2KOTA 2JT3A 2L50A 2M1UA 3EK8A 1SCVA 1TTXA 1A03A 1CLMA 2F33A 4NDBA 5HLOA 4XJKA 2KSPA 2ISDA 4N1FA 3PSRA 1PALA 4YI8A 2QPTA 2KFHA 2JQ6A 1ZUZA 1SMGA 2JT8A 2CTNA 1XYDA 4PE4A 4GBAA 4UPGA 1OMDA 1V1FA 1YRUB 1QJTA 1NWDA 4PE0A 2WNDA 3KPXA 2CNPA 3NSOA 4ZCVA 5HKWA 2PRUA 1LA3A 2JOJA 4WRIA 1SW8A 1QX2A 3WXAA 3OB2B 1NX2A 2L98A 4MSPA 5I2QA 1PVAA 3BUXB 1M31A 2AUCA 1PK0D 3KF9A 1B47A 1DJXA 2A4JA 3SIBA 3CGAA 2HF5A 1KK7Z 1BODA 4GGFA 2JNFA 1DF0A 3CR2A 1DF0B 3CS1A 5CSJA 1Y1UA 1WRZA 1AVSA 1GQMA 1TIZA 2FCEA 1IQ5A 3ZNIA 5B8IB 1YUUA 4WQ3A 4D1EA 3EK4A 2KHNA 4P2YB 4ZCUA 2KI4C 2PSRA 2MBXA 2P6BB 2LMUA 4TNCA 4I5KA 1H8BA 1BLQA 2I7AA 2NZ0A 1XFXO 1KK8B 1K9UA 4FQOA 5DKNA 1JC2A 1B9AA 2K7BA 4C0LA 2SASA 1JFKA 1SPYA 1HQVA 1AK8A 2MRDA 4OCIA 4PHKA 3ZWHA 2ZRSA 5I2OA 2LVVA 3BUWB 3CR4X 4DIRA 3LK0A 1IGVA 1F71A 1DJGA 4YGBB 2BE6A 3M0WA 3EVUA 2LVIA 1DGVA 2KGRA 4HRHA 1D1OA 1A4PA 5CSFA 1AJ5A 1SBJA 2JNXA 1K90D 3BXKA 3FWBA 3C1VA 3O78A 5ER5A 2KGBC 3SJSA 4NQGA 3CWGA 3OP0A 1TOPA 3KEVA 2HQ8A 1DVIA 5CSNA 1CMFA 1KK7Y 1SNLA 2FJUB 2OTGB 1CB1A 2GGMA 1DJHA 3BUNB 3SG4A 1G8IA 1NCXA 3DF0A 1ZACA 1KQMC 1EH2A 3CTNA 1PRWA 2LUXA 1XO5A 1C7WA 5G08A 3TUYC 1FF1A 1S36A 1F54A 1JWDA 5CSIA 2Y1MA 2WORA 3BUMB 1EXRA 1YVHA 1QASA 2JTTA 2KBIA 2Y4QA 1J7OA 2AAOA 4CFQA 5DKQA 5BPJA 4PE1A 2JU0A 2ZNDA 1XFUO 4YGCB 3I5HB 5J3XA 3RM1A 1IKUA 2KQ6A 2K2AA 3PFVA 4DCKA 1B4CA 3PM8A 1Y0VH 4M2QA 4M2OA 3TDIA 1QIWA 3DVJA 3SG5A 3LK1A 1M39A 4ORBB 1RROA 1PVBA 2PASA 1R2UA 2K7OA 1YTZC 3SG3A 1MHOA 1K96A 2NLNA 1M63B 1Y1XA 1KWOB 2BKHB 1NX1A 4Q04A 4YI9A 4A4CA 5KU1A 1AUIB 3HX4A 2F3YA 3WHUB 4C0JA 1RJVA 2JRFA 1WY9A 5KTYA 4GGNA 1C7VA 1K2HA 1BT6A 2HETA 2M3WA 3VROA 4NDDA 3GK1A 1VRKA 2DOQA 2I18A 1XFZO 4DUQA 1S3PA 2COLB 1DJYA 3I5FB 2MJWB 1BR1B 4MLWA 3VRNA 4GPLB 5D69A 4GGFC 5IBWA 1F4QA 4ETOA 1L2OB 4OV2A 1LKJA 3VGOA 4ORCB 1ODBA 1UUSA 5GQQC 1TCOB 1UHNA 2LMTA 2LUCA 1FBVA 2B1UA 1OQPA 2Q91A 3NSIA 1MR8A 1TNXA 1PSRA 2EGDA 2LCPA 1F4OA 4I5NB 1F70A 2KYFA 4BY5A 3K21A 3TS5B 1CM4A 2I2RE 4M2PA 2KI6D 3OHMB 1B8CA 1BF5A 4MEWA 3JVTB 1E8AA 1KFXS 1YURA 2M49B 4OVNF 2VRGA 3FWCA 4GFTA 2KAXA 2E30A 5ER4X 1YR5A 3I5IC 3DVMA 3VRPA 2JXCA 4FTGA 2LVJA 1F8HA 1Y1AA 4QJ5B 3PATA 2ZN9A 5AFPA 4GAOA 3VRRA 3I5GB 5TNCA 1JUOA 4U8DA 4QJ3B 1OOJA 1UHIA 1XFYO 1SY9A 2K8MB 1BU3A 1YUTA 1N65A 1K9KA 3PN7B 5HLVA 3RLZA 4WQ2A 2K0JA 1X02A 1WRKA 1MWNA 4HRGA 1S5GZ 3OX5A 2WCFA 3A8RA 2JZIA 3FIAA 1ZFSA 2CCMA 1U5IB 1AP4A 3DD4A 1IQ3A 2BECA 1K8UA 2LLSA 2LV7A 2LMVA 1W7JB 1QXPA 1NP8A 1CDPA 5AANA 3AAKA 4P5OE 4MRXA 2ZRTA 3I5HC 1TRFA 1BMOA 1CFPA 4PALA 2M9GA 2BL0C 1YX7A 2JWWA 4MN0A 2CBLA 1GJYA 1LXFC 2OS8B 2PMYA 3JTDC 3MSEB 5HYDA 1QV1A 2GV5A 2Y1NA 3EKHA 1FPWA 2NXQA 1DJIA 1H4BA 3GOFA 2H61A 5AEQA 3F45A 1IH0A 2MHHA 3HCMA 1WDCC 4GNKB 4L9MA 1AHRA 4JWQA 4JPZB 1JSAA 2MLFC 1M46A 1BOCA 2F3ZA 1SR6B 3BOWA 1RTP1 1Y6WA 3BOWB 1BJFA 2KBMA 1ALWA 1CDLA 4YGDB 1S5GY 4PHJA 3LLEA 2BE4A 1UP5A 2O60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFW O;  1OZO A;  4ICB A;  2EC6 C;  1QV0 A;  3QRX A;  1LVC D;  3E3R A;  1KFU L;  1NSH A;  2LE9 B;  1OSA A;  4AOM A;  1NYA A;  1SL8 A;  1NCZ A;  2LNK A;  1R6P A;  5HKZ A;  4DS7 A;  5KSZ A;  1CDN A;  2KFG A;  1S1E A;  4N5X A;  1RWY A;  1KCY A;  1YVL A;  2M8U A;  4MBE A;  1TCF A;  3BQ3 A;  1AJ4 A;  1CTR A;  4USL A;  1S6I A;  1SK6 D;  2WC8 A;  5I2L A;  1JFJ A;  2V53 A;  2CXJ A;  4PDZ A;  5JOL A;  3CR5 X;  2GGZ A;  4MZL A;  1IRJ A;  3IQQ A;  2M1K B;  2Q4U A;  1QIV A;  3PLF B;  1MXL C;  5CPV A;  2K2F A;  2L51 A;  2ZKM X;  3SG7 A;  1ZMZ A;  1UUR A;  1CDM A;  1KSO A;  3EKJ A;  3VRQ A;  3GK4 X;  1B8L A;  1NPQ A;  1RFJ A;  1TNW A;  2KQY A;  3DVE A;  1J7P A;  2KNE A;  4CLN A;  1EG4 A;  4BY4 A;  1QTX A;  4YBH B;  5HKY A;  1A75 A;  2M7N A;  1A75 B;  1B1G A;  3TZ1 A;  1MUX A;  2HPS A;  1N2D A;  2KYC A;  2LLU A;  1K95 A;  3EK7 A;  1QVI Z;  1CFD A;  5F6T A;  1WLM A;  1G33 A;  2BCB A;  1B8R A;  3SIA A;  1QLK A;  1SL7 A;  2LP3 A;  3WHT B;  1S6J A;  3FS7 A;  1MF8 B;  2K61 A;  1PSB A;  1KK8 C;  1IWQ A;  2G9B A;  2L4H A;  2LHL A;  2BKI B;  2ZFD A;  4GUK A;  4HSZ A;  3CZT X;  4A4B A;  1OMV A;  1SL9 A;  4PCW A;  1NX3 A;  1J7R A;  1KQM B;  3TUY B;  1S26 D;  2AMI A;  2OS8 C;  4IL1 A;  1JBA A;  2BCX A;  1ZOT B;  1OZS A;  1CFC A;  1LA0 A;  1KSM A;  1A29 A;  1OE9 B;  5K89 A;  1MQ1 A;  4JQ0 D;  2LLT A;  1K9P A;  4MZK A;  2H61 C;  1BG1 A;  3D0Y B;  2RGI A;  3O6B A;  5AXI A;  1ALV A;  2ZN8 A;  4I5J A;  1J1D A;  1HT9 A;  1EJ3 A;  2JTZ A;  1JF2 A;  1K93 D;  1PUL A;  1WRL A;  1RK9 A;  1YUS A;  3EVR A;  3H4S E;  4YGE B;  1WLZ A;  3LCP C;  3TDZ A;  1BR4 B;  4XJK B;  1SR6 C;  4C0K A;  2OTG C;  2JC2 A;  3AKA A;  1B7T Z;  4F0Z B;  1NIW A;  2KFF A;  1FI5 A;  3AAJ A;  2BBM A;  1QVI Y;  4PHN A;  4NDC A;  3EVV A;  2KI6 C;  1SRA A;  1U5I A;  2QAC A;  3GK2 A;  1DJW A;  1Q80 A;  1LIN A;  2MLE C;  1SKT A;  1J55 A;  1XK4 A;  1CLB A;  4CFR A;  2NCO A;  2WCB A;  2LAP A;  1IJ6 A;  4OR9 B;  2OPO A;  1J1E A;  5I8N A;  1YRT B;  1SCM B;  2BBN A;  3O2P A;  2LM5 A;  2LAN A;  1CMG A;  1FW4 A;  1GGZ A;  1REC A;  2F2O A;  1TN4 A;  2M0R A;  1M45 A;  2CT9 A;  1EG3 A;  1DGU A;  4N1G A;  3CLN A;  3PAL A;  1A2X A;  1UWO A;  2MAZ A;  1FI6 A;  1KWO C;  4QJ4 B;  5DKR A;  2WCE A;  2F8P A;  4YGA A;  1UHK A;  4HRE E;  1DT7 B;  1DTL A;  5AER A;  2ZNE A;  4MVF A;  3WNX B;  4MRY A;  3O4Y A;  3ICB A;  1KQV A;  4YRU A;  1B7T Y;  1NCY A;  2R2I A;  3NSK A;  4AQJ A;  2G2B A;  3D10 A;  3I5F C;  3I5I B;  5PAL A;  3TDU A;  4PE7 A;  2L0P A;  1W7I B;  4ORA B;  1L7Z A;  5JJG A;  1EL4 A;  2BCA A;  1L2O C;  2TN4 A;  2JPT A;  4MZJ A;  2O5G A;  1C07 A;  2L2E A;  1IG5 A;  1CM1 A;  2E6W A;  1TNP A;  1XVJ A;  2PAL A;  1SYM A;  2K7C A;  2IS9 A;  2FOT A;  2D8N A;  5FYX A;  1G4Y R;  2SCP A;  4OKH A;  1JF0 A;  2LC5 A;  4CPV A;  2EHB A;  2NCP A;  3TS5 C;  1CFF A;  3LL8 B;  3JVT C;  2H2K A;  3OB1 B;  2F2P A;  3SG6 A;  1DJZ A;  1V1G A;  2KI4 B;  3DF0 B;  1UHH A;  1XFV O;  2FCD A;  1CLL A;  2I94 A;  3OX6 A;  1QAT A;  2K7D A;  1NX0 A;  1YX8 A;  2M7L A;  1CNP A;  1N0Y A;  3I5G C;  2BL0 B;  1K94 A;  3KO0 A;  1NUB A;  3JTD B;  4CID A;  4R1E A;  1QX5 B;  2LHI A;  1KFU S;  3NXA A;  2KAV A;  3PN7 C;  3A4U B;  2HQW A;  1WDC B;  2WOS A;  2L4I A;  3IF7 A;  1KFX L;  3NSL A;  1F55 A;  1QX7 A;  2L5X B;  4I5L B;  1XA5 A;  4PHM A;  1S6C A;  1XK4 C;  2JXL A;  1CKK A;  1MXE A;  1DMO A;  2JUL A;  2LP2 A;  3AKB A;  2M97 A;  5D7F A;  1UHJ A;  1SCM C;  4AQI A;  2KAY A;  2MA2 A;  4DRW A;  1QLS A;  4XYN A;  1TNQ A;  2PVB A;  2M29 A;  2LVK A;  1GGW A;  3SG2 A;  3BUO B;  2EC6 B;  2JT0 A;  2KDH A;  2Y5I A;  3DVK A;  1IJ5 A;  3IQO A;  1J7Q A;  4E68 A;  1QS7 A;  3KHE A;  3BYA A;  1OMR A;  3D0Y A;  2KOT A;  2JT3 A;  2L50 A;  2M1U A;  3EK8 A;  1SCV A;  1TTX A;  1A03 A;  1CLM A;  2F33 A;  4NDB A;  5HLO A;  4XJK A;  2KSP A;  2ISD A;  4N1F A;  3PSR A;  1PAL A;  4YI8 A;  2QPT A;  2KFH A;  2JQ6 A;  1ZUZ A;  1SMG A;  2JT8 A;  2CTN A;  1XYD A;  4PE4 A;  4GBA A;  4UPG A;  1OMD A;  1V1F A;  1YRU B;  1QJT A;  1NWD A;  4PE0 A;  2WND A;  3KPX A;  2CNP A;  3NSO A;  4ZCV A;  5HKW A;  2PRU A;  1LA3 A;  2JOJ A;  4WRI A;  1SW8 A;  1QX2 A;  3WXA A;  3OB2 B;  1NX2 A;  2L98 A;  4MSP A;  5I2Q A;  1PVA A;  3BUX B;  1M31 A;  2AUC A;  1PK0 D;  3KF9 A;  1B47 A;  1DJX A;  2A4J A;  3SIB A;  3CGA A;  2HF5 A;  1KK7 Z;  1BOD A;  4GGF A;  2JNF A;  1DF0 A;  3CR2 A;  1DF0 B;  3CS1 A;  5CSJ A;  1Y1U A;  1WRZ A;  1AVS A;  1GQM A;  1TIZ A;  2FCE A;  1IQ5 A;  3ZNI A;  5B8I B;  1YUU A;  4WQ3 A;  4D1E A;  3EK4 A;  2KHN A;  4P2Y B;  4ZCU A;  2KI4 C;  2PSR A;  2MBX A;  2P6B B;  2LMU A;  4TNC A;  4I5K A;  1H8B A;  1BLQ A;  2I7A A;  2NZ0 A;  1XFX O;  1KK8 B;  1K9U A;  4FQO A;  5DKN A;  1JC2 A;  1B9A A;  2K7B A;  4C0L A;  2SAS A;  1JFK A;  1SPY A;  1HQV A;  1AK8 A;  2MRD A;  4OCI A;  4PHK A;  3ZWH A;  2ZRS A;  5I2O A;  2LVV A;  3BUW B;  3CR4 X;  4DIR A;  3LK0 A;  1IGV A;  1F71 A;  1DJG A;  4YGB B;  2BE6 A;  3M0W A;  3EVU A;  2LVI A;  1DGV A;  2KGR A;  4HRH A;  1D1O A;  1A4P A;  5CSF A;  1AJ5 A;  1SBJ A;  2JNX A;  1K90 D;  3BXK A;  3FWB A;  3C1V A;  3O78 A;  5ER5 A;  2KGB C;  3SJS A;  4NQG A;  3CWG A;  3OP0 A;  1TOP A;  3KEV A;  2HQ8 A;  1DVI A;  5CSN A;  1CMF A;  1KK7 Y;  1SNL A;  2FJU B;  2OTG B;  1CB1 A;  2GGM A;  1DJH A;  3BUN B;  3SG4 A;  1G8I A;  1NCX A;  3DF0 A;  1ZAC A;  1KQM C;  1EH2 A;  3CTN A;  1PRW A;  2LUX A;  1XO5 A;  1C7W A;  5G08 A;  3TUY C;  1FF1 A;  1S36 A;  1F54 A;  1JWD A;  5CSI A;  2Y1M A;  2WOR A;  3BUM B;  1EXR A;  1YVH A;  1QAS A;  2JTT A;  2KBI A;  2Y4Q A;  1J7O A;  2AAO A;  4CFQ A;  5DKQ A;  5BPJ A;  4PE1 A;  2JU0 A;  2ZND A;  1XFU O;  4YGC B;  3I5H B;  5J3X A;  3RM1 A;  1IKU A;  2KQ6 A;  2K2A A;  3PFV A;  4DCK A;  1B4C A;  3PM8 A;  1Y0V H;  4M2Q A;  4M2O A;  3TDI A;  1QIW A;  3DVJ A;  3SG5 A;  3LK1 A;  1M39 A;  4ORB B;  1RRO A;  1PVB A;  2PAS A;  1R2U A;  2K7O A;  1YTZ C;  3SG3 A;  1MHO A;  1K96 A;  2NLN A;  1M63 B;  1Y1X A;  1KWO B;  2BKH B;  1NX1 A;  4Q04 A;  4YI9 A;  4A4C A;  5KU1 A;  1AUI B;  3HX4 A;  2F3Y A;  3WHU B;  4C0J A;  1RJV A;  2JRF A;  1WY9 A;  5KTY A;  4GGN A;  1C7V A;  1K2H A;  1BT6 A;  2HET A;  2M3W A;  3VRO A;  4NDD A;  3GK1 A;  1VRK A;  2DOQ A;  2I18 A;  1XFZ O;  4DUQ A;  1S3P A;  2COL B;  1DJY A;  3I5F B;  2MJW B;  1BR1 B;  4MLW A;  3VRN A;  4GPL B;  5D69 A;  4GGF C;  5IBW A;  1F4Q A;  4ETO A;  1L2O B;  4OV2 A;  1LKJ A;  3VGO A;  4ORC B;  1ODB A;  1UUS A;  5GQQ C;  1TCO B;  1UHN A;  2LMT A;  2LUC A;  1FBV A;  2B1U A;  1OQP A;  2Q91 A;  3NSI A;  1MR8 A;  1TNX A;  1PSR A;  2EGD A;  2LCP A;  1F4O A;  4I5N B;  1F70 A;  2KYF A;  4BY5 A;  3K21 A;  3TS5 B;  1CM4 A;  2I2R E;  4M2P A;  2KI6 D;  3OHM B;  1B8C A;  1BF5 A;  4MEW A;  3JVT B;  1E8A A;  1KFX S;  1YUR A;  2M49 B;  4OVN F;  2VRG A;  3FWC A;  4GFT A;  2KAX A;  2E30 A;  5ER4 X;  1YR5 A;  3I5I C;  3DVM A;  3VRP A;  2JXC A;  4FTG A;  2LVJ A;  1F8H A;  1Y1A A;  4QJ5 B;  3PAT A;  2ZN9 A;  5AFP A;  4GAO A;  3VRR A;  3I5G B;  5TNC A;  1JUO A;  4U8D A;  4QJ3 B;  1OOJ A;  1UHI A;  1XFY O;  1SY9 A;  2K8M B;  1BU3 A;  1YUT A;  1N65 A;  1K9K A;  3PN7 B;  5HLV A;  3RLZ A;  4WQ2 A;  2K0J A;  1X02 A;  1WRK A;  1MWN A;  4HRG A;  1S5G Z;  3OX5 A;  2WCF A;  3A8R A;  2JZI A;  3FIA A;  1ZFS A;  2CCM A;  1U5I B;  1AP4 A;  3DD4 A;  1IQ3 A;  2BEC A;  1K8U A;  2LLS A;  2LV7 A;  2LMV A;  1W7J B;  1QXP A;  1NP8 A;  1CDP A;  5AAN A;  3AAK A;  4P5O E;  4MRX A;  2ZRT A;  3I5H C;  1TRF A;  1BMO A;  1CFP A;  4PAL A;  2M9G A;  2BL0 C;  1YX7 A;  2JWW A;  4MN0 A;  2CBL A;  1GJY A;  1LXF C;  2OS8 B;  2PMY A;  3JTD C;  3MSE B;  5HYD A;  1QV1 A;  2GV5 A;  2Y1N A;  3EKH A;  1FPW A;  2NXQ A;  1DJI A;  1H4B A;  3GOF A;  2H61 A;  5AEQ A;  3F45 A;  1IH0 A;  2MHH A;  3HCM A;  1WDC C;  4GNK B;  4L9M A;  1AHR A;  4JWQ A;  4JPZ B;  1JSA A;  2MLF C;  1M46 A;  1BOC A;  2F3Z A;  1SR6 B;  3BOW A;  1RTP 1;  1Y6W A;  3BOW B;  1BJF A;  2KBM A;  1ALW A;  1CDL A;  4YGD B;  1S5G Y;  4PHJ A;  3LLE A;  2BE4 A;  1UP5 A;  2O60 A; 
#chains in the Genus database with same CATH topology
 1XFW O;  1OZO A;  4ICB A;  2EC6 C;  3RZS A;  1QV0 A;  3QRX A;  1LVC D;  3E3R A;  1KFU L;  1NSH A;  2LE9 B;  1OSA A;  4AOM A;  4JD9 A;  1NYA A;  1SL8 A;  1NCZ A;  2LNK A;  1R6P A;  5HKZ A;  4DS7 A;  5KSZ A;  1CDN A;  2KFG A;  1S1E A;  4N5X A;  1RWY A;  1KCY A;  2QEH A;  1P28 A;  1YVL A;  2M8U A;  4MBE A;  1TCF A;  3BQ3 A;  1AJ4 A;  1CTR A;  4USL A;  1S6I A;  1SK6 D;  2WC8 A;  5I2L A;  1JFJ A;  2V53 A;  2CXJ A;  3D74 A;  4PDZ A;  5JOL A;  3CR5 X;  2ERB A;  2GGZ A;  4MZL A;  1IRJ A;  2PYQ A;  3IQQ A;  2M1K B;  2Q4U A;  1QIV A;  3D77 A;  1MXL C;  3PLF B;  2K2F A;  2L51 A;  2ZKM X;  5CPV A;  3SG7 A;  2KLE A;  1ZMZ A;  1UUR A;  1CDM A;  1KSO A;  2WC6 A;  3EKJ A;  3VRQ A;  3GK4 X;  1B8L A;  1NPQ A;  1OW4 A;  1RFJ A;  1TNW A;  2KQY A;  3DVE A;  1J7P A;  2KNE A;  4CLN A;  3Q8I A;  1EG4 A;  4BY4 A;  1QTX A;  4YBH B;  5HKY A;  1A75 A;  2M7N A;  1A75 B;  1B1G A;  3TZ1 A;  1MUX A;  2HPS A;  1N2D A;  2KYC A;  2LLU A;  1K95 A;  1SSE B;  3EK7 A;  1QVI Z;  1CFD A;  5F6T A;  1WLM A;  1G33 A;  2WCM A;  2BCB A;  1B8R A;  2WCJ A;  3SIA A;  1QLK A;  1SL7 A;  2LP3 A;  3WHT B;  1S6J A;  3FS7 A;  1MF8 B;  2K61 A;  1C3Y A;  1PSB A;  1KK8 C;  1IWQ A;  2G9B A;  2L4H A;  2LHL A;  2BKI B;  2ZFD A;  4GUK A;  4HSZ A;  3CZT X;  4A4B A;  2KLD A;  3B7A A;  1OMV A;  1SL9 A;  4PCW A;  3O4X A;  1NX3 A;  1J7R A;  1KQM B;  3TUY B;  1S26 D;  2AMI A;  2OS8 C;  4IL1 A;  1JBA A;  2BCX A;  1ZOT B;  1OZS A;  1CFC A;  1LA0 A;  1KSM A;  1A29 A;  1OE9 B;  5K89 A;  1MQ1 A;  4JQ0 D;  2LLT A;  1K9P A;  4MZK A;  1W9Z A;  2H61 C;  1BG1 A;  3B88 A;  3D0Y B;  3SS5 A;  2RGI A;  3O6B A;  5AXI A;  1ALV A;  2ZN8 A;  4I5J A;  1J1D A;  1HT9 A;  1EJ3 A;  2JTZ A;  1JF2 A;  1K93 D;  1PUL A;  1YUS A;  1RK9 A;  1WRL A;  3EVR A;  3H4S E;  4YGE B;  4INW A;  1WLZ A;  3LCP C;  3TDZ A;  1BR4 B;  4XJK B;  1SR6 C;  4C0K A;  2OTG C;  2JC2 A;  3UNW A;  2QEV A;  3AKA A;  1B7T Z;  4F0Z B;  1NIW A;  2KFF A;  3VB1 A;  1XFR A;  1FI5 A;  3AAJ A;  2BBM A;  1QVI Y;  4PHN A;  4NDC A;  2YGU A;  3R1O A;  3EVV A;  2KI6 C;  1SRA A;  1U5I A;  2QAC A;  3GK2 A;  1DJW A;  1Q80 A;  3PM2 A;  1LIN A;  2MLE C;  1SKT A;  1J55 A;  1XK4 A;  1CLB A;  4CFR A;  2NCO A;  2WCB A;  2LAP A;  1IJ6 A;  4OR9 B;  2OPO A;  1J1E A;  5I8N A;  3B86 A;  1YRT B;  3CZ2 A;  1SCM B;  2BBN A;  3O2P A;  2LM5 A;  2LAN A;  3BJH A;  1CMG A;  1FW4 A;  3D78 A;  1GGZ A;  1REC A;  2F2O A;  1TN4 A;  3B6X A;  2M0R A;  1M45 A;  2CT9 A;  1EG3 A;  1DGU A;  4N1G A;  3CLN A;  3PAL A;  1A2X A;  1UWO A;  2MAZ A;  1FI6 A;  1KWO C;  4QJ4 B;  5I2O A;  5DKR A;  2WCE A;  2F8P A;  2QEO A;  4YGA A;  1UHK A;  4HRE E;  1DT7 B;  1DTL A;  5AER A;  2ZNE A;  4MVF A;  1OOI X;  3WNX B;  1TUJ A;  2BNX A;  4MRY A;  3O4Y A;  3ICB A;  3DYE A;  1KQV A;  4YRU A;  1B7T Y;  1NCY A;  1QWV A;  3DZT A;  2R2I A;  3NSK A;  4AQJ A;  2G2B A;  3D10 A;  3I5F C;  3I5I B;  3L4A A;  5PAL A;  3TDU A;  4PE7 A;  2L0P A;  1W7I B;  4ORA B;  1L7Z A;  5JJG A;  1EL4 A;  2BCA A;  2WCH A;  1L2O C;  1TWO A;  2TN4 A;  2JPT A;  4MZJ A;  2O5G A;  1C07 A;  2L2E A;  1IG5 A;  1CM1 A;  2E6W A;  1TNP A;  3NGV A;  1XVJ A;  3BFB A;  1ORG A;  2PAL A;  1SYM A;  2K7C A;  2IS9 A;  2FOT A;  2D8N A;  5FYX A;  1G4Y R;  1GM0 A;  2SCP A;  4OKH A;  1JF0 A;  2LC5 A;  4CPV A;  2EHB A;  2NCP A;  3TS5 C;  1CFF A;  3LL8 B;  3JVT C;  2H2K A;  3OB1 B;  2F2P A;  3SG6 A;  1DJZ A;  1V1G A;  2KI4 B;  3DF0 B;  1UHH A;  1XFV O;  2FCD A;  1DEK A;  1CLL A;  2I94 A;  3OX6 A;  1QAT A;  2K7D A;  1NX0 A;  1YX8 A;  2M7L A;  1CNP A;  1N0Y A;  3I5G C;  2QEB A;  2BL0 B;  1K94 A;  3KO0 A;  1NUB A;  3CYZ A;  3JTD B;  4CID A;  4R1E A;  1QX5 B;  2LHI A;  5D3O A;  1KFU S;  3NXA A;  2KAV A;  3PN7 C;  2FJY A;  3A4U B;  2HQW A;  3R1V A;  1WDC B;  2WOS A;  2L4I A;  3IF7 A;  1KFX L;  3NSL A;  1F55 A;  4FQT A;  1QX7 A;  2L5X B;  1OOG A;  1XA5 A;  4I5L B;  1S6C A;  1XK4 C;  2JXL A;  4PHM A;  1CKK A;  1MXE A;  1DMO A;  2JUL A;  3UO9 A;  2LP2 A;  4F7F A;  3AKB A;  2M97 A;  5D7F A;  1UHJ A;  1SCM C;  4AQI A;  2KAY A;  2MA2 A;  4DRW A;  1LS8 A;  1QLS A;  4XYN A;  1TNQ A;  2PVB A;  2M29 A;  1TUZ A;  2LVK A;  1GGW A;  3SG2 A;  3BUO B;  2EC6 B;  2JT0 A;  2KDH A;  5FI2 A;  2Y5I A;  3DVK A;  1IJ5 A;  3IQO A;  3R1P A;  1J7Q A;  4E68 A;  1QS7 A;  3KHE A;  3BYA A;  1OMR A;  3D0Y A;  2KOT A;  2JT3 A;  2L50 A;  2M1U A;  3EK8 A;  1SCV A;  1TTX A;  1A03 A;  1CLM A;  2F33 A;  4INX A;  4NDB A;  3QME A;  5HLO A;  2H8V A;  4XJK A;  1DEL A;  2KSP A;  2ISD A;  4N1F A;  3PSR A;  1PAL A;  4YI8 A;  2QPT A;  2KFH A;  2JQ6 A;  1ZUZ A;  1SMG A;  2JT8 A;  2CTN A;  1XYD A;  4PE4 A;  4GBA A;  4UPG A;  1OMD A;  1V1F A;  1YRU B;  3CAB A;  1QJT A;  1NWD A;  4PE0 A;  2WND A;  3KPX A;  2CNP A;  3NSO A;  4ZCV A;  5HKW A;  2PRU A;  1LA3 A;  2JOJ A;  4WRI A;  1SW8 A;  1QX2 A;  3D76 A;  3OB2 B;  1NX2 A;  3WXA A;  2L98 A;  1OOH A;  4MSP A;  5I2Q A;  3FE6 A;  1PVA A;  3BUX B;  1M31 A;  2AUC A;  1PK0 D;  3KF9 A;  1B47 A;  1DJX A;  2A4J A;  3SIB A;  3CGA A;  2HF5 A;  1KK7 Z;  1BOD A;  4GGF A;  2JNF A;  1DF0 A;  3CR2 A;  1DF0 B;  3CS1 A;  5CSJ A;  1Y1U A;  1WRZ A;  1AVS A;  1GQM A;  1TIZ A;  2FCE A;  1IQ5 A;  3ZNI A;  5B8I B;  1YUU A;  4WQ3 A;  4D1E A;  2WCL A;  3EK4 A;  2KHN A;  4P2Y B;  4ZCU A;  2KI4 C;  2PSR A;  2BAP A;  2MBX A;  2P6B B;  2LMU A;  4TNC A;  4I5K A;  1H8B A;  1BLQ A;  2I7A A;  5FI7 A;  2NZ0 A;  1XFX O;  1KK8 B;  1K9U A;  4FQO A;  5DKN A;  1JC2 A;  1B9A A;  2K7B A;  4C0L A;  2SAS A;  1JFK A;  1SPY A;  3S0A A;  1HQV A;  1AK8 A;  4JKT A;  4KYN A;  2MRD A;  4OCI A;  4PHK A;  3ZWH A;  2ZRS A;  2K60 A;  2LVV A;  3BUW B;  3CR4 X;  4DIR A;  3L4L A;  3LK0 A;  1IGV A;  1F71 A;  1DJG A;  4YGB B;  2BE6 A;  3M0W A;  3EVU A;  2LVI A;  3OBV A;  1DGV A;  2KGR A;  4HRH A;  3S0E A;  1D1O A;  1A4P A;  5CSF A;  1AJ5 A;  1SBJ A;  2JNX A;  1K90 D;  3BXK A;  3FWB A;  3C1V A;  3O78 A;  5ER5 A;  2KGB C;  3SJS A;  4NQG A;  3CWG A;  3OP0 A;  1TOP A;  4OZD A;  5I94 A;  3KEV A;  2HQ8 A;  1DVI A;  3BFA A;  3CZ1 A;  5CSN A;  1CMF A;  1KK7 Y;  1SNL A;  2FJU B;  2OTG B;  2P70 A;  4IJ7 A;  1CB1 A;  2GGM A;  1DJH A;  3BUN B;  3SG4 A;  1G8I A;  1NCX A;  3SS4 A;  3DF0 A;  1ZAC A;  1KQM C;  1EH2 A;  3CTN A;  1PRW A;  2LUX A;  1Z2C B;  1C7W A;  1XO5 A;  3EG5 B;  3PJI A;  5G08 A;  3TUY C;  1S36 A;  1F54 A;  1FF1 A;  1JWD A;  5CSI A;  2Y1M A;  2WOR A;  3BUM B;  1EXR A;  1YVH A;  1QAS A;  2JTT A;  2KBI A;  2Y4Q A;  1J7O A;  2AAO A;  4CFQ A;  5DKQ A;  5BPJ A;  4PE1 A;  2JU0 A;  2ZND A;  1XFU O;  4YGC B;  3I5H B;  5J3X A;  3RM1 A;  1IKU A;  2KQ6 A;  2K2A A;  3DXL A;  2PQL A;  3PFV A;  4DCK A;  1B4C A;  3PM8 A;  1Y0V H;  4M2Q A;  4M2O A;  3TDI A;  1QIW A;  2JPO A;  2P71 A;  3DVJ A;  1M39 A;  3LK1 A;  4ORB B;  3SG5 A;  1RRO A;  1PVB A;  2PAS A;  1R2U A;  3NHT A;  2K7O A;  1YTZ C;  3SG3 A;  1MHO A;  1K96 A;  2NLN A;  1M63 B;  1Y1X A;  3R72 A;  1KWO B;  2BKH B;  1NX1 A;  4Q04 A;  4YI9 A;  4A4C A;  3CDN A;  5KU1 A;  1AUI B;  3HX4 A;  5HL1 A;  2F3Y A;  3WHU B;  4C0J A;  1RJV A;  2JRF A;  1IIO A;  1WY9 A;  5KTY A;  4GGN A;  1C7V A;  1K2H A;  1BT6 A;  2HET A;  2M3W A;  2WC5 A;  3VRO A;  1DC1 A;  2QDI A;  4NDD A;  3GK1 A;  1VRK A;  2DOQ A;  2I18 A;  3CZ0 A;  1XFZ O;  4DUQ A;  1S3P A;  2COL B;  1DJY A;  3I5F B;  2MJW B;  1BR1 B;  4MLW A;  3VRN A;  3D73 A;  3D75 A;  4GPL B;  5D69 A;  4GGF C;  5IBW A;  1F4Q A;  4ETO A;  1L2O B;  4OV2 A;  1LKJ A;  3VGO A;  5DIC A;  4ORC B;  1ODB A;  1UUS A;  5GQQ C;  1TCO B;  1UHN A;  2LMT A;  2LUC A;  1FBV A;  2B1U A;  1OQP A;  2Q91 A;  3NSI A;  1MR8 A;  1TNX A;  1PSR A;  2EGD A;  2LCP A;  1F4O A;  4I5N B;  1F70 A;  2KYF A;  4BY5 A;  3K21 A;  3TS5 B;  1CM4 A;  2L2C A;  3S0F A;  2I2R E;  4M2P A;  2KI6 D;  3FE8 A;  1B8C A;  3OHM B;  4MEW A;  1BF5 A;  3JVT B;  1E8A A;  1KFX S;  1YUR A;  2M49 B;  4OVN F;  2VRG A;  3SS3 A;  3FWC A;  4GFT A;  2KAX A;  2E30 A;  3V2L A;  5ER4 X;  1YR5 A;  3I5I C;  3DVM A;  3VRP A;  1T14 A;  2JXC A;  4FTG A;  2LVJ A;  1Z4H A;  1F8H A;  1Y1A A;  4QJ5 B;  3PAT A;  2ZN9 A;  5AFP A;  4GAO A;  3VRR A;  3I5G B;  1DQE A;  5TNC A;  1JUO A;  4U8D A;  4QJ3 B;  1OOJ A;  1UHI A;  1XFY O;  1SY9 A;  2K8M B;  1BU3 A;  5EL2 A;  1YUT A;  3FE9 A;  1N65 A;  3DY9 A;  1K9K A;  3PN7 B;  5FI6 A;  5HLV A;  3RLZ A;  4WQ2 A;  2GTE A;  2K0J A;  1X02 A;  1WRK A;  2KPH A;  1MWN A;  4HRG A;  1S5G Z;  3OX5 A;  2WCF A;  3A8R A;  2JZI A;  3FIA A;  1ZFS A;  2CCM A;  1U5I B;  1AP4 A;  3DD4 A;  1IQ3 A;  2BEC A;  1K8U A;  2L5Y A;  2LLS A;  2LV7 A;  2LMV A;  1W7J B;  3NHI A;  1QXP A;  1NP8 A;  3N7H A;  1CDP A;  5AAN A;  3AAK A;  4P5O E;  4MRX A;  2ZRT A;  3OGN A;  3I5H C;  1TRF A;  1BMO A;  1CFP A;  4PAL A;  3IVT A;  2M9G A;  2BL0 C;  1YX7 A;  2JWW A;  3K1E A;  4MN0 A;  3S0G A;  1GJY A;  1LXF C;  2CBL A;  2OS8 B;  2PMY A;  3JTD C;  3MSE B;  5HYD A;  1QV1 A;  2GV5 A;  2Y1N A;  3EKH A;  3L47 A;  2NXQ A;  1DJI A;  4PT1 A;  3S0B A;  1FPW A;  1H4B A;  3GOF A;  2H61 A;  3S0D A;  5AEQ A;  3F45 A;  1IH0 A;  2MHH A;  3HCM A;  1OOF A;  1WDC C;  4GNK B;  4L9M A;  1C3Z A;  1AHR A;  4JWQ A;  4JPZ B;  1JSA A;  2MLF C;  1M46 A;  3B87 A;  1BOC A;  2F3Z A;  1SR6 B;  3BOW A;  1RTP 1;  1Y6W A;  3BOW B;  1BJF A;  2KBM A;  1ALW A;  1CDL A;  3BFH A;  4YGD B;  2WCK A;  1S5G Y;  4PHJ A;  3LLE A;  2BE4 A;  1UP5 A;  2O60 A; 
#chains in the Genus database with same CATH homology
 1XFW O;  1OZO A;  4ICB A;  2EC6 C;  1QV0 A;  3QRX A;  1LVC D;  3E3R A;  1KFU L;  1NSH A;  2LE9 B;  1OSA A;  4AOM A;  1NYA A;  1SL8 A;  1NCZ A;  2LNK A;  1R6P A;  5HKZ A;  4DS7 A;  5KSZ A;  1CDN A;  2KFG A;  1S1E A;  4N5X A;  1RWY A;  1KCY A;  1YVL A;  2M8U A;  4MBE A;  1TCF A;  3BQ3 A;  1AJ4 A;  1CTR A;  4USL A;  1S6I A;  1SK6 D;  2WC8 A;  5I2L A;  1JFJ A;  2V53 A;  2CXJ A;  4PDZ A;  5JOL A;  3CR5 X;  2GGZ A;  4MZL A;  1IRJ A;  3IQQ A;  2M1K B;  2Q4U A;  1QIV A;  3PLF B;  1MXL C;  5CPV A;  2K2F A;  2L51 A;  2ZKM X;  3SG7 A;  1ZMZ A;  1UUR A;  1CDM A;  1KSO A;  3EKJ A;  3VRQ A;  3GK4 X;  1B8L A;  1NPQ A;  1RFJ A;  1TNW A;  2KQY A;  3DVE A;  1J7P A;  2KNE A;  4CLN A;  1EG4 A;  4BY4 A;  1QTX A;  4YBH B;  5HKY A;  1A75 A;  2M7N A;  1A75 B;  1B1G A;  3TZ1 A;  1MUX A;  2HPS A;  1N2D A;  2KYC A;  2LLU A;  1K95 A;  3EK7 A;  1QVI Z;  1CFD A;  5F6T A;  1WLM A;  1G33 A;  2BCB A;  1B8R A;  3SIA A;  1QLK A;  1SL7 A;  2LP3 A;  3WHT B;  1S6J A;  3FS7 A;  1MF8 B;  2K61 A;  1PSB A;  1KK8 C;  1IWQ A;  2G9B A;  2L4H A;  2LHL A;  2BKI B;  2ZFD A;  4GUK A;  4HSZ A;  3CZT X;  4A4B A;  1OMV A;  1SL9 A;  4PCW A;  1NX3 A;  1J7R A;  1KQM B;  3TUY B;  1S26 D;  2AMI A;  2OS8 C;  4IL1 A;  1JBA A;  2BCX A;  1ZOT B;  1OZS A;  1CFC A;  1LA0 A;  1KSM A;  1A29 A;  1OE9 B;  5K89 A;  1MQ1 A;  4JQ0 D;  2LLT A;  1K9P A;  4MZK A;  2H61 C;  1BG1 A;  3D0Y B;  2RGI A;  3O6B A;  5AXI A;  1ALV A;  2ZN8 A;  4I5J A;  1J1D A;  1HT9 A;  1EJ3 A;  2JTZ A;  1JF2 A;  1K93 D;  1PUL A;  1WRL A;  1RK9 A;  1YUS A;  3EVR A;  3H4S E;  4YGE B;  1WLZ A;  3LCP C;  3TDZ A;  1BR4 B;  4XJK B;  1SR6 C;  4C0K A;  2OTG C;  2JC2 A;  3AKA A;  1B7T Z;  4F0Z B;  1NIW A;  2KFF A;  1FI5 A;  3AAJ A;  2BBM A;  1QVI Y;  4PHN A;  4NDC A;  3EVV A;  2KI6 C;  1SRA A;  1U5I A;  2QAC A;  3GK2 A;  1DJW A;  1Q80 A;  1LIN A;  2MLE C;  1SKT A;  1J55 A;  1XK4 A;  1CLB A;  4CFR A;  2NCO A;  2WCB A;  2LAP A;  1IJ6 A;  4OR9 B;  2OPO A;  1J1E A;  5I8N A;  1YRT B;  1SCM B;  2BBN A;  3O2P A;  2LM5 A;  2LAN A;  1CMG A;  1FW4 A;  1GGZ A;  1REC A;  2F2O A;  1TN4 A;  2M0R A;  1M45 A;  2CT9 A;  1EG3 A;  1DGU A;  4N1G A;  3CLN A;  3PAL A;  1A2X A;  1UWO A;  2MAZ A;  1FI6 A;  1KWO C;  4QJ4 B;  5DKR A;  2WCE A;  2F8P A;  4YGA A;  1UHK A;  4HRE E;  1DT7 B;  1DTL A;  5AER A;  2ZNE A;  4MVF A;  3WNX B;  4MRY A;  3O4Y A;  3ICB A;  1KQV A;  4YRU A;  1B7T Y;  1NCY A;  2R2I A;  3NSK A;  4AQJ A;  2G2B A;  3D10 A;  3I5F C;  3I5I B;  5PAL A;  3TDU A;  4PE7 A;  2L0P A;  1W7I B;  4ORA B;  1L7Z A;  5JJG A;  1EL4 A;  2BCA A;  1L2O C;  2TN4 A;  2JPT A;  4MZJ A;  2O5G A;  1C07 A;  2L2E A;  1IG5 A;  1CM1 A;  2E6W A;  1TNP A;  1XVJ A;  2PAL A;  1SYM A;  2K7C A;  2IS9 A;  2FOT A;  2D8N A;  5FYX A;  1G4Y R;  2SCP A;  4OKH A;  1JF0 A;  2LC5 A;  4CPV A;  2EHB A;  2NCP A;  3TS5 C;  1CFF A;  3LL8 B;  3JVT C;  2H2K A;  3OB1 B;  2F2P A;  3SG6 A;  1DJZ A;  1V1G A;  2KI4 B;  3DF0 B;  1UHH A;  1XFV O;  2FCD A;  1CLL A;  2I94 A;  3OX6 A;  1QAT A;  2K7D A;  1NX0 A;  1YX8 A;  2M7L A;  1CNP A;  1N0Y A;  3I5G C;  2BL0 B;  1K94 A;  3KO0 A;  1NUB A;  3JTD B;  4CID A;  4R1E A;  1QX5 B;  2LHI A;  1KFU S;  3NXA A;  2KAV A;  3PN7 C;  3A4U B;  2HQW A;  1WDC B;  2WOS A;  2L4I A;  3IF7 A;  1KFX L;  3NSL A;  1F55 A;  1QX7 A;  2L5X B;  4I5L B;  1XA5 A;  4PHM A;  1S6C A;  1XK4 C;  2JXL A;  1CKK A;  1MXE A;  1DMO A;  2JUL A;  2LP2 A;  3AKB A;  2M97 A;  5D7F A;  1UHJ A;  1SCM C;  4AQI A;  2KAY A;  2MA2 A;  4DRW A;  1QLS A;  4XYN A;  1TNQ A;  2PVB A;  2M29 A;  2LVK A;  1GGW A;  3SG2 A;  3BUO B;  2EC6 B;  2JT0 A;  2KDH A;  2Y5I A;  3DVK A;  1IJ5 A;  3IQO A;  1J7Q A;  4E68 A;  1QS7 A;  3KHE A;  3BYA A;  1OMR A;  3D0Y A;  2KOT A;  2JT3 A;  2L50 A;  2M1U A;  3EK8 A;  1SCV A;  1TTX A;  1A03 A;  1CLM A;  2F33 A;  4NDB A;  5HLO A;  4XJK A;  2KSP A;  2ISD A;  4N1F A;  3PSR A;  1PAL A;  4YI8 A;  2QPT A;  2KFH A;  2JQ6 A;  1ZUZ A;  1SMG A;  2JT8 A;  2CTN A;  1XYD A;  4PE4 A;  4GBA A;  4UPG A;  1OMD A;  1V1F A;  1YRU B;  1QJT A;  1NWD A;  4PE0 A;  2WND A;  3KPX A;  2CNP A;  3NSO A;  4ZCV A;  5HKW A;  2PRU A;  1LA3 A;  2JOJ A;  4WRI A;  1SW8 A;  1QX2 A;  3WXA A;  3OB2 B;  1NX2 A;  2L98 A;  4MSP A;  5I2Q A;  1PVA A;  3BUX B;  1M31 A;  2AUC A;  1PK0 D;  3KF9 A;  1B47 A;  1DJX A;  2A4J A;  3SIB A;  3CGA A;  2HF5 A;  1KK7 Z;  1BOD A;  4GGF A;  2JNF A;  1DF0 A;  3CR2 A;  1DF0 B;  3CS1 A;  5CSJ A;  1Y1U A;  1WRZ A;  1AVS A;  1GQM A;  1TIZ A;  2FCE A;  1IQ5 A;  3ZNI A;  5B8I B;  1YUU A;  4WQ3 A;  4D1E A;  3EK4 A;  2KHN A;  4P2Y B;  4ZCU A;  2KI4 C;  2PSR A;  2MBX A;  2P6B B;  2LMU A;  4TNC A;  4I5K A;  1H8B A;  1BLQ A;  2I7A A;  2NZ0 A;  1XFX O;  1KK8 B;  1K9U A;  4FQO A;  5DKN A;  1JC2 A;  1B9A A;  2K7B A;  4C0L A;  2SAS A;  1JFK A;  1SPY A;  1HQV A;  1AK8 A;  2MRD A;  4OCI A;  4PHK A;  3ZWH A;  2ZRS A;  5I2O A;  2LVV A;  3BUW B;  3CR4 X;  4DIR A;  3LK0 A;  1IGV A;  1F71 A;  1DJG A;  4YGB B;  2BE6 A;  3M0W A;  3EVU A;  2LVI A;  1DGV A;  2KGR A;  4HRH A;  1D1O A;  1A4P A;  5CSF A;  1AJ5 A;  1SBJ A;  2JNX A;  1K90 D;  3BXK A;  3FWB A;  3C1V A;  3O78 A;  5ER5 A;  2KGB C;  3SJS A;  4NQG A;  3CWG A;  3OP0 A;  1TOP A;  3KEV A;  2HQ8 A;  1DVI A;  5CSN A;  1CMF A;  1KK7 Y;  1SNL A;  2FJU B;  2OTG B;  1CB1 A;  2GGM A;  1DJH A;  3BUN B;  3SG4 A;  1G8I A;  1NCX A;  3DF0 A;  1ZAC A;  1KQM C;  1EH2 A;  3CTN A;  1PRW A;  2LUX A;  1XO5 A;  1C7W A;  5G08 A;  3TUY C;  1FF1 A;  1S36 A;  1F54 A;  1JWD A;  5CSI A;  2Y1M A;  2WOR A;  3BUM B;  1EXR A;  1YVH A;  1QAS A;  2JTT A;  2KBI A;  2Y4Q A;  1J7O A;  2AAO A;  4CFQ A;  5DKQ A;  5BPJ A;  4PE1 A;  2JU0 A;  2ZND A;  1XFU O;  4YGC B;  3I5H B;  5J3X A;  3RM1 A;  1IKU A;  2KQ6 A;  2K2A A;  3PFV A;  4DCK A;  1B4C A;  3PM8 A;  1Y0V H;  4M2Q A;  4M2O A;  3TDI A;  1QIW A;  3DVJ A;  3SG5 A;  3LK1 A;  1M39 A;  4ORB B;  1RRO A;  1PVB A;  2PAS A;  1R2U A;  2K7O A;  1YTZ C;  3SG3 A;  1MHO A;  1K96 A;  2NLN A;  1M63 B;  1Y1X A;  1KWO B;  2BKH B;  1NX1 A;  4Q04 A;  4YI9 A;  4A4C A;  5KU1 A;  1AUI B;  3HX4 A;  2F3Y A;  3WHU B;  4C0J A;  1RJV A;  2JRF A;  1WY9 A;  5KTY A;  4GGN A;  1C7V A;  1K2H A;  1BT6 A;  2HET A;  2M3W A;  3VRO A;  4NDD A;  3GK1 A;  1VRK A;  2DOQ A;  2I18 A;  1XFZ O;  4DUQ A;  1S3P A;  2COL B;  1DJY A;  3I5F B;  2MJW B;  1BR1 B;  4MLW A;  3VRN A;  4GPL B;  5D69 A;  4GGF C;  5IBW A;  1F4Q A;  4ETO A;  1L2O B;  4OV2 A;  1LKJ A;  3VGO A;  4ORC B;  1ODB A;  1UUS A;  5GQQ C;  1TCO B;  1UHN A;  2LMT A;  2LUC A;  1FBV A;  2B1U A;  1OQP A;  2Q91 A;  3NSI A;  1MR8 A;  1TNX A;  1PSR A;  2EGD A;  2LCP A;  1F4O A;  4I5N B;  1F70 A;  2KYF A;  4BY5 A;  3K21 A;  3TS5 B;  1CM4 A;  2I2R E;  4M2P A;  2KI6 D;  3OHM B;  1B8C A;  1BF5 A;  4MEW A;  3JVT B;  1E8A A;  1KFX S;  1YUR A;  2M49 B;  4OVN F;  2VRG A;  3FWC A;  4GFT A;  2KAX A;  2E30 A;  5ER4 X;  1YR5 A;  3I5I C;  3DVM A;  3VRP A;  2JXC A;  4FTG A;  2LVJ A;  1F8H A;  1Y1A A;  4QJ5 B;  3PAT A;  2ZN9 A;  5AFP A;  4GAO A;  3VRR A;  3I5G B;  5TNC A;  1JUO A;  4U8D A;  4QJ3 B;  1OOJ A;  1UHI A;  1XFY O;  1SY9 A;  2K8M B;  1BU3 A;  1YUT A;  1N65 A;  1K9K A;  3PN7 B;  5HLV A;  3RLZ A;  4WQ2 A;  2K0J A;  1X02 A;  1WRK A;  1MWN A;  4HRG A;  1S5G Z;  3OX5 A;  2WCF A;  3A8R A;  2JZI A;  3FIA A;  1ZFS A;  2CCM A;  1U5I B;  1AP4 A;  3DD4 A;  1IQ3 A;  2BEC A;  1K8U A;  2LLS A;  2LV7 A;  2LMV A;  1W7J B;  1QXP A;  1NP8 A;  1CDP A;  5AAN A;  3AAK A;  4P5O E;  4MRX A;  2ZRT A;  3I5H C;  1TRF A;  1BMO A;  1CFP A;  4PAL A;  2M9G A;  2BL0 C;  1YX7 A;  2JWW A;  4MN0 A;  2CBL A;  1GJY A;  1LXF C;  2OS8 B;  2PMY A;  3JTD C;  3MSE B;  5HYD A;  1QV1 A;  2GV5 A;  2Y1N A;  3EKH A;  1FPW A;  2NXQ A;  1DJI A;  1H4B A;  3GOF A;  2H61 A;  5AEQ A;  3F45 A;  1IH0 A;  2MHH A;  3HCM A;  1WDC C;  4GNK B;  4L9M A;  1AHR A;  4JWQ A;  4JPZ B;  1JSA A;  2MLF C;  1M46 A;  1BOC A;  2F3Z A;  1SR6 B;  3BOW A;  1RTP 1;  1Y6W A;  3BOW B;  1BJF A;  2KBM A;  1ALW A;  1CDL A;  4YGD B;  1S5G Y;  4PHJ A;  3LLE A;  2BE4 A;  1UP5 A;  2O60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...