1WY9A

Crystal structure of microglia-specific protein, iba1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
b'KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allograft inflammatory factor 1
publication title X-ray Structures of the Microglia/Macrophage-specific Protein Iba1 from Human and Mouse Demonstrate Novel Molecular Conformation Change Induced by Calcium binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 38
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wy9A00
3KEVA 4N5XA 1LINA 1XFYO 2KSPA 4YBHB 2JTTA 2WCFA 3FWCA 1NX3A 1W7IB 1CFFA 1JFKA 3OB1B 1PVBA 2TN4A 2ZN8A 4L9MA 2KQYA 2MAZA 1KQVA 4CLNA 1K90D 1OOJA 1QLKA 3CZTX 1S1EA 3OP0A 2JZIA 1UHJA 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 4YGAA 4AOMA 3K21A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 2JWWA 4OR9B 1KK7Y 4QJ5B 3NSOA 2OTGC 2E6WA 1MXLC 1YUSA 2SASA 1BU3A 1FBVA 1HT9A 1TCFA 1RK9A 2GGMA 2JXCA 4U8DA 1KK8C 2LMVA 3TZ1A 2KGRA 4JQ0D 1WRLA 5FYXA 1F8HA 1A75B 1IG5A 1PK0D 2M29A 1CDMA 2ZFDA 5G08A 1XFUO 1A75A 1LXFC 2ISDA 1UP5A 3ICBA 2LMUA 1NYAA 2CTNA 1NCYA 1XK4A 2ZRSA 4GBAA 3TUYB 1S3PA 1J1DA 4DUQA 1M45A 2LLTA 1FI6A 1MF8B 2LAPA 3BUWB 1Y1AA 1Y0VH 1CDLA 1CFDA 1AJ4A 2K61A 2ZKMX 1F54A 2K2FA 3DF0B 2RGIA 1KQMC 4IL1A 1VRKA 2PSRA 2K7CA 1BODA 1BR4B 4I5NB 2PALA 4YRUA 4F0ZB 5CSJA 1UURA 3DF0A 1H8BA 1KFXS 2E30A 1F70A 1K9UA 3NSKA 1B47A 1UHNA 3BUXB 3VRPA 1B8LA 3GK2A 2H61A 2KFGA 1Q80A 1SPYA 1DF0B 2MJWB 4PE4A 3E3RA 1IH0A 1AP4A 2F2OA 3DVKA 2GGZA 2JTZA 3I5IC 3O4YA 4PHKA 1M63B 1TNWA 2LM5A 1SL7A 1CTRA 4ORBB 1SL8A 1DF0A 1CDNA 1ZFSA 2V53A 3PN7B 2LCPA 4CFQA 3CWGA 1CDPA 1SYMA 2JU0A 1CMGA 3NSLA 3SIAA 1SRAA 1MXEA 1MWNA 5KSZA 3SG4A 2GV5A 1JWDA 3VRRA 1IJ5A 3I5GB 2O60A 2EHBA 2B1UA 1SY9A 2KAXA 5AXIA 1L2OB 2Q4UA 1GJYA 1B7TZ 1WLMA 3CS1A 2JNXA 1F55A 1NWDA 2FCEA 4OVNF 1KFUL 1KWOC 1IWQA 1PSRA 2LV7A 4PDZA 4AQJA 4N1FA 3DVJA 1NX0A 4Q04A 1YRUB 1RECA 1ZOTB 5B8IB 2PRUA 1BF5A 1RTP1 1SK6D 2NXQA 2KI4B 3CR2A 3I5HB 3PALA 4YGBB 1J7RA 3WXAA 5IBWA 1D1OA 1GGWA 2KOTA 3OB2B 2HQWA 1BG1A 1QX7A 2KGBC 1V1GA 2BE4A 2KAYA 1DJHA 3SG3A 5AANA 4ETOA 4XYNA 1UHHA 1EH2A 1NCZA 1SCMC 4YGEB 1Y1XA 2EGDA 4MN0A 2AUCA 1X02A 1NX1A 3O78A 2LVIA 2ZN9A 2KHNA 2L4IA 1PRWA 2CT9A 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 4NQGA 4TNCA 3VROA 3CGAA 3CR4X 3PLFB 1FI5A 1DJZA 1MHOA 1QV0A 2CNPA 2IS9A 3H4SE 3I5FB 3A8RA 1CLMA 2BKIB 2M1KB 1BJFA 2G9BA 4ZCUA 2M7LA 2MLFC 3JTDC 3AKBA 3PSRA 1LA3A 1WLZA 1M31A 1KSOA 2CCMA 5DKRA 1S5GZ 2CXJA 1WDCC 3C1VA 3VGOA 5AFPA 1CKKA 1NUBA 2PASA 2SCPA 4DCKA 4PE1A 5HKYA 1NX2A 1Y1UA 4NDDA 1LKJA 1XFZO 2F8PA 1QTXA 3JVTC 1CLLA 1XFXO 1SCVA 1RJVA 2I2RE 4DS7A 1UHIA 2LANA 2OTGB 4GGFC 2WCBA 2MBXA 1J7OA 1S26D 4JPZB 2JT3A 2L5XB 3SG5A 2M0RA 3AAKA 1EG4A 1KK8B 1K9KA 1SBJA 2BCAA 2R2IA 4DRWA 3SG2A 5I2QA 2K7OA 2K8MB 3D10A 3IF7A 2M8UA 2O5GA 4ZCVA 3VRQA 1ZACA 1QS7A 2LHIA 1K96A 3BQ3A 4QJ4B 1SNLA 2F3YA 1B8RA 1CMFA 1OQPA 1ZUZA 2JRFA 2LNKA 2HETA 1TTXA 1CM1A 1JFJA 2OPOA 4GGFA 4MZKA 2OS8C 3OX6A 1DTLA 1SKTA 2I7AA 1K2HA 1YVHA 1QXPA 1NIWA 1AHRA 4HREE 1YRTB 2VRGA 1FW4A 3LK0A 2WORA 4GUKA 4A4BA 2BBNA 3F45A 1YX7A 1KQMB 1GQMA 5HYDA 2OS8B 1QVIZ 2KI6D 1U5IB 4USLA 1FPWA 3ZNIA 1MR8A 2LMTA 5D69A 5J3XA 2L2EA 1KK7Z 2COLB 1KFXL 1DJGA 4GGNA 1TN4A 4GPLB 5CSIA 1CFCA 1U5IA 2KDHA 1OMVA 2JULA 2MHHA 1KCYA 1R6PA 2JOJA 2CBLA 1YVLA 3EVUA 1OMDA 1JC2A 2Y1NA 2Y4QA 1TOPA 3I5IB 4MEWA 1RROA 3KO0A 1K95A 4BY4A 5I2OA 4HRHA 1XFWO 4MRXA 1G33A 1XA5A 3CR5X 3D0YB 4C0JA 1HQVA 4XJKB 2LP3A 1JF0A 1F4QA 2F2PA 2FJUB 3WNXB 4HRGA 3OHMB 1WRKA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2JNFA 5DKNA 4XJKA 1SR6C 1S6CA 3SG6A 5DKQA 4HSZA 1W7JB 4YI9A 5BPJA 3LK1A 5KU1A 1M46A 1IRJA 2WCEA 1IGVA 1YUUA 1C7VA 1TRFA 2LVKA 2WNDA 4PE7A 4CIDA 4NDCA 1F4OA 4ICBA 4PHJA 4PHNA 1UHKA 1KWOB 1S6IA 4WQ2A 2I18A 2H2KA 4I5LB 1DJIA 1QIVA 4AQIA 2K7BA 3TDIA 1L7ZA 4FQOA 2P6BB 4E68A 1PULA 2BL0C 2MLEC 4YGDB 4PCWA 1SW8A 1RWYA 1OZOA 1YUTA 1QATA 3IQOA 1N0YA 2ZNEA 1B8CA 1NSHA 1AUIB 1TNXA 2FOTA 3BUNB 1DGVA 2KAVA 3WHTB 1TIZA 1UUSA 4MLWA 2LLSA 1ALVA 2JT0A 3EVRA 1CM4A 1BT6A 1OE9B 1UWOA 4N1GA 4WQ3A 2L0PA 2LUXA 4C0KA 1LVCD 1MQ1A 2LP2A 1B4CA 4NDBA 1ZMZA 4MSPA 1BMOA 1SCMB 3IQQA 3RLZA 1DGUA 4ORAB 1DVIA 1QV1A 1QX2A 1B9AA 2L4HA 3LL8B 1A2XA 3KF9A 1BR1B 3BXKA 3O6BA 1IQ3A 3PATA 2JC2A 3SG7A 1DJWA 1TNQA 2WC8A 3DVEA 2NZ0A 1CNPA 1NP8A 4BY5A 4JWQA 4CPVA 3AKAA 3JTDB 1K93D 1J1EA 1CFPA 4I5JA 1WDCB 4YGCB 2PMYA 2MRDA 2ZNDA 4GFTA 1XK4C 2BCXA 2I94A 3BYAA 4QJ3B 4CFRA 1ALWA 3JVTB 4GAOA 3LLEA 1C07A 3EK8A 3VRNA 5HLOA 4WRIA 2LUCA 1CLBA 4C0LA 1Y6WA 1KSMA 3EVVA 3TUYC 5HKZA 2M97A 1YTZC 3PM8A 2QPTA 1EL4A 2K0JA 1J7PA 3HX4A 4OV2A 1EJ3A 4M2QA 2L51A 1JSAA 3DD4A 3KPXA 2MA2A 2KBMA 2WOSA 1RFJA 2NCOA 2PVBA 5CSFA 1IQ5A 4GNKB 2EC6C 1R2UA 1JBAA 1XYDA 1B7TY 2NCPA 2K7DA 3SIBA 3FWBA 2A4JA 2H61C 1E8AA 1IKUA 5ER4X 1DJXA 4PE0A 1BOCA 1A29A 5AERA 2F33A 4MZLA 1H4BA 1G8IA 3TDZA 2EC6B 2M3WA 1V1FA 1ODBA 1CB1A 1GGZA 1NPQA 3TDUA 2DOQA 1TNPA 2D8NA 3FIAA 3PN7C 1K94A 3M0WA 1YX8A 3WHUB 1LA0A 2ZRTA 5PALA 5HLVA 5F6TA 1B1GA 3NXAA 1IJ6A 1YURA 2BBMA 3ZWHA 3DVMA 1XO5A 3MSEB 3NSIA 1YR5A 3EK7A 3O2PA 5KTYA 1SMGA 1S6JA 4MRYA 1OZSA 4MBEA 5TNCA 3SJSA 3I5GC 2LC5A 2FCDA 4D1EA 1QLSA 5CPVA 2M49B 5CSNA 3QRXA 1WRZA 2HPSA 1L2OC 1MUXA 3KHEA 2KFHA 5ER5A 1C7WA 3TS5C 1DT7B 1G4YR 4ORCB 1PALA 1NCXA 5D7FA 1BLQA 2HF5A 1M39A 2KQ6A 1KFUS 3BUMB 2KI6C 1QASA 2M1UA 2Y1MA 1SL9A 4PALA 1JUOA 2BE6A 1S36A 1OMRA 1A03A 1SR6B 1A4PA 1S5GY 3EK4A 3CLNA 1AVSA 1EXRA 3GK4X 3TS5B 5AEQA 3EKJA 2KI4C 3I5HC 1AJ5A 4P5OE 2LVVA 2Q91A 3BOWB 3OX5A 1F71A 4R1EA 2M9GA 1PSBA 3EKHA 4I5KA 1WY9A 1QJTA 2KNEA 2BECA 3CTNA 2G2BA 2BCBA 2HQ8A 3BOWA 4DIRA 4PHMA 3PFVA 4P2YB 1DMOA 2QACA 2BKHB 3LCPC 5I8NA 1N65A 2L50A 2LE9B 1J55A 2JQ6A 4FTGA 2LLUA 5I2LA 2KBIA 1OSAA 3AAJA 2JXLA 5K89A 2BL0B 1EG3A 2K2AA 3A4UB 5JOLA 1K8UA 3GOFA 1PVAA 4M2OA 4OCIA 3GK1A 2LVJA 5HKWA 2KFFA 2LHLA 3BUOB 3FS7A 2JT8A 4M2PA 1J7QA 3RM1A 4UPGA 4OKHA 2NLNA 1JF2A 1K9PA 2M7NA 3I5FC 1FF1A 1N2DA 1QIWA 4A4CA 1QX5B 5GQQC
chains in the Genus database with same CATH superfamily
3KEVA 4N5XA 3CABA 1LINA 4PT1A 1XFYO 2KSPA 4YBHB 2JTTA 2WCFA 3FWCA 1NX3A 1W7IB 1CFFA 1JFKA 3IVTA 3OB1B 1PVBA 2TN4A 2ZN8A 4L9MA 2KQYA 2MAZA 1KQVA 4CLNA 1K90D 1OOJA 1QLKA 3CZTX 1S1EA 3OP0A 2JZIA 1UHJA 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 1TWOA 4YGAA 4AOMA 3K21A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 2JWWA 4OR9B 1KK7Y 4QJ5B 3NSOA 2OTGC 2QEVA 2E6WA 3Q8IA 1MXLC 1YUSA 1OW4A 1BU3A 1FBVA 2SASA 1HT9A 1TCFA 3WHUB 1RK9A 2GGMA 2JXCA 4U8DA 1KK8C 2LMVA 3TZ1A 2KGRA 4JQ0D 1WRLA 5FYXA 1F8HA 1A75B 1IG5A 1PK0D 2M29A 1CDMA 2ZFDA 3DXLA 1XFUO 5G08A 5I94A 1DELA 3S0GA 1A75A 1LXFC 2ISDA 1UP5A 3ICBA 2LMUA 1NYAA 2WCKA 2CTNA 1NCYA 1XK4A 1OOFA 2ZRSA 4GBAA 3TUYB 1S3PA 1J1DA 4DUQA 1M45A 2LLTA 1FI6A 2WCMA 1MF8B 2LAPA 4F7FA 3BUWB 1Y1AA 1Y0VH 1CDLA 1CFDA 1AJ4A 2K61A 2ZKMX 4KYNA 2YGUA 2K2FA 3B88A 3DF0B 2RGIA 1KQMC 1OOHA 4IL1A 1LS8A 1VRKA 2PSRA 2K7CA 3FE8A 3S0DA 1BODA 1BR4B 4I5NB 2PALA 4YRUA 4F0ZB 5CSJA 1UURA 3DF0A 1H8BA 1KFXS 2E30A 1F70A 3S0AA 1K9UA 3NSKA 1B47A 1UHNA 3BUXB 3OGNA 1SSEB 3VRPA 1B8LA 5DICA 3GK2A 5HL1A 2H61A 2KFGA 1Q80A 1SPYA 1C3ZA 1DF0B 2MJWB 4PE4A 3E3RA 1IH0A 5EL2A 1AP4A 2F2OA 3DVKA 1IIOA 2GGZA 2JTZA 3I5IC 3O4YA 4PHKA 1M63B 1TNWA 2LM5A 1SL7A 1CTRA 4ORBB 1SL8A 1DF0A 1CDNA 1ZFSA 2V53A 3PN7B 4JKTA 3SS5A 2LCPA 3DY9A 4CFQA 3CWGA 1CDPA 1SYMA 2JU0A 3V2LA 1CMGA 3NSLA 3SIAA 1SRAA 1MXEA 1C3YA 1MWNA 5KSZA 3SG4A 2GV5A 1JWDA 3VRRA 1IJ5A 2H8VA 2O60A 2EHBA 3I5GB 2B1UA 1SY9A 2KAXA 5AXIA 3N7HA 1L2OB 3CZ0A 2Q4UA 1GJYA 2KPHA 1B7TZ 1WLMA 3CS1A 2JNXA 1F55A 1NWDA 2FCEA 4OVNF 1KFUL 1KWOC 2WC6A 1IWQA 3R1VA 1PSRA 2LV7A 4PDZA 3R72A 4AQJA 4N1FA 2BNXA 3DVJA 1NX0A 2FJYA 3CDNA 4Q04A 1YRUB 1RECA 1ZOTB 5B8IB 2PRUA 1BF5A 3SS3A 1RTP1 1SK6D 2NXQA 2KI4B 3CR2A 3I5HB 3PALA 4INWA 1J7RA 4YGBB 3WXAA 5IBWA 1D1OA 1GGWA 2KOTA 3OB2B 2HQWA 1BG1A 1QX7A 2KGBC 2PQLA 1V1GA 2BE4A 2P70A 1DQEA 2KAYA 1DJHA 3SG3A 5AANA 4ETOA 4XYNA 1F54A 1UHHA 1EH2A 1W9ZA 1NCZA 1SCMC 4YGEB 1Y1XA 2EGDA 4MN0A 2AUCA 1X02A 1NX1A 2GTEA 3O78A 2LVIA 2ZN9A 3NGVA 2KHNA 2L4IA 1PRWA 2CT9A 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 4JD9A 4NQGA 4TNCA 3VROA 3CGAA 3CR4X 3PLFB 1FI5A 1DJZA 1MHOA 1QV0A 2CNPA 2IS9A 3H4SE 3I5FB 3A8RA 1CLMA 2BKIB 2M1KB 1BJFA 2G9BA 2K60A 4ZCUA 2M7LA 2MLFC 3JTDC 3AKBA 3PSRA 1LA3A 1WLZA 1M31A 1KSOA 2CCMA 2QEHA 5DKRA 1S5GZ 2CXJA 1WDCC 3C1VA 3SS4A 3VGOA 5AFPA 1CKKA 1NUBA 2PASA 2SCPA 4DCKA 4PE1A 5HKYA 1NX2A 1Y1UA 4NDDA 1LKJA 1XFZO 2F8PA 3D74A 1QTXA 3JVTC 1CLLA 1XFXO 1SCVA 1RJVA 2I2RE 4DS7A 1UHIA 2LANA 2OTGB 4GGFC 3PM2A 2WCBA 2MBXA 1J7OA 1S26D 4JPZB 2JT3A 2L5XB 3SG5A 3UO9A 2M0RA 3D78A 3AAKA 1EG4A 1KK8B 1K9KA 1SBJA 2BCAA 2P71A 2R2IA 3DZTA 3SG2A 2ERBA 4DRWA 2K7OA 2K8MB 3D10A 3IF7A 3L4AA 1P28A 2M8UA 2O5GA 4ZCVA 1ZACA 1QS7A 3VRQA 2LHIA 1K96A 3BQ3A 2KLEA 4QJ4B 1SNLA 2F3YA 1B8RA 2QEBA 1CMFA 1OQPA 1ZUZA 2JRFA 2LNKA 2HETA 1TTXA 1CM1A 1JFJA 2OPOA 4GGFA 4MZKA 2OS8C 3OX6A 1DTLA 1QWVA 1SKTA 2I7AA 3CZ1A 1K2HA 1YVHA 1QXPA 4IJ7A 1NIWA 1AHRA 4HREE 1YRTB 2VRGA 3BJHA 1FW4A 3LK0A 4FQTA 2WORA 4GUKA 4A4BA 2BBNA 3F45A 1YX7A 1KQMB 1GQMA 3R1OA 5HYDA 2OS8B 1QVIZ 2KI6D 1U5IB 4USLA 1FPWA 3ZNIA 1MR8A 2LMTA 5D69A 4OZDA 2L2EA 5J3XA 1KK7Z 1KFXL 1DJGA 2COLB 4GGNA 1TN4A 4GPLB 5CSIA 1CFCA 1U5IA 2KDHA 1OMVA 2JULA 2MHHA 1KCYA 1R6PA 3O4XA 2JOJA 2CBLA 1YVLA 3B87A 1OMDA 3EVUA 2Y1NA 2Y4QA 1TOPA 1JC2A 3I5IB 4MEWA 1RROA 3KO0A 1K95A 4BY4A 5I2OA 4HRHA 1XFWO 4MRXA 1G33A 1XA5A 3CR5X 3D0YB 3UNWA 4C0JA 3EG5B 1HQVA 4XJKB 2LP3A 1JF0A 1F4QA 2F2PA 2FJUB 3WNXB 4HRGA 2WCLA 1WRKA 3OHMB 5I2QA 1DEKA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2JNFA 5DKNA 4XJKA 1SR6C 1S6CA 3SG6A 5DKQA 4HSZA 1W7JB 4YI9A 5BPJA 1TUZA 3LK1A 5KU1A 3FE6A 1M46A 1IRJA 2WCEA 1IGVA 1YUUA 1C7VA 1TRFA 2LVKA 2WNDA 4PE7A 4CIDA 3BFAA 1DC1A 4NDCA 1F4OA 2L2CA 1Z4HA 4ICBA 4PHJA 4PHNA 1UHKA 3L47A 1KWOB 1S6IA 4WQ2A 2I18A 2H2KA 4I5LB 1DJIA 1QIVA 4AQIA 2K7BA 3D76A 3TDIA 1L7ZA 5D3OA 4FQOA 3R1PA 2P6BB 3PJIA 4E68A 1B1GA 1PULA 2BL0C 2MLEC 4INXA 4YGDB 4PCWA 1SW8A 1RWYA 1OZOA 1YUTA 1QATA 3IQOA 1N0YA 2ZNEA 1B8CA 1NSHA 1AUIB 1TNXA 2FOTA 3BUNB 1DGVA 2KAVA 3WHTB 1TIZA 5FI6A 1T14A 1UUSA 4MLWA 2LLSA 1ALVA 2JT0A 3EVRA 3QMEA 1CM4A 1BT6A 1OE9B 1UWOA 3BFHA 4N1GA 2L0PA 2LUXA 4WQ3A 4C0KA 3NHIA 1LVCD 1MQ1A 2LP2A 1B4CA 4NDBA 1ZMZA 4MSPA 1BMOA 1SCMB 3IQQA 3RLZA 1DGUA 4ORAB 1DVIA 1QV1A 1QX2A 1B9AA 2L4HA 3LL8B 3D73A 1A2XA 3KF9A 1BR1B 3BXKA 3O6BA 1IQ3A 3PATA 2JC2A 3SG7A 1DJWA 1TNQA 2WC8A 1GM0A 3DVEA 2NZ0A 3D75A 1CNPA 3B7AA 1NP8A 4BY5A 4JWQA 4CPVA 3AKAA 3JTDB 1K93D 1J1EA 1CFPA 4I5JA 1WDCB 4YGCB 2PMYA 2MRDA 2L5YA 2ZNDA 4GFTA 1XK4C 2BCXA 2I94A 3BYAA 4QJ3B 4CFRA 1ALWA 3JVTB 4GAOA 3LLEA 1C07A 2WC5A 3EK8A 3VRNA 5HLOA 4WRIA 2LUCA 2PYQA 1CLBA 4C0LA 1Y6WA 1KSMA 3EVVA 3TUYC 5HKZA 2WCJA 2M97A 1YTZC 1ORGA 3PM8A 2QPTA 1EL4A 2K0JA 1J7PA 3HX4A 4OV2A 1EJ3A 4M2QA 2L51A 1JSAA 3DD4A 3KPXA 2MA2A 2KBMA 2WOSA 1RFJA 2NCOA 2PVBA 3K1EA 1IQ5A 4GNKB 5CSFA 2EC6C 1R2UA 1JBAA 2QEOA 1XYDA 1B7TY 2NCPA 3NHTA 2K7DA 3SIBA 3FWBA 2A4JA 2H61C 1E8AA 1IKUA 5ER4X 1Z2CB 1DJXA 4PE0A 1BOCA 1A29A 5AERA 2F33A 4MZLA 1H4BA 1G8IA 3TDZA 2EC6B 2M3WA 1V1FA 1ODBA 1CB1A 1GGZA 1NPQA 3TDUA 2DOQA 1TNPA 2D8NA 3FIAA 3PN7C 1K94A 3M0WA 1YX8A 2KLDA 1LA0A 2WCHA 2ZRTA 5HLVA 5F6TA 5PALA 3NXAA 1IJ6A 1YURA 2BBMA 3ZWHA 3DVMA 1XO5A 2QDIA 3DYEA 3MSEB 1YR5A 3EK7A 3NSIA 3O2PA 5KTYA 1SMGA 1S6JA 4MRYA 1OZSA 4MBEA 5TNCA 3SJSA 3I5GC 5FI7A 2LC5A 2FCDA 4D1EA 1QLSA 5CPVA 2M49B 5CSNA 3QRXA 1WRZA 2HPSA 1L2OC 1MUXA 3KHEA 2KFHA 5ER5A 1C7WA 3TS5C 1TUJA 3S0FA 1DT7B 1G4YR 3L4LA 4ORCB 1PALA 1NCXA 3B6XA 5D7FA 1BLQA 2HF5A 1M39A 2KQ6A 1KFUS 3RZSA 3BUMB 2KI6C 1QASA 2M1UA 2Y1MA 1SL9A 3FE9A 1OOGA 4PALA 1JUOA 2BE6A 1S36A 1OMRA 1A03A 1OOIX 1SR6B 1A4PA 1S5GY 3EK4A 3CLNA 1AVSA 1EXRA 3GK4X 3TS5B 5AEQA 3EKJA 2KI4C 3I5HC 1AJ5A 4P5OE 2LVVA 2Q91A 3BOWB 3OX5A 1F71A 4R1EA 2M9GA 1PSBA 3EKHA 4I5KA 1WY9A 1QJTA 2KNEA 2BECA 3CTNA 3CZ2A 2G2BA 2BCBA 2HQ8A 3BOWA 3S0EA 4DIRA 4PHMA 3PFVA 4P2YB 1DMOA 2QACA 2BKHB 3LCPC 5I8NA 1N65A 5FI2A 2L50A 2BAPA 2JPOA 1J55A 2JQ6A 2LE9B 4FTGA 3VB1A 2LLUA 3D77A 2KBIA 5I2LA 3S0BA 1OSAA 3AAJA 2JXLA 5K89A 3CYZA 2BL0B 1EG3A 2K2AA 3A4UB 3B86A 3OBVA 5JOLA 1K8UA 3GOFA 1PVAA 4M2OA 4OCIA 3GK1A 2LVJA 5HKWA 2KFFA 2LHLA 3BUOB 3FS7A 2JT8A 4M2PA 1J7QA 3RM1A 4UPGA 1XFRA 4OKHA 2NLNA 1JF2A 1K9PA 2M7NA 3I5FC 3BFBA 1FF1A 1N2DA 1QIWA 4A4CA 1QX5B 5GQQC
chains in the Genus database with same CATH topology
3KEVA 4N5XA 1LINA 1XFYO 2KSPA 4YBHB 2JTTA 2WCFA 3FWCA 1NX3A 1W7IB 1CFFA 1JFKA 3OB1B 1PVBA 2TN4A 2ZN8A 4L9MA 2KQYA 2MAZA 1KQVA 4CLNA 1K90D 1OOJA 1QLKA 3CZTX 1S1EA 3OP0A 2JZIA 1UHJA 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 4YGAA 4AOMA 3K21A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 2JWWA 4OR9B 1KK7Y 4QJ5B 3NSOA 2OTGC 2E6WA 1MXLC 1YUSA 2SASA 1BU3A 1FBVA 1HT9A 1TCFA 1RK9A 2GGMA 2JXCA 4U8DA 1KK8C 2LMVA 3TZ1A 2KGRA 4JQ0D 1WRLA 5FYXA 1F8HA 1A75B 1IG5A 1PK0D 2M29A 1CDMA 2ZFDA 5G08A 1XFUO 1A75A 1LXFC 2ISDA 1UP5A 3ICBA 2LMUA 1NYAA 2CTNA 1NCYA 1XK4A 2ZRSA 4GBAA 3TUYB 1S3PA 1J1DA 4DUQA 1M45A 2LLTA 1FI6A 1MF8B 2LAPA 3BUWB 1Y1AA 1Y0VH 1CDLA 1CFDA 1AJ4A 2K61A 2ZKMX 1F54A 2K2FA 3DF0B 2RGIA 1KQMC 4IL1A 1VRKA 2PSRA 2K7CA 1BODA 1BR4B 4I5NB 2PALA 4YRUA 4F0ZB 5CSJA 1UURA 3DF0A 1H8BA 1KFXS 2E30A 1F70A 1K9UA 3NSKA 1B47A 1UHNA 3BUXB 3VRPA 1B8LA 3GK2A 2H61A 2KFGA 1Q80A 1SPYA 1DF0B 2MJWB 4PE4A 3E3RA 1IH0A 1AP4A 2F2OA 3DVKA 2GGZA 2JTZA 3I5IC 3O4YA 4PHKA 1M63B 1TNWA 2LM5A 1SL7A 1CTRA 4ORBB 1SL8A 1DF0A 1CDNA 1ZFSA 2V53A 3PN7B 2LCPA 4CFQA 3CWGA 1CDPA 1SYMA 2JU0A 1CMGA 3NSLA 3SIAA 1SRAA 1MXEA 1MWNA 5KSZA 3SG4A 2GV5A 1JWDA 3VRRA 1IJ5A 3I5GB 2O60A 2EHBA 2B1UA 1SY9A 2KAXA 5AXIA 1L2OB 2Q4UA 1GJYA 1B7TZ 1WLMA 3CS1A 2JNXA 1F55A 1NWDA 2FCEA 4OVNF 1KFUL 1KWOC 1IWQA 1PSRA 2LV7A 4PDZA 4AQJA 4N1FA 3DVJA 1NX0A 4Q04A 1YRUB 1RECA 1ZOTB 5B8IB 2PRUA 1BF5A 1RTP1 1SK6D 2NXQA 2KI4B 3CR2A 3I5HB 3PALA 4YGBB 1J7RA 3WXAA 5IBWA 1D1OA 1GGWA 2KOTA 3OB2B 2HQWA 1BG1A 1QX7A 2KGBC 1V1GA 2BE4A 2KAYA 1DJHA 3SG3A 5AANA 4ETOA 4XYNA 1UHHA 1EH2A 1NCZA 1SCMC 4YGEB 1Y1XA 2EGDA 4MN0A 2AUCA 1X02A 1NX1A 3O78A 2LVIA 2ZN9A 2KHNA 2L4IA 1PRWA 2CT9A 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 4NQGA 4TNCA 3VROA 3CGAA 3CR4X 3PLFB 1FI5A 1DJZA 1MHOA 1QV0A 2CNPA 2IS9A 3H4SE 3I5FB 3A8RA 1CLMA 2BKIB 2M1KB 1BJFA 2G9BA 4ZCUA 2M7LA 2MLFC 3JTDC 3AKBA 3PSRA 1LA3A 1WLZA 1M31A 1KSOA 2CCMA 5DKRA 1S5GZ 2CXJA 1WDCC 3C1VA 3VGOA 5AFPA 1CKKA 1NUBA 2PASA 2SCPA 4DCKA 4PE1A 5HKYA 1NX2A 1Y1UA 4NDDA 1LKJA 1XFZO 2F8PA 1QTXA 3JVTC 1CLLA 1XFXO 1SCVA 1RJVA 2I2RE 4DS7A 1UHIA 2LANA 2OTGB 4GGFC 2WCBA 2MBXA 1J7OA 1S26D 4JPZB 2JT3A 2L5XB 3SG5A 2M0RA 3AAKA 1EG4A 1KK8B 1K9KA 1SBJA 2BCAA 2R2IA 4DRWA 3SG2A 5I2QA 2K7OA 2K8MB 3D10A 3IF7A 2M8UA 2O5GA 4ZCVA 3VRQA 1ZACA 1QS7A 2LHIA 1K96A 3BQ3A 4QJ4B 1SNLA 2F3YA 1B8RA 1CMFA 1OQPA 1ZUZA 2JRFA 2LNKA 2HETA 1TTXA 1CM1A 1JFJA 2OPOA 4GGFA 4MZKA 2OS8C 3OX6A 1DTLA 1SKTA 2I7AA 1K2HA 1YVHA 1QXPA 1NIWA 1AHRA 4HREE 1YRTB 2VRGA 1FW4A 3LK0A 2WORA 4GUKA 4A4BA 2BBNA 3F45A 1YX7A 1KQMB 1GQMA 5HYDA 2OS8B 1QVIZ 2KI6D 1U5IB 4USLA 1FPWA 3ZNIA 1MR8A 2LMTA 5D69A 5J3XA 2L2EA 1KK7Z 2COLB 1KFXL 1DJGA 4GGNA 1TN4A 4GPLB 5CSIA 1CFCA 1U5IA 2KDHA 1OMVA 2JULA 2MHHA 1KCYA 1R6PA 2JOJA 2CBLA 1YVLA 3EVUA 1OMDA 1JC2A 2Y1NA 2Y4QA 1TOPA 3I5IB 4MEWA 1RROA 3KO0A 1K95A 4BY4A 5I2OA 4HRHA 1XFWO 4MRXA 1G33A 1XA5A 3CR5X 3D0YB 4C0JA 1HQVA 4XJKB 2LP3A 1JF0A 1F4QA 2F2PA 2FJUB 3WNXB 4HRGA 3OHMB 1WRKA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2JNFA 5DKNA 4XJKA 1SR6C 1S6CA 3SG6A 5DKQA 4HSZA 1W7JB 4YI9A 5BPJA 3LK1A 5KU1A 1M46A 1IRJA 2WCEA 1IGVA 1YUUA 1C7VA 1TRFA 2LVKA 2WNDA 4PE7A 4CIDA 4NDCA 1F4OA 4ICBA 4PHJA 4PHNA 1UHKA 1KWOB 1S6IA 4WQ2A 2I18A 2H2KA 4I5LB 1DJIA 1QIVA 4AQIA 2K7BA 3TDIA 1L7ZA 4FQOA 2P6BB 4E68A 1PULA 2BL0C 2MLEC 4YGDB 4PCWA 1SW8A 1RWYA 1OZOA 1YUTA 1QATA 3IQOA 1N0YA 2ZNEA 1B8CA 1NSHA 1AUIB 1TNXA 2FOTA 3BUNB 1DGVA 2KAVA 3WHTB 1TIZA 1UUSA 4MLWA 2LLSA 1ALVA 2JT0A 3EVRA 1CM4A 1BT6A 1OE9B 1UWOA 4N1GA 4WQ3A 2L0PA 2LUXA 4C0KA 1LVCD 1MQ1A 2LP2A 1B4CA 4NDBA 1ZMZA 4MSPA 1BMOA 1SCMB 3IQQA 3RLZA 1DGUA 4ORAB 1DVIA 1QV1A 1QX2A 1B9AA 2L4HA 3LL8B 1A2XA 3KF9A 1BR1B 3BXKA 3O6BA 1IQ3A 3PATA 2JC2A 3SG7A 1DJWA 1TNQA 2WC8A 3DVEA 2NZ0A 1CNPA 1NP8A 4BY5A 4JWQA 4CPVA 3AKAA 3JTDB 1K93D 1J1EA 1CFPA 4I5JA 1WDCB 4YGCB 2PMYA 2MRDA 2ZNDA 4GFTA 1XK4C 2BCXA 2I94A 3BYAA 4QJ3B 4CFRA 1ALWA 3JVTB 4GAOA 3LLEA 1C07A 3EK8A 3VRNA 5HLOA 4WRIA 2LUCA 1CLBA 4C0LA 1Y6WA 1KSMA 3EVVA 3TUYC 5HKZA 2M97A 1YTZC 3PM8A 2QPTA 1EL4A 2K0JA 1J7PA 3HX4A 4OV2A 1EJ3A 4M2QA 2L51A 1JSAA 3DD4A 3KPXA 2MA2A 2KBMA 2WOSA 1RFJA 2NCOA 2PVBA 5CSFA 1IQ5A 4GNKB 2EC6C 1R2UA 1JBAA 1XYDA 1B7TY 2NCPA 2K7DA 3SIBA 3FWBA 2A4JA 2H61C 1E8AA 1IKUA 5ER4X 1DJXA 4PE0A 1BOCA 1A29A 5AERA 2F33A 4MZLA 1H4BA 1G8IA 3TDZA 2EC6B 2M3WA 1V1FA 1ODBA 1CB1A 1GGZA 1NPQA 3TDUA 2DOQA 1TNPA 2D8NA 3FIAA 3PN7C 1K94A 3M0WA 1YX8A 3WHUB 1LA0A 2ZRTA 5PALA 5HLVA 5F6TA 1B1GA 3NXAA 1IJ6A 1YURA 2BBMA 3ZWHA 3DVMA 1XO5A 3MSEB 3NSIA 1YR5A 3EK7A 3O2PA 5KTYA 1SMGA 1S6JA 4MRYA 1OZSA 4MBEA 5TNCA 3SJSA 3I5GC 2LC5A 2FCDA 4D1EA 1QLSA 5CPVA 2M49B 5CSNA 3QRXA 1WRZA 2HPSA 1L2OC 1MUXA 3KHEA 2KFHA 5ER5A 1C7WA 3TS5C 1DT7B 1G4YR 4ORCB 1PALA 1NCXA 5D7FA 1BLQA 2HF5A 1M39A 2KQ6A 1KFUS 3BUMB 2KI6C 1QASA 2M1UA 2Y1MA 1SL9A 4PALA 1JUOA 2BE6A 1S36A 1OMRA 1A03A 1SR6B 1A4PA 1S5GY 3EK4A 3CLNA 1AVSA 1EXRA 3GK4X 3TS5B 5AEQA 3EKJA 2KI4C 3I5HC 1AJ5A 4P5OE 2LVVA 2Q91A 3BOWB 3OX5A 1F71A 4R1EA 2M9GA 1PSBA 3EKHA 4I5KA 1WY9A 1QJTA 2KNEA 2BECA 3CTNA 2G2BA 2BCBA 2HQ8A 3BOWA 4DIRA 4PHMA 3PFVA 4P2YB 1DMOA 2QACA 2BKHB 3LCPC 5I8NA 1N65A 2L50A 2LE9B 1J55A 2JQ6A 4FTGA 2LLUA 5I2LA 2KBIA 1OSAA 3AAJA 2JXLA 5K89A 2BL0B 1EG3A 2K2AA 3A4UB 5JOLA 1K8UA 3GOFA 1PVAA 4M2OA 4OCIA 3GK1A 2LVJA 5HKWA 2KFFA 2LHLA 3BUOB 3FS7A 2JT8A 4M2PA 1J7QA 3RM1A 4UPGA 4OKHA 2NLNA 1JF2A 1K9PA 2M7NA 3I5FC 1FF1A 1N2DA 1QIWA 4A4CA 1QX5B 5GQQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEV A;  4N5X A;  1LIN A;  1XFY O;  2KSP A;  4YBH B;  2JTT A;  2WCF A;  3FWC A;  1NX3 A;  1W7I B;  1CFF A;  1JFK A;  3OB1 B;  1PVB A;  2TN4 A;  2ZN8 A;  4L9M A;  2KQY A;  2MAZ A;  1KQV A;  4CLN A;  1K90 D;  1OOJ A;  1QLK A;  3CZT X;  1S1E A;  3OP0 A;  2JZI A;  1UHJ A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  4YGA A;  4AOM A;  3K21 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  2JWW A;  4OR9 B;  1KK7 Y;  4QJ5 B;  3NSO A;  2OTG C;  2E6W A;  1MXL C;  1YUS A;  2SAS A;  1BU3 A;  1FBV A;  1HT9 A;  1TCF A;  1RK9 A;  2GGM A;  2JXC A;  4U8D A;  1KK8 C;  2LMV A;  3TZ1 A;  2KGR A;  4JQ0 D;  1WRL A;  5FYX A;  1F8H A;  1A75 B;  1IG5 A;  1PK0 D;  2M29 A;  1CDM A;  2ZFD A;  5G08 A;  1XFU O;  1A75 A;  1LXF C;  2ISD A;  1UP5 A;  3ICB A;  2LMU A;  1NYA A;  2CTN A;  1NCY A;  1XK4 A;  2ZRS A;  4GBA A;  3TUY B;  1S3P A;  1J1D A;  4DUQ A;  1M45 A;  2LLT A;  1FI6 A;  1MF8 B;  2LAP A;  3BUW B;  1Y1A A;  1Y0V H;  1CDL A;  1CFD A;  1AJ4 A;  2K61 A;  2ZKM X;  1F54 A;  2K2F A;  3DF0 B;  2RGI A;  1KQM C;  4IL1 A;  1VRK A;  2PSR A;  2K7C A;  1BOD A;  1BR4 B;  4I5N B;  2PAL A;  4YRU A;  4F0Z B;  5CSJ A;  1UUR A;  3DF0 A;  1H8B A;  1KFX S;  2E30 A;  1F70 A;  1K9U A;  3NSK A;  1B47 A;  1UHN A;  3BUX B;  3VRP A;  1B8L A;  3GK2 A;  2H61 A;  2KFG A;  1Q80 A;  1SPY A;  1DF0 B;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  1AP4 A;  2F2O A;  3DVK A;  2GGZ A;  2JTZ A;  3I5I C;  3O4Y A;  4PHK A;  1M63 B;  1TNW A;  2LM5 A;  1SL7 A;  1CTR A;  4ORB B;  1SL8 A;  1DF0 A;  1CDN A;  1ZFS A;  2V53 A;  3PN7 B;  2LCP A;  4CFQ A;  3CWG A;  1CDP A;  1SYM A;  2JU0 A;  1CMG A;  3NSL A;  3SIA A;  1SRA A;  1MXE A;  1MWN A;  5KSZ A;  3SG4 A;  2GV5 A;  1JWD A;  3VRR A;  1IJ5 A;  3I5G B;  2O60 A;  2EHB A;  2B1U A;  1SY9 A;  2KAX A;  5AXI A;  1L2O B;  2Q4U A;  1GJY A;  1B7T Z;  1WLM A;  3CS1 A;  2JNX A;  1F55 A;  1NWD A;  2FCE A;  4OVN F;  1KFU L;  1KWO C;  1IWQ A;  1PSR A;  2LV7 A;  4PDZ A;  4AQJ A;  4N1F A;  3DVJ A;  1NX0 A;  4Q04 A;  1YRU B;  1REC A;  1ZOT B;  5B8I B;  2PRU A;  1BF5 A;  1RTP 1;  1SK6 D;  2NXQ A;  2KI4 B;  3CR2 A;  3I5H B;  3PAL A;  4YGB B;  1J7R A;  3WXA A;  5IBW A;  1D1O A;  1GGW A;  2KOT A;  3OB2 B;  2HQW A;  1BG1 A;  1QX7 A;  2KGB C;  1V1G A;  2BE4 A;  2KAY A;  1DJH A;  3SG3 A;  5AAN A;  4ETO A;  4XYN A;  1UHH A;  1EH2 A;  1NCZ A;  1SCM C;  4YGE B;  1Y1X A;  2EGD A;  4MN0 A;  2AUC A;  1X02 A;  1NX1 A;  3O78 A;  2LVI A;  2ZN9 A;  2KHN A;  2L4I A;  1PRW A;  2CT9 A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  4NQG A;  4TNC A;  3VRO A;  3CGA A;  3CR4 X;  3PLF B;  1FI5 A;  1DJZ A;  1MHO A;  1QV0 A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3A8R A;  1CLM A;  2BKI B;  2M1K B;  1BJF A;  2G9B A;  4ZCU A;  2M7L A;  2MLF C;  3JTD C;  3AKB A;  3PSR A;  1LA3 A;  1WLZ A;  1M31 A;  1KSO A;  2CCM A;  5DKR A;  1S5G Z;  2CXJ A;  1WDC C;  3C1V A;  3VGO A;  5AFP A;  1CKK A;  1NUB A;  2PAS A;  2SCP A;  4DCK A;  4PE1 A;  5HKY A;  1NX2 A;  1Y1U A;  4NDD A;  1LKJ A;  1XFZ O;  2F8P A;  1QTX A;  3JVT C;  1CLL A;  1XFX O;  1SCV A;  1RJV A;  2I2R E;  4DS7 A;  1UHI A;  2LAN A;  2OTG B;  4GGF C;  2WCB A;  2MBX A;  1J7O A;  1S26 D;  4JPZ B;  2JT3 A;  2L5X B;  3SG5 A;  2M0R A;  3AAK A;  1EG4 A;  1KK8 B;  1K9K A;  1SBJ A;  2BCA A;  2R2I A;  4DRW A;  3SG2 A;  5I2Q A;  2K7O A;  2K8M B;  3D10 A;  3IF7 A;  2M8U A;  2O5G A;  4ZCV A;  3VRQ A;  1ZAC A;  1QS7 A;  2LHI A;  1K96 A;  3BQ3 A;  4QJ4 B;  1SNL A;  2F3Y A;  1B8R A;  1CMF A;  1OQP A;  1ZUZ A;  2JRF A;  2LNK A;  2HET A;  1TTX A;  1CM1 A;  1JFJ A;  2OPO A;  4GGF A;  4MZK A;  2OS8 C;  3OX6 A;  1DTL A;  1SKT A;  2I7A A;  1K2H A;  1YVH A;  1QXP A;  1NIW A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  1FW4 A;  3LK0 A;  2WOR A;  4GUK A;  4A4B A;  2BBN A;  3F45 A;  1YX7 A;  1KQM B;  1GQM A;  5HYD A;  2OS8 B;  1QVI Z;  2KI6 D;  1U5I B;  4USL A;  1FPW A;  3ZNI A;  1MR8 A;  2LMT A;  5D69 A;  5J3X A;  2L2E A;  1KK7 Z;  2COL B;  1KFX L;  1DJG A;  4GGN A;  1TN4 A;  4GPL B;  5CSI A;  1CFC A;  1U5I A;  2KDH A;  1OMV A;  2JUL A;  2MHH A;  1KCY A;  1R6P A;  2JOJ A;  2CBL A;  1YVL A;  3EVU A;  1OMD A;  1JC2 A;  2Y1N A;  2Y4Q A;  1TOP A;  3I5I B;  4MEW A;  1RRO A;  3KO0 A;  1K95 A;  4BY4 A;  5I2O A;  4HRH A;  1XFW O;  4MRX A;  1G33 A;  1XA5 A;  3CR5 X;  3D0Y B;  4C0J A;  1HQV A;  4XJK B;  2LP3 A;  1JF0 A;  1F4Q A;  2F2P A;  2FJU B;  3WNX B;  4HRG A;  3OHM B;  1WRK A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2JNF A;  5DKN A;  4XJK A;  1SR6 C;  1S6C A;  3SG6 A;  5DKQ A;  4HSZ A;  1W7J B;  4YI9 A;  5BPJ A;  3LK1 A;  5KU1 A;  1M46 A;  1IRJ A;  2WCE A;  1IGV A;  1YUU A;  1C7V A;  1TRF A;  2LVK A;  2WND A;  4PE7 A;  4CID A;  4NDC A;  1F4O A;  4ICB A;  4PHJ A;  4PHN A;  1UHK A;  1KWO B;  1S6I A;  4WQ2 A;  2I18 A;  2H2K A;  4I5L B;  1DJI A;  1QIV A;  4AQI A;  2K7B A;  3TDI A;  1L7Z A;  4FQO A;  2P6B B;  4E68 A;  1PUL A;  2BL0 C;  2MLE C;  4YGD B;  4PCW A;  1SW8 A;  1RWY A;  1OZO A;  1YUT A;  1QAT A;  3IQO A;  1N0Y A;  2ZNE A;  1B8C A;  1NSH A;  1AUI B;  1TNX A;  2FOT A;  3BUN B;  1DGV A;  2KAV A;  3WHT B;  1TIZ A;  1UUS A;  4MLW A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  1CM4 A;  1BT6 A;  1OE9 B;  1UWO A;  4N1G A;  4WQ3 A;  2L0P A;  2LUX A;  4C0K A;  1LVC D;  1MQ1 A;  2LP2 A;  1B4C A;  4NDB A;  1ZMZ A;  4MSP A;  1BMO A;  1SCM B;  3IQQ A;  3RLZ A;  1DGU A;  4ORA B;  1DVI A;  1QV1 A;  1QX2 A;  1B9A A;  2L4H A;  3LL8 B;  1A2X A;  3KF9 A;  1BR1 B;  3BXK A;  3O6B A;  1IQ3 A;  3PAT A;  2JC2 A;  3SG7 A;  1DJW A;  1TNQ A;  2WC8 A;  3DVE A;  2NZ0 A;  1CNP A;  1NP8 A;  4BY5 A;  4JWQ A;  4CPV A;  3AKA A;  3JTD B;  1K93 D;  1J1E A;  1CFP A;  4I5J A;  1WDC B;  4YGC B;  2PMY A;  2MRD A;  2ZND A;  4GFT A;  1XK4 C;  2BCX A;  2I94 A;  3BYA A;  4QJ3 B;  4CFR A;  1ALW A;  3JVT B;  4GAO A;  3LLE A;  1C07 A;  3EK8 A;  3VRN A;  5HLO A;  4WRI A;  2LUC A;  1CLB A;  4C0L A;  1Y6W A;  1KSM A;  3EVV A;  3TUY C;  5HKZ A;  2M97 A;  1YTZ C;  3PM8 A;  2QPT A;  1EL4 A;  2K0J A;  1J7P A;  3HX4 A;  4OV2 A;  1EJ3 A;  4M2Q A;  2L51 A;  1JSA A;  3DD4 A;  3KPX A;  2MA2 A;  2KBM A;  2WOS A;  1RFJ A;  2NCO A;  2PVB A;  5CSF A;  1IQ5 A;  4GNK B;  2EC6 C;  1R2U A;  1JBA A;  1XYD A;  1B7T Y;  2NCP A;  2K7D A;  3SIB A;  3FWB A;  2A4J A;  2H61 C;  1E8A A;  1IKU A;  5ER4 X;  1DJX A;  4PE0 A;  1BOC A;  1A29 A;  5AER A;  2F33 A;  4MZL A;  1H4B A;  1G8I A;  3TDZ A;  2EC6 B;  2M3W A;  1V1F A;  1ODB A;  1CB1 A;  1GGZ A;  1NPQ A;  3TDU A;  2DOQ A;  1TNP A;  2D8N A;  3FIA A;  3PN7 C;  1K94 A;  3M0W A;  1YX8 A;  3WHU B;  1LA0 A;  2ZRT A;  5PAL A;  5HLV A;  5F6T A;  1B1G A;  3NXA A;  1IJ6 A;  1YUR A;  2BBM A;  3ZWH A;  3DVM A;  1XO5 A;  3MSE B;  3NSI A;  1YR5 A;  3EK7 A;  3O2P A;  5KTY A;  1SMG A;  1S6J A;  4MRY A;  1OZS A;  4MBE A;  5TNC A;  3SJS A;  3I5G C;  2LC5 A;  2FCD A;  4D1E A;  1QLS A;  5CPV A;  2M49 B;  5CSN A;  3QRX A;  1WRZ A;  2HPS A;  1L2O C;  1MUX A;  3KHE A;  2KFH A;  5ER5 A;  1C7W A;  3TS5 C;  1DT7 B;  1G4Y R;  4ORC B;  1PAL A;  1NCX A;  5D7F A;  1BLQ A;  2HF5 A;  1M39 A;  2KQ6 A;  1KFU S;  3BUM B;  2KI6 C;  1QAS A;  2M1U A;  2Y1M A;  1SL9 A;  4PAL A;  1JUO A;  2BE6 A;  1S36 A;  1OMR A;  1A03 A;  1SR6 B;  1A4P A;  1S5G Y;  3EK4 A;  3CLN A;  1AVS A;  1EXR A;  3GK4 X;  3TS5 B;  5AEQ A;  3EKJ A;  2KI4 C;  3I5H C;  1AJ5 A;  4P5O E;  2LVV A;  2Q91 A;  3BOW B;  3OX5 A;  1F71 A;  4R1E A;  2M9G A;  1PSB A;  3EKH A;  4I5K A;  1WY9 A;  1QJT A;  2KNE A;  2BEC A;  3CTN A;  2G2B A;  2BCB A;  2HQ8 A;  3BOW A;  4DIR A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  2QAC A;  2BKH B;  3LCP C;  5I8N A;  1N65 A;  2L50 A;  2LE9 B;  1J55 A;  2JQ6 A;  4FTG A;  2LLU A;  5I2L A;  2KBI A;  1OSA A;  3AAJ A;  2JXL A;  5K89 A;  2BL0 B;  1EG3 A;  2K2A A;  3A4U B;  5JOL A;  1K8U A;  3GOF A;  1PVA A;  4M2O A;  4OCI A;  3GK1 A;  2LVJ A;  5HKW A;  2KFF A;  2LHL A;  3BUO B;  3FS7 A;  2JT8 A;  4M2P A;  1J7Q A;  3RM1 A;  4UPG A;  4OKH A;  2NLN A;  1JF2 A;  1K9P A;  2M7N A;  3I5F C;  1FF1 A;  1N2D A;  1QIW A;  4A4C A;  1QX5 B;  5GQQ C; 
#chains in the Genus database with same CATH topology
 3KEV A;  4N5X A;  3CAB A;  1LIN A;  4PT1 A;  1XFY O;  2KSP A;  4YBH B;  2JTT A;  2WCF A;  3FWC A;  1NX3 A;  1W7I B;  1CFF A;  1JFK A;  3IVT A;  3OB1 B;  1PVB A;  2TN4 A;  2ZN8 A;  4L9M A;  2KQY A;  2MAZ A;  1KQV A;  4CLN A;  1K90 D;  1OOJ A;  1QLK A;  3CZT X;  1S1E A;  3OP0 A;  2JZI A;  1UHJ A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  1TWO A;  4YGA A;  4AOM A;  3K21 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  2JWW A;  4OR9 B;  1KK7 Y;  4QJ5 B;  3NSO A;  2OTG C;  2QEV A;  2E6W A;  3Q8I A;  1MXL C;  1YUS A;  1OW4 A;  1BU3 A;  1FBV A;  2SAS A;  1HT9 A;  1TCF A;  3WHU B;  1RK9 A;  2GGM A;  2JXC A;  4U8D A;  1KK8 C;  2LMV A;  3TZ1 A;  2KGR A;  4JQ0 D;  1WRL A;  5FYX A;  1F8H A;  1A75 B;  1IG5 A;  1PK0 D;  2M29 A;  1CDM A;  2ZFD A;  3DXL A;  1XFU O;  5G08 A;  5I94 A;  1DEL A;  3S0G A;  1A75 A;  1LXF C;  2ISD A;  1UP5 A;  3ICB A;  2LMU A;  1NYA A;  2WCK A;  2CTN A;  1NCY A;  1XK4 A;  1OOF A;  2ZRS A;  4GBA A;  3TUY B;  1S3P A;  1J1D A;  4DUQ A;  1M45 A;  2LLT A;  1FI6 A;  2WCM A;  1MF8 B;  2LAP A;  4F7F A;  3BUW B;  1Y1A A;  1Y0V H;  1CDL A;  1CFD A;  1AJ4 A;  2K61 A;  2ZKM X;  4KYN A;  2YGU A;  2K2F A;  3B88 A;  3DF0 B;  2RGI A;  1KQM C;  1OOH A;  4IL1 A;  1LS8 A;  1VRK A;  2PSR A;  2K7C A;  3FE8 A;  3S0D A;  1BOD A;  1BR4 B;  4I5N B;  2PAL A;  4YRU A;  4F0Z B;  5CSJ A;  1UUR A;  3DF0 A;  1H8B A;  1KFX S;  2E30 A;  1F70 A;  3S0A A;  1K9U A;  3NSK A;  1B47 A;  1UHN A;  3BUX B;  3OGN A;  1SSE B;  3VRP A;  1B8L A;  5DIC A;  3GK2 A;  5HL1 A;  2H61 A;  2KFG A;  1Q80 A;  1SPY A;  1C3Z A;  1DF0 B;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  5EL2 A;  1AP4 A;  2F2O A;  3DVK A;  1IIO A;  2GGZ A;  2JTZ A;  3I5I C;  3O4Y A;  4PHK A;  1M63 B;  1TNW A;  2LM5 A;  1SL7 A;  1CTR A;  4ORB B;  1SL8 A;  1DF0 A;  1CDN A;  1ZFS A;  2V53 A;  3PN7 B;  4JKT A;  3SS5 A;  2LCP A;  3DY9 A;  4CFQ A;  3CWG A;  1CDP A;  1SYM A;  2JU0 A;  3V2L A;  1CMG A;  3NSL A;  3SIA A;  1SRA A;  1MXE A;  1C3Y A;  1MWN A;  5KSZ A;  3SG4 A;  2GV5 A;  1JWD A;  3VRR A;  1IJ5 A;  2H8V A;  2O60 A;  2EHB A;  3I5G B;  2B1U A;  1SY9 A;  2KAX A;  5AXI A;  3N7H A;  1L2O B;  3CZ0 A;  2Q4U A;  1GJY A;  2KPH A;  1B7T Z;  1WLM A;  3CS1 A;  2JNX A;  1F55 A;  1NWD A;  2FCE A;  4OVN F;  1KFU L;  1KWO C;  2WC6 A;  1IWQ A;  3R1V A;  1PSR A;  2LV7 A;  4PDZ A;  3R72 A;  4AQJ A;  4N1F A;  2BNX A;  3DVJ A;  1NX0 A;  2FJY A;  3CDN A;  4Q04 A;  1YRU B;  1REC A;  1ZOT B;  5B8I B;  2PRU A;  1BF5 A;  3SS3 A;  1RTP 1;  1SK6 D;  2NXQ A;  2KI4 B;  3CR2 A;  3I5H B;  3PAL A;  4INW A;  1J7R A;  4YGB B;  3WXA A;  5IBW A;  1D1O A;  1GGW A;  2KOT A;  3OB2 B;  2HQW A;  1BG1 A;  1QX7 A;  2KGB C;  2PQL A;  1V1G A;  2BE4 A;  2P70 A;  1DQE A;  2KAY A;  1DJH A;  3SG3 A;  5AAN A;  4ETO A;  4XYN A;  1F54 A;  1UHH A;  1EH2 A;  1W9Z A;  1NCZ A;  1SCM C;  4YGE B;  1Y1X A;  2EGD A;  4MN0 A;  2AUC A;  1X02 A;  1NX1 A;  2GTE A;  3O78 A;  2LVI A;  2ZN9 A;  3NGV A;  2KHN A;  2L4I A;  1PRW A;  2CT9 A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  4JD9 A;  4NQG A;  4TNC A;  3VRO A;  3CGA A;  3CR4 X;  3PLF B;  1FI5 A;  1DJZ A;  1MHO A;  1QV0 A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3A8R A;  1CLM A;  2BKI B;  2M1K B;  1BJF A;  2G9B A;  2K60 A;  4ZCU A;  2M7L A;  2MLF C;  3JTD C;  3AKB A;  3PSR A;  1LA3 A;  1WLZ A;  1M31 A;  1KSO A;  2CCM A;  2QEH A;  5DKR A;  1S5G Z;  2CXJ A;  1WDC C;  3C1V A;  3SS4 A;  3VGO A;  5AFP A;  1CKK A;  1NUB A;  2PAS A;  2SCP A;  4DCK A;  4PE1 A;  5HKY A;  1NX2 A;  1Y1U A;  4NDD A;  1LKJ A;  1XFZ O;  2F8P A;  3D74 A;  1QTX A;  3JVT C;  1CLL A;  1XFX O;  1SCV A;  1RJV A;  2I2R E;  4DS7 A;  1UHI A;  2LAN A;  2OTG B;  4GGF C;  3PM2 A;  2WCB A;  2MBX A;  1J7O A;  1S26 D;  4JPZ B;  2JT3 A;  2L5X B;  3SG5 A;  3UO9 A;  2M0R A;  3D78 A;  3AAK A;  1EG4 A;  1KK8 B;  1K9K A;  1SBJ A;  2BCA A;  2P71 A;  2R2I A;  3DZT A;  3SG2 A;  2ERB A;  4DRW A;  2K7O A;  2K8M B;  3D10 A;  3IF7 A;  3L4A A;  1P28 A;  2M8U A;  2O5G A;  4ZCV A;  1ZAC A;  1QS7 A;  3VRQ A;  2LHI A;  1K96 A;  3BQ3 A;  2KLE A;  4QJ4 B;  1SNL A;  2F3Y A;  1B8R A;  2QEB A;  1CMF A;  1OQP A;  1ZUZ A;  2JRF A;  2LNK A;  2HET A;  1TTX A;  1CM1 A;  1JFJ A;  2OPO A;  4GGF A;  4MZK A;  2OS8 C;  3OX6 A;  1DTL A;  1QWV A;  1SKT A;  2I7A A;  3CZ1 A;  1K2H A;  1YVH A;  1QXP A;  4IJ7 A;  1NIW A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  3BJH A;  1FW4 A;  3LK0 A;  4FQT A;  2WOR A;  4GUK A;  4A4B A;  2BBN A;  3F45 A;  1YX7 A;  1KQM B;  1GQM A;  3R1O A;  5HYD A;  2OS8 B;  1QVI Z;  2KI6 D;  1U5I B;  4USL A;  1FPW A;  3ZNI A;  1MR8 A;  2LMT A;  5D69 A;  4OZD A;  2L2E A;  5J3X A;  1KK7 Z;  1KFX L;  1DJG A;  2COL B;  4GGN A;  1TN4 A;  4GPL B;  5CSI A;  1CFC A;  1U5I A;  2KDH A;  1OMV A;  2JUL A;  2MHH A;  1KCY A;  1R6P A;  3O4X A;  2JOJ A;  2CBL A;  1YVL A;  3B87 A;  1OMD A;  3EVU A;  2Y1N A;  2Y4Q A;  1TOP A;  1JC2 A;  3I5I B;  4MEW A;  1RRO A;  3KO0 A;  1K95 A;  4BY4 A;  5I2O A;  4HRH A;  1XFW O;  4MRX A;  1G33 A;  1XA5 A;  3CR5 X;  3D0Y B;  3UNW A;  4C0J A;  3EG5 B;  1HQV A;  4XJK B;  2LP3 A;  1JF0 A;  1F4Q A;  2F2P A;  2FJU B;  3WNX B;  4HRG A;  2WCL A;  1WRK A;  3OHM B;  5I2Q A;  1DEK A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2JNF A;  5DKN A;  4XJK A;  1SR6 C;  1S6C A;  3SG6 A;  5DKQ A;  4HSZ A;  1W7J B;  4YI9 A;  5BPJ A;  1TUZ A;  3LK1 A;  5KU1 A;  3FE6 A;  1M46 A;  1IRJ A;  2WCE A;  1IGV A;  1YUU A;  1C7V A;  1TRF A;  2LVK A;  2WND A;  4PE7 A;  4CID A;  3BFA A;  1DC1 A;  4NDC A;  1F4O A;  2L2C A;  1Z4H A;  4ICB A;  4PHJ A;  4PHN A;  1UHK A;  3L47 A;  1KWO B;  1S6I A;  4WQ2 A;  2I18 A;  2H2K A;  4I5L B;  1DJI A;  1QIV A;  4AQI A;  2K7B A;  3D76 A;  3TDI A;  1L7Z A;  5D3O A;  4FQO A;  3R1P A;  2P6B B;  3PJI A;  4E68 A;  1B1G A;  1PUL A;  2BL0 C;  2MLE C;  4INX A;  4YGD B;  4PCW A;  1SW8 A;  1RWY A;  1OZO A;  1YUT A;  1QAT A;  3IQO A;  1N0Y A;  2ZNE A;  1B8C A;  1NSH A;  1AUI B;  1TNX A;  2FOT A;  3BUN B;  1DGV A;  2KAV A;  3WHT B;  1TIZ A;  5FI6 A;  1T14 A;  1UUS A;  4MLW A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  3QME A;  1CM4 A;  1BT6 A;  1OE9 B;  1UWO A;  3BFH A;  4N1G A;  2L0P A;  2LUX A;  4WQ3 A;  4C0K A;  3NHI A;  1LVC D;  1MQ1 A;  2LP2 A;  1B4C A;  4NDB A;  1ZMZ A;  4MSP A;  1BMO A;  1SCM B;  3IQQ A;  3RLZ A;  1DGU A;  4ORA B;  1DVI A;  1QV1 A;  1QX2 A;  1B9A A;  2L4H A;  3LL8 B;  3D73 A;  1A2X A;  3KF9 A;  1BR1 B;  3BXK A;  3O6B A;  1IQ3 A;  3PAT A;  2JC2 A;  3SG7 A;  1DJW A;  1TNQ A;  2WC8 A;  1GM0 A;  3DVE A;  2NZ0 A;  3D75 A;  1CNP A;  3B7A A;  1NP8 A;  4BY5 A;  4JWQ A;  4CPV A;  3AKA A;  3JTD B;  1K93 D;  1J1E A;  1CFP A;  4I5J A;  1WDC B;  4YGC B;  2PMY A;  2MRD A;  2L5Y A;  2ZND A;  4GFT A;  1XK4 C;  2BCX A;  2I94 A;  3BYA A;  4QJ3 B;  4CFR A;  1ALW A;  3JVT B;  4GAO A;  3LLE A;  1C07 A;  2WC5 A;  3EK8 A;  3VRN A;  5HLO A;  4WRI A;  2LUC A;  2PYQ A;  1CLB A;  4C0L A;  1Y6W A;  1KSM A;  3EVV A;  3TUY C;  5HKZ A;  2WCJ A;  2M97 A;  1YTZ C;  1ORG A;  3PM8 A;  2QPT A;  1EL4 A;  2K0J A;  1J7P A;  3HX4 A;  4OV2 A;  1EJ3 A;  4M2Q A;  2L51 A;  1JSA A;  3DD4 A;  3KPX A;  2MA2 A;  2KBM A;  2WOS A;  1RFJ A;  2NCO A;  2PVB A;  3K1E A;  1IQ5 A;  4GNK B;  5CSF A;  2EC6 C;  1R2U A;  1JBA A;  2QEO A;  1XYD A;  1B7T Y;  2NCP A;  3NHT A;  2K7D A;  3SIB A;  3FWB A;  2A4J A;  2H61 C;  1E8A A;  1IKU A;  5ER4 X;  1Z2C B;  1DJX A;  4PE0 A;  1BOC A;  1A29 A;  5AER A;  2F33 A;  4MZL A;  1H4B A;  1G8I A;  3TDZ A;  2EC6 B;  2M3W A;  1V1F A;  1ODB A;  1CB1 A;  1GGZ A;  1NPQ A;  3TDU A;  2DOQ A;  1TNP A;  2D8N A;  3FIA A;  3PN7 C;  1K94 A;  3M0W A;  1YX8 A;  2KLD A;  1LA0 A;  2WCH A;  2ZRT A;  5HLV A;  5F6T A;  5PAL A;  3NXA A;  1IJ6 A;  1YUR A;  2BBM A;  3ZWH A;  3DVM A;  1XO5 A;  2QDI A;  3DYE A;  3MSE B;  1YR5 A;  3EK7 A;  3NSI A;  3O2P A;  5KTY A;  1SMG A;  1S6J A;  4MRY A;  1OZS A;  4MBE A;  5TNC A;  3SJS A;  3I5G C;  5FI7 A;  2LC5 A;  2FCD A;  4D1E A;  1QLS A;  5CPV A;  2M49 B;  5CSN A;  3QRX A;  1WRZ A;  2HPS A;  1L2O C;  1MUX A;  3KHE A;  2KFH A;  5ER5 A;  1C7W A;  3TS5 C;  1TUJ A;  3S0F A;  1DT7 B;  1G4Y R;  3L4L A;  4ORC B;  1PAL A;  1NCX A;  3B6X A;  5D7F A;  1BLQ A;  2HF5 A;  1M39 A;  2KQ6 A;  1KFU S;  3RZS A;  3BUM B;  2KI6 C;  1QAS A;  2M1U A;  2Y1M A;  1SL9 A;  3FE9 A;  1OOG A;  4PAL A;  1JUO A;  2BE6 A;  1S36 A;  1OMR A;  1A03 A;  1OOI X;  1SR6 B;  1A4P A;  1S5G Y;  3EK4 A;  3CLN A;  1AVS A;  1EXR A;  3GK4 X;  3TS5 B;  5AEQ A;  3EKJ A;  2KI4 C;  3I5H C;  1AJ5 A;  4P5O E;  2LVV A;  2Q91 A;  3BOW B;  3OX5 A;  1F71 A;  4R1E A;  2M9G A;  1PSB A;  3EKH A;  4I5K A;  1WY9 A;  1QJT A;  2KNE A;  2BEC A;  3CTN A;  3CZ2 A;  2G2B A;  2BCB A;  2HQ8 A;  3BOW A;  3S0E A;  4DIR A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  2QAC A;  2BKH B;  3LCP C;  5I8N A;  1N65 A;  5FI2 A;  2L50 A;  2BAP A;  2JPO A;  1J55 A;  2JQ6 A;  2LE9 B;  4FTG A;  3VB1 A;  2LLU A;  3D77 A;  2KBI A;  5I2L A;  3S0B A;  1OSA A;  3AAJ A;  2JXL A;  5K89 A;  3CYZ A;  2BL0 B;  1EG3 A;  2K2A A;  3A4U B;  3B86 A;  3OBV A;  5JOL A;  1K8U A;  3GOF A;  1PVA A;  4M2O A;  4OCI A;  3GK1 A;  2LVJ A;  5HKW A;  2KFF A;  2LHL A;  3BUO B;  3FS7 A;  2JT8 A;  4M2P A;  1J7Q A;  3RM1 A;  4UPG A;  1XFR A;  4OKH A;  2NLN A;  1JF2 A;  1K9P A;  2M7N A;  3I5F C;  3BFB A;  1FF1 A;  1N2D A;  1QIW A;  4A4C A;  1QX5 B;  5GQQ C; 
#chains in the Genus database with same CATH homology
 3KEV A;  4N5X A;  1LIN A;  1XFY O;  2KSP A;  4YBH B;  2JTT A;  2WCF A;  3FWC A;  1NX3 A;  1W7I B;  1CFF A;  1JFK A;  3OB1 B;  1PVB A;  2TN4 A;  2ZN8 A;  4L9M A;  2KQY A;  2MAZ A;  1KQV A;  4CLN A;  1K90 D;  1OOJ A;  1QLK A;  3CZT X;  1S1E A;  3OP0 A;  2JZI A;  1UHJ A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  4YGA A;  4AOM A;  3K21 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  2JWW A;  4OR9 B;  1KK7 Y;  4QJ5 B;  3NSO A;  2OTG C;  2E6W A;  1MXL C;  1YUS A;  2SAS A;  1BU3 A;  1FBV A;  1HT9 A;  1TCF A;  1RK9 A;  2GGM A;  2JXC A;  4U8D A;  1KK8 C;  2LMV A;  3TZ1 A;  2KGR A;  4JQ0 D;  1WRL A;  5FYX A;  1F8H A;  1A75 B;  1IG5 A;  1PK0 D;  2M29 A;  1CDM A;  2ZFD A;  5G08 A;  1XFU O;  1A75 A;  1LXF C;  2ISD A;  1UP5 A;  3ICB A;  2LMU A;  1NYA A;  2CTN A;  1NCY A;  1XK4 A;  2ZRS A;  4GBA A;  3TUY B;  1S3P A;  1J1D A;  4DUQ A;  1M45 A;  2LLT A;  1FI6 A;  1MF8 B;  2LAP A;  3BUW B;  1Y1A A;  1Y0V H;  1CDL A;  1CFD A;  1AJ4 A;  2K61 A;  2ZKM X;  1F54 A;  2K2F A;  3DF0 B;  2RGI A;  1KQM C;  4IL1 A;  1VRK A;  2PSR A;  2K7C A;  1BOD A;  1BR4 B;  4I5N B;  2PAL A;  4YRU A;  4F0Z B;  5CSJ A;  1UUR A;  3DF0 A;  1H8B A;  1KFX S;  2E30 A;  1F70 A;  1K9U A;  3NSK A;  1B47 A;  1UHN A;  3BUX B;  3VRP A;  1B8L A;  3GK2 A;  2H61 A;  2KFG A;  1Q80 A;  1SPY A;  1DF0 B;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  1AP4 A;  2F2O A;  3DVK A;  2GGZ A;  2JTZ A;  3I5I C;  3O4Y A;  4PHK A;  1M63 B;  1TNW A;  2LM5 A;  1SL7 A;  1CTR A;  4ORB B;  1SL8 A;  1DF0 A;  1CDN A;  1ZFS A;  2V53 A;  3PN7 B;  2LCP A;  4CFQ A;  3CWG A;  1CDP A;  1SYM A;  2JU0 A;  1CMG A;  3NSL A;  3SIA A;  1SRA A;  1MXE A;  1MWN A;  5KSZ A;  3SG4 A;  2GV5 A;  1JWD A;  3VRR A;  1IJ5 A;  3I5G B;  2O60 A;  2EHB A;  2B1U A;  1SY9 A;  2KAX A;  5AXI A;  1L2O B;  2Q4U A;  1GJY A;  1B7T Z;  1WLM A;  3CS1 A;  2JNX A;  1F55 A;  1NWD A;  2FCE A;  4OVN F;  1KFU L;  1KWO C;  1IWQ A;  1PSR A;  2LV7 A;  4PDZ A;  4AQJ A;  4N1F A;  3DVJ A;  1NX0 A;  4Q04 A;  1YRU B;  1REC A;  1ZOT B;  5B8I B;  2PRU A;  1BF5 A;  1RTP 1;  1SK6 D;  2NXQ A;  2KI4 B;  3CR2 A;  3I5H B;  3PAL A;  4YGB B;  1J7R A;  3WXA A;  5IBW A;  1D1O A;  1GGW A;  2KOT A;  3OB2 B;  2HQW A;  1BG1 A;  1QX7 A;  2KGB C;  1V1G A;  2BE4 A;  2KAY A;  1DJH A;  3SG3 A;  5AAN A;  4ETO A;  4XYN A;  1UHH A;  1EH2 A;  1NCZ A;  1SCM C;  4YGE B;  1Y1X A;  2EGD A;  4MN0 A;  2AUC A;  1X02 A;  1NX1 A;  3O78 A;  2LVI A;  2ZN9 A;  2KHN A;  2L4I A;  1PRW A;  2CT9 A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  4NQG A;  4TNC A;  3VRO A;  3CGA A;  3CR4 X;  3PLF B;  1FI5 A;  1DJZ A;  1MHO A;  1QV0 A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3A8R A;  1CLM A;  2BKI B;  2M1K B;  1BJF A;  2G9B A;  4ZCU A;  2M7L A;  2MLF C;  3JTD C;  3AKB A;  3PSR A;  1LA3 A;  1WLZ A;  1M31 A;  1KSO A;  2CCM A;  5DKR A;  1S5G Z;  2CXJ A;  1WDC C;  3C1V A;  3VGO A;  5AFP A;  1CKK A;  1NUB A;  2PAS A;  2SCP A;  4DCK A;  4PE1 A;  5HKY A;  1NX2 A;  1Y1U A;  4NDD A;  1LKJ A;  1XFZ O;  2F8P A;  1QTX A;  3JVT C;  1CLL A;  1XFX O;  1SCV A;  1RJV A;  2I2R E;  4DS7 A;  1UHI A;  2LAN A;  2OTG B;  4GGF C;  2WCB A;  2MBX A;  1J7O A;  1S26 D;  4JPZ B;  2JT3 A;  2L5X B;  3SG5 A;  2M0R A;  3AAK A;  1EG4 A;  1KK8 B;  1K9K A;  1SBJ A;  2BCA A;  2R2I A;  4DRW A;  3SG2 A;  5I2Q A;  2K7O A;  2K8M B;  3D10 A;  3IF7 A;  2M8U A;  2O5G A;  4ZCV A;  3VRQ A;  1ZAC A;  1QS7 A;  2LHI A;  1K96 A;  3BQ3 A;  4QJ4 B;  1SNL A;  2F3Y A;  1B8R A;  1CMF A;  1OQP A;  1ZUZ A;  2JRF A;  2LNK A;  2HET A;  1TTX A;  1CM1 A;  1JFJ A;  2OPO A;  4GGF A;  4MZK A;  2OS8 C;  3OX6 A;  1DTL A;  1SKT A;  2I7A A;  1K2H A;  1YVH A;  1QXP A;  1NIW A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  1FW4 A;  3LK0 A;  2WOR A;  4GUK A;  4A4B A;  2BBN A;  3F45 A;  1YX7 A;  1KQM B;  1GQM A;  5HYD A;  2OS8 B;  1QVI Z;  2KI6 D;  1U5I B;  4USL A;  1FPW A;  3ZNI A;  1MR8 A;  2LMT A;  5D69 A;  5J3X A;  2L2E A;  1KK7 Z;  2COL B;  1KFX L;  1DJG A;  4GGN A;  1TN4 A;  4GPL B;  5CSI A;  1CFC A;  1U5I A;  2KDH A;  1OMV A;  2JUL A;  2MHH A;  1KCY A;  1R6P A;  2JOJ A;  2CBL A;  1YVL A;  3EVU A;  1OMD A;  1JC2 A;  2Y1N A;  2Y4Q A;  1TOP A;  3I5I B;  4MEW A;  1RRO A;  3KO0 A;  1K95 A;  4BY4 A;  5I2O A;  4HRH A;  1XFW O;  4MRX A;  1G33 A;  1XA5 A;  3CR5 X;  3D0Y B;  4C0J A;  1HQV A;  4XJK B;  2LP3 A;  1JF0 A;  1F4Q A;  2F2P A;  2FJU B;  3WNX B;  4HRG A;  3OHM B;  1WRK A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2JNF A;  5DKN A;  4XJK A;  1SR6 C;  1S6C A;  3SG6 A;  5DKQ A;  4HSZ A;  1W7J B;  4YI9 A;  5BPJ A;  3LK1 A;  5KU1 A;  1M46 A;  1IRJ A;  2WCE A;  1IGV A;  1YUU A;  1C7V A;  1TRF A;  2LVK A;  2WND A;  4PE7 A;  4CID A;  4NDC A;  1F4O A;  4ICB A;  4PHJ A;  4PHN A;  1UHK A;  1KWO B;  1S6I A;  4WQ2 A;  2I18 A;  2H2K A;  4I5L B;  1DJI A;  1QIV A;  4AQI A;  2K7B A;  3TDI A;  1L7Z A;  4FQO A;  2P6B B;  4E68 A;  1PUL A;  2BL0 C;  2MLE C;  4YGD B;  4PCW A;  1SW8 A;  1RWY A;  1OZO A;  1YUT A;  1QAT A;  3IQO A;  1N0Y A;  2ZNE A;  1B8C A;  1NSH A;  1AUI B;  1TNX A;  2FOT A;  3BUN B;  1DGV A;  2KAV A;  3WHT B;  1TIZ A;  1UUS A;  4MLW A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  1CM4 A;  1BT6 A;  1OE9 B;  1UWO A;  4N1G A;  4WQ3 A;  2L0P A;  2LUX A;  4C0K A;  1LVC D;  1MQ1 A;  2LP2 A;  1B4C A;  4NDB A;  1ZMZ A;  4MSP A;  1BMO A;  1SCM B;  3IQQ A;  3RLZ A;  1DGU A;  4ORA B;  1DVI A;  1QV1 A;  1QX2 A;  1B9A A;  2L4H A;  3LL8 B;  1A2X A;  3KF9 A;  1BR1 B;  3BXK A;  3O6B A;  1IQ3 A;  3PAT A;  2JC2 A;  3SG7 A;  1DJW A;  1TNQ A;  2WC8 A;  3DVE A;  2NZ0 A;  1CNP A;  1NP8 A;  4BY5 A;  4JWQ A;  4CPV A;  3AKA A;  3JTD B;  1K93 D;  1J1E A;  1CFP A;  4I5J A;  1WDC B;  4YGC B;  2PMY A;  2MRD A;  2ZND A;  4GFT A;  1XK4 C;  2BCX A;  2I94 A;  3BYA A;  4QJ3 B;  4CFR A;  1ALW A;  3JVT B;  4GAO A;  3LLE A;  1C07 A;  3EK8 A;  3VRN A;  5HLO A;  4WRI A;  2LUC A;  1CLB A;  4C0L A;  1Y6W A;  1KSM A;  3EVV A;  3TUY C;  5HKZ A;  2M97 A;  1YTZ C;  3PM8 A;  2QPT A;  1EL4 A;  2K0J A;  1J7P A;  3HX4 A;  4OV2 A;  1EJ3 A;  4M2Q A;  2L51 A;  1JSA A;  3DD4 A;  3KPX A;  2MA2 A;  2KBM A;  2WOS A;  1RFJ A;  2NCO A;  2PVB A;  5CSF A;  1IQ5 A;  4GNK B;  2EC6 C;  1R2U A;  1JBA A;  1XYD A;  1B7T Y;  2NCP A;  2K7D A;  3SIB A;  3FWB A;  2A4J A;  2H61 C;  1E8A A;  1IKU A;  5ER4 X;  1DJX A;  4PE0 A;  1BOC A;  1A29 A;  5AER A;  2F33 A;  4MZL A;  1H4B A;  1G8I A;  3TDZ A;  2EC6 B;  2M3W A;  1V1F A;  1ODB A;  1CB1 A;  1GGZ A;  1NPQ A;  3TDU A;  2DOQ A;  1TNP A;  2D8N A;  3FIA A;  3PN7 C;  1K94 A;  3M0W A;  1YX8 A;  3WHU B;  1LA0 A;  2ZRT A;  5PAL A;  5HLV A;  5F6T A;  1B1G A;  3NXA A;  1IJ6 A;  1YUR A;  2BBM A;  3ZWH A;  3DVM A;  1XO5 A;  3MSE B;  3NSI A;  1YR5 A;  3EK7 A;  3O2P A;  5KTY A;  1SMG A;  1S6J A;  4MRY A;  1OZS A;  4MBE A;  5TNC A;  3SJS A;  3I5G C;  2LC5 A;  2FCD A;  4D1E A;  1QLS A;  5CPV A;  2M49 B;  5CSN A;  3QRX A;  1WRZ A;  2HPS A;  1L2O C;  1MUX A;  3KHE A;  2KFH A;  5ER5 A;  1C7W A;  3TS5 C;  1DT7 B;  1G4Y R;  4ORC B;  1PAL A;  1NCX A;  5D7F A;  1BLQ A;  2HF5 A;  1M39 A;  2KQ6 A;  1KFU S;  3BUM B;  2KI6 C;  1QAS A;  2M1U A;  2Y1M A;  1SL9 A;  4PAL A;  1JUO A;  2BE6 A;  1S36 A;  1OMR A;  1A03 A;  1SR6 B;  1A4P A;  1S5G Y;  3EK4 A;  3CLN A;  1AVS A;  1EXR A;  3GK4 X;  3TS5 B;  5AEQ A;  3EKJ A;  2KI4 C;  3I5H C;  1AJ5 A;  4P5O E;  2LVV A;  2Q91 A;  3BOW B;  3OX5 A;  1F71 A;  4R1E A;  2M9G A;  1PSB A;  3EKH A;  4I5K A;  1WY9 A;  1QJT A;  2KNE A;  2BEC A;  3CTN A;  2G2B A;  2BCB A;  2HQ8 A;  3BOW A;  4DIR A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  2QAC A;  2BKH B;  3LCP C;  5I8N A;  1N65 A;  2L50 A;  2LE9 B;  1J55 A;  2JQ6 A;  4FTG A;  2LLU A;  5I2L A;  2KBI A;  1OSA A;  3AAJ A;  2JXL A;  5K89 A;  2BL0 B;  1EG3 A;  2K2A A;  3A4U B;  5JOL A;  1K8U A;  3GOF A;  1PVA A;  4M2O A;  4OCI A;  3GK1 A;  2LVJ A;  5HKW A;  2KFF A;  2LHL A;  3BUO B;  3FS7 A;  2JT8 A;  4M2P A;  1J7Q A;  3RM1 A;  4UPG A;  4OKH A;  2NLN A;  1JF2 A;  1K9P A;  2M7N A;  3I5F C;  1FF1 A;  1N2D A;  1QIW A;  4A4C A;  1QX5 B;  5GQQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...