1WY9A

Crystal structure of microglia-specific protein, iba1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
KAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Allograft inflammatory factor 1
publication title X-ray Structures of the Microglia/Macrophage-specific Protein Iba1 from Human and Mouse Demonstrate Novel Molecular Conformation Change Induced by Calcium binding
pubmed doi rcsb
source organism Mus musculus
total genus 38
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2005-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1wy9A00
3KPXA 1SNLA 1SMGA 1WLZA 1QIWA 1K94A 2F3YA 1LKJA 2Y4QA 3OHMB 1M46A 1PSRA 1AJ4A 1BR4B 2JT3A 2K2AA 5J3XA 2I7AA 2Y1MA 2EGDA 1GJYA 1J1DA 1TCFA 3BUMB 3BQ3A 4GFTA 3SG3A 2KGRA 3D0YA 1S5GY 3GK4X 1CFDA 4YI9A 1XFVO 1C07A 2L5XB 3EVRA 2WNDA 2JC2A 2M97A 1K95A 1XFXO 1ALVA 2NLNA 4AOMA 2H61A 2ZNDA 4L9MA 5GQQC 3WHTB 5B8IB 1SL7A 1FI6A 2LMTA 2M8UA 2I94A 2K0JA 1DF0A 4XJKB 3HCMA 2BE4A 3TUYB 4AQIA 1BU3A 2TN4A 3FWCA 4ORBB 1B47A 2JZIA 4GBAA 1CLLA 1SKTA 1NPQA 2K2FA 2LVIA 1BODA 4USLA 1OZOA 4OV2A 2BBNA 1AUIB 1EXRA 1IWQA 5D69A 4PHMA 3WXAA 2A4JA 1G33A 1KFUS 2Q4UA 2KSPA 3CR2A 3DVEA 4XYNA 1Y1AA 4M2QA 1JWDA 1TNXA 1KCYA 3OB2B 3I5FC 5FYXA 2L98A 3WHUB 3WNXB 1FW4A 1NX0A 4N5XA 1DGVA 4GAOA 1H4BA 4AQJA 1QVIZ 3VROA 3E3RA 3RM1A 3VRRA 1SL9A 1KQVA 1ZMZA 1ZUZA 2E6WA 1F71A 1Y1XA 1S6JA 1K93D 1KFXS 2LP2A 5CSFA 2LAPA 5F6TA 5KU1A 1IKUA 4PE1A 2O5GA 1YUSA 1PULA 4MLWA 2EC6B 1DGUA 1QX2A 1GGWA 1UURA 2LC5A 1NX3A 2RGIA 3IQOA 1S3PA 2M49B 5JOLA 1LA0A 3A4UB 1N65A 1RFJA 2L51A 1NX1A 2EC6C 4OCIA 1J7QA 1F54A 1F8HA 1EH2A 2MJWB 1H8BA 1DT7B 1S1EA 2NCPA 2KGBC 2L4HA 3FIAA 1L2OB 4ETOA 1TNWA 5DKNA 1QLKA 1IJ5A 2F8PA 1YUTA 3OP0A 2ZFDA 2B1UA 2JOJA 1JC2A 5K89A 1J7OA 2NZ0A 2PMYA 3O2PA 2I2RE 5ER4X 1IGVA 1WDCB 1B7TZ 2L50A 3QRXA 3VGOA 3OB1B 2LCPA 1SR6B 4MSPA 4NDBA 1K9KA 3DVMA 4D1EA 1UHHA 1WDCC 4MZLA 3DVKA 2ZRSA 2SCPA 1AHRA 1K9UA 1SR6C 1K90D 3NXAA 4XJKA 4DS7A 2KI4B 3CGAA 4CFRA 2KFGA 2JQ6A 2F2OA 1A03A 3EVUA 1S36A 2KI4C 1YTZC 1SRAA 2KOTA 2CXJA 1IQ3A 1BJFA 1ZOTB 3PLFB 1NSHA 2K7OA 2VRGA 1RWYA 1S5GZ 3SG6A 2CT9A 2WORA 1UP5A 1CM4A 2JXLA 1M63B 2M9GA 2P6BB 3KHEA 4GGNA 4HSZA 2LUXA 2GGMA 4JWQA 1U5IB 2COLB 1V1GA 1W7JB 3PATA 1RK9A 1BF5A 3FWBA 1NUBA 1A2XA 3I5GB 1SCMB 1DVIA 1G8IA 1UHJA 2M3WA 1CKKA 3I5GC 4C0KA 3DVJA 1IG5A 1CFPA 4DUQA 3EK4A 1OMDA 2OTGB 1KK7Y 2AUCA 2LNKA 4YGDB 5TNCA 3BUNB 3TDZA 2FCDA 2BECA 4GUKA 1PALA 3DF0B 1CNPA 3SG2A 4PE4A 2PSRA 2D8NA 1XO5A 2K8MB 1TNQA 1CTRA 1Y0VH 2LMVA 2JXCA 2JRFA 2KAYA 1CFCA 3FS7A 3AKAA 1G4YR 4GGFC 3C1VA 2BKHB 2M0RA 1SPYA 5HKZA 2DOQA 3DD4A 4ZCUA 1L7ZA 1ZACA 2JT0A 2ZN8A 1B8RA 1KFUL 1OMVA 5KSZA 1R2UA 3CR4X 2K7DA 2KDHA 1A75B 1K8UA 1XVJA 1Y1UA 1DJZA 1GQMA 2M1UA 1KK8B 1AVSA 1MWNA 1FBVA 3JTDB 1KK8C 3BOWB 1J7PA 3EVVA 4NQGA 2L0PA 2LLSA 2LP3A 2R2IA 1JF0A 2MRDA 3JTDC 3GK1A 3TUYC 1KQMB 3IF7A 2WCBA 1XFUO 4ICBA 4MZJA 2I18A 1YX8A 1FPWA 1DJYA 4QJ4B 1KQMC 1ODBA 5PALA 1CDMA 1CMFA 4JQ0D 1OE9B 1U5IA 4WQ3A 1B9AA 1WRLA 1VRKA 1MR8A 4HRGA 2GV5A 1MQ1A 1QASA 4NDDA 2M7NA 1S6CA 3ZWHA 1QATA 4PHNA 4YGCB 3KO0A 5AEQA 5I2OA 1SK6D 4PHKA 4GPLB 1N2DA 1BT6A 1OOJA 1TRFA 5ER5A 5BPJA 3CTNA 4FTGA 4PALA 1XYDA 2JT8A 1V1FA 2MA2A 2PALA 4MN0A 4DRWA 3DF0A 2JULA 3VRNA 3AAJA 1RECA 2IS9A 2MAZA 3LL8B 2LV7A 1IRJA 3SG4A 4GGFA 2JPTA 5CPVA 5AANA 1MHOA 1EG4A 3CR5X 1M45A 3JVTB 3O78A 2PASA 2HF5A 5JJGA 1DMOA 5HKYA 1TOPA 1L2OC 1S26D 1K96A 3JVTC 3RLZA 3EK8A 1FI5A 3AKBA 4YGEB 1RROA 2ISDA 1SY9A 2V53A 2BCAA 4OKHA 1WRZA 1KK7Z 1A75A 5HYDA 3SJSA 1AJ5A 3BUOB 2WCFA 2KYFA 4MRYA 3M0WA 2KFFA 2LANA 1XK4C 2BL0B 3BOWA 3MSEB 1IJ6A 1NIWA 1R6PA 1NP8A 2MBXA 3GK2A 1NCYA 3O6BA 4C0JA 2BL0C 3BXKA 4C0LA 1JSAA 1JBAA 1NWDA 5CSIA 2M1KB 5HKWA 4ORCB 4I5JA 1SYMA 2FOTA 1NX2A 1UHNA 1YURA 5DKRA 1D1OA 5IBWA 1X02A 1Y6WA 2HQWA 4YRUA 1PK0D 5I2QA 3PFVA 1QJTA 1CDNA 2O60A 1BG1A 2JNXA 1XFWO 2K7BA 3I5IB 1TIZA 1JFKA 4CLNA 2JU0A 3I5IC 1SCMC 3PN7B 1DJWA 1EL4A 1DJHA 1QV1A 3HX4A 1B8CA 3H4SE 2LHIA 1LA3A 2HPSA 4N1GA 1M39A 1C7WA 1TCOB 1DJXA 3PN7C 2M29A 1OZSA 2OTGC 5KTYA 1IH0A 2F33A 1Q80A 2AAOA 3GOFA 3CZTX 2EHBA 1F70A 2ZRTA 4R1EA 1BOCA 1UHIA 1QXPA 1ALWA 3NSIA 2L2EA 3BUWB 1AK8A 1YR5A 2BCBA 4U8DA 3EKJA 4N1FA 1JF2A 2KBIA 1FF1A 5AXIA 3SG5A 1CFFA 4CPVA 5CSNA 3O4YA 4PHJA 1LVCD 2OPOA 2CCMA 3K21A 4P5OE 4I5NB 4PE7A 3ZNIA 4WQ2A 4MBEA 4CFQA 3CS1A 1J55A 1QS7A 1SCVA 1TNPA 1XK4A 1SW8A 4GNKB 4YGBB 1XA5A 1J1EA 1RTP1 1BMOA 1LINA 1UWOA 2PVBA 2NXQA 2Y1NA 1QV0A 1WLMA 4HRHA 4YI8A 4MZKA 1K2HA 1KFXL 2QPTA 2LM5A 4I5LB 1J7RA 4UPGA 1PRWA 1WY9A 2KYCA 2JTTA 2L4IA 3KF9A 4OVNF 4NDCA 2LLTA 3EKHA 4DCKA 1JFJA 3SIAA 2LVJA 2KHNA 1A29A 4ZCVA 3NSOA 2Q91A 1KSMA 2ZNEA 2KNEA 1F55A 5DKQA 1B4CA 1PVBA 2F2PA 1BR1B 3TS5B 2QACA 3LLEA 5HLVA 1F4QA 2KQYA 2LUCA 3I5HB 2KFHA 2LVKA 2MLEC 3TS5C 4F0ZB 1YRUB 3I5HC 3KEVA 1XFYO 3BYAA 3CWGA 3OX5A 2GGZA 2HQ8A 4MRXA 4ORAB 4A4CA 1CDLA 3F45A 1XFZO 2LHLA 3I5FB 1CLBA 1MXEA 5I2LA 2JNFA 1JUOA 1S6IA 3SIBA 4E68A 5G08A 2WOSA 4I5KA 1UUSA 5CSJA 1QIVA 1EG3A 2HETA 2JWWA 2AMIA 2CBLA 2LLUA 1YRTB 2KI6D 1KWOB 1CB1A 1BLQA 2F3ZA 2CTNA 4PCWA 4CIDA 2ZKMX 1W7IB 5I8NA 1KWOC 1IQ5A 4QJ3B 4BY4A 2G9BA 2JTZA 1MXLC 1F4OA 4WRIA 1DJGA 1MF8B 3PSRA 1RJVA 2G2BA 1LXFC 4M2OA 2LE9B 1OQPA 2K7CA 1HQVA 2MLFC 4M2PA 1C7VA 2E30A 3NSLA 1GGZA 1N0YA 1QX5B 3TDUA 1YUUA 2WCEA 1QLSA 4P2YB 1NCZA 2BKIB 3D10A 1CDPA 4MVFA 1E8AA 2BE6A 1SBJA 3BUXB 3D0YB 3VRPA 3LCPC 1K9PA 4HREE 3CLNA 1CM1A 2CNPA 1M31A 1OSAA 3NSKA 4DIRA 3LK0A 1HT9A 2MHHA 1YVLA 2PRUA 1B1GA 1TN4A 2FJUB 2KI6C 1WRKA 4IL1A 2ZN9A 1NYAA 3OX6A 4PDZA 1OMRA 2KBMA 3AAKA 1MUXA 1NCXA 3EK7A 1QVIY 1DF0B 2H61C 4YGAA 4A4BA 2LVVA 4YBHB 4JPZB 4MEWA 4BY5A 1UHKA 2Y5IA 4PE0A 1EJ3A 2K61A 3SG7A 2OS8B 2BCXA 3TDIA 3PM8A 1CLMA 4Q04A 2H2KA 1DTLA 2LMUA 2OS8C 2SASA 2FCEA 2KAVA 1ZFSA 5D7FA 1KSOA 4FQOA 1QX7A 1CMGA 2BBMA 3VRQA 3LK1A 1PSBA 1AP4A 1DJIA 2KAXA 4OR9B 3PALA 5AERA 1QTXA 3ICBA 5AFPA 1A4PA 1B8LA 4QJ5B 2NCOA 1YX7A 2WC8A 2M7LA 1SL8A 4TNCA 1TTXA 2KQ6A 3IQQA 3A8RA 1B7TY 5HLOA 3TZ1A 1PVAA 1YVHA
chains in the Genus database with same CATH superfamily
1W9ZA 3KPXA 1SNLA 1SMGA 1OOFA 1WLZA 1QIWA 1K94A 2ERBA 2F3YA 1LKJA 2Y4QA 3OHMB 1M46A 1PSRA 1AJ4A 1BR4B 2JT3A 2K2AA 5J3XA 3OGNA 2I7AA 2BNXA 2Y1MA 2EGDA 1GJYA 1J1DA 1TCFA 3BUMB 3BQ3A 4GFTA 3SG3A 3CYZA 2KGRA 3D0YA 1S5GY 3GK4X 3IVTA 1CFDA 4YI9A 1XFVO 1C07A 2L5XB 3EVRA 2WNDA 2JC2A 2M97A 1K95A 1XFXO 1ALVA 2NLNA 4AOMA 1P28A 3B86A 2H61A 2ZNDA 4L9MA 5GQQC 3WHTB 5B8IB 1SL7A 1FI6A 2LMTA 3CZ1A 2M8UA 2I94A 2K0JA 1DF0A 4XJKB 3HCMA 2BE4A 3TUYB 4AQIA 1BU3A 2TN4A 3FWCA 4ORBB 1B47A 2JZIA 2QEVA 4GBAA 3R1PA 5FI6A 1CLLA 1SKTA 1NPQA 4INXA 2K2FA 2LVIA 1BODA 4USLA 1IIOA 1TUZA 1OZOA 4OV2A 2BBNA 1AUIB 1DQEA 1EXRA 1IWQA 5D69A 4PHMA 3WXAA 2A4JA 3B6XA 1G33A 1KFUS 2Q4UA 2KSPA 3O4XA 3CR2A 3DVEA 4XYNA 1Y1AA 4M2QA 1JWDA 1TNXA 1KCYA 3OB2B 2L5YA 3I5FC 2L98A 5FYXA 3WHUB 1FW4A 1NX0A 3WNXB 4N5XA 1DGVA 4GAOA 1H4BA 4AQJA 1QVIZ 3VROA 1C3YA 3E3RA 3RM1A 3VRRA 1BOCA 1SL9A 1KQVA 3CDNA 1ZMZA 1ZUZA 2E6WA 1F71A 3FE6A 4JD9A 1Y1XA 1S6JA 1K93D 3B88A 1KFXS 2LP2A 5CSFA 2LAPA 2KPHA 5F6TA 5KU1A 1IKUA 4PE1A 2O5GA 1YUSA 4FQTA 1PULA 4MLWA 3SS4A 2EC6B 1DGUA 1Z4HA 1QX2A 1GGWA 1UURA 2LC5A 1NX3A 2RGIA 3IQOA 1S3PA 2M49B 5JOLA 1LA0A 3A4UB 1N65A 1RFJA 4INWA 2L51A 1NX1A 1QWVA 2EC6C 4OCIA 1J7QA 1F54A 1F8HA 1EH2A 2MJWB 1H8BA 1DT7B 1S1EA 2NCPA 2KGBC 2L4HA 3FIAA 1L2OB 4ETOA 1TNWA 5DKNA 1QLKA 1IJ5A 2F8PA 1YUTA 3OP0A 2ZFDA 2B1UA 2JOJA 1JC2A 5K89A 1J7OA 2NZ0A 2PMYA 3O2PA 2I2RE 3S0BA 5ER4X 1IGVA 1WDCB 1B7TZ 2L50A 3QRXA 3VGOA 3OB1B 2LCPA 1SR6B 4MSPA 4NDBA 1DEKA 1K9KA 2PYQA 3DVMA 4D1EA 1UHHA 1WDCC 4MZLA 3DVKA 2ZRSA 2SCPA 1AHRA 1K9UA 1SR6C 1K90D 3NXAA 4XJKA 4DS7A 2KI4B 3NGVA 3CGAA 4CFRA 2KFGA 2JQ6A 2F2OA 1A03A 3EVUA 3PJIA 1S36A 2KI4C 1YTZC 1TUJA 1SRAA 2KOTA 2CXJA 1IQ3A 1BJFA 1ZOTB 3PLFB 1NSHA 2K7OA 3SS5A 2VRGA 1RWYA 1S5GZ 4KYNA 3SG6A 2CT9A 2WORA 1UP5A 1CM4A 2JXLA 1M63B 2M9GA 2P6BB 3KHEA 4GGNA 4HSZA 2KLEA 2LUXA 2GGMA 4JWQA 1U5IB 2COLB 1V1GA 1W7JB 3PATA 2WCLA 2WCJA 1RK9A 1BF5A 3FWBA 3L47A 1NUBA 1OOGA 1A2XA 3I5GB 1SCMB 1DVIA 1G8IA 1UHJA 5FI2A 2M3WA 3OBVA 3I5GC 4C0KA 3DVJA 1IG5A 1CFPA 1CKKA 3L4AA 4DUQA 3EK4A 1OMDA 2OTGB 1KK7Y 2AUCA 3V2LA 2LNKA 4YGDB 5TNCA 3BUNB 3TDZA 2FCDA 2BECA 3DY9A 1PALA 4GUKA 3DF0B 1CNPA 3SG2A 1OW4A 4PE4A 3SS3A 2PSRA 2D8NA 1XO5A 2K8MB 1TNQA 1CTRA 3S0FA 1Y0VH 2LMVA 5I94A 2JXCA 2JRFA 2KAYA 1CFCA 3FS7A 3AKAA 1G4YR 2BAPA 2WCHA 2QEOA 4GGFC 3C1VA 2BKHB 2M0RA 1SPYA 3D77A 5HKZA 2DOQA 3DD4A 4ZCUA 1L7ZA 1ZACA 2JT0A 2QDIA 2ZN8A 1B8RA 1KFUL 1OMVA 5KSZA 1R2UA 3CR4X 2K7DA 3D73A 2KDHA 1A75B 1K8UA 1XVJA 1Y1UA 1DJZA 1GQMA 2M1UA 1KK8B 1XFRA 1AVSA 3D76A 2H8VA 1MWNA 1FBVA 3JTDB 1KK8C 3BOWB 3S0DA 3EVVA 1J7PA 3DXLA 4NQGA 2L0PA 2WCMA 2LLSA 2LP3A 2R2IA 1JF0A 2MRDA 3JTDC 3GK1A 3NHTA 3TUYC 1KQMB 3IF7A 2WCBA 1XFUO 4ICBA 4MZJA 2I18A 3VB1A 1YX8A 1FPWA 1DJYA 4QJ4B 1KQMC 1ODBA 5PALA 1CDMA 1CMFA 4JQ0D 5EL2A 2WC5A 1OE9B 3BFBA 1U5IA 4WQ3A 1B9AA 1WRLA 1VRKA 1MR8A 4HRGA 2GV5A 1MQ1A 1QASA 4NDDA 2FJYA 2M7NA 1S6CA 3ZWHA 1QATA 4PHNA 4YGCB 3KO0A 5AEQA 5I2OA 3FE8A 1SK6D 4PHKA 3NHIA 4IJ7A 4GPLB 1N2DA 1BT6A 1OOJA 1TRFA 5ER5A 5BPJA 3CTNA 4FTGA 4PALA 1XYDA 2JT8A 1V1FA 2MA2A 2PALA 4MN0A 4DRWA 3DF0A 2JULA 3VRNA 3AAJA 1RECA 3EG5B 2IS9A 3S0EA 2MAZA 3B7AA 3LL8B 2LV7A 1IRJA 3SG4A 4GGFA 2JPTA 5CPVA 5AANA 1MHOA 1EG4A 3CR5X 1M45A 3JVTB 3O78A 2PASA 2HF5A 5JJGA 1DMOA 5HKYA 1GM0A 1TOPA 1L2OC 1S26D 1K96A 3JVTC 3RLZA 3EK8A 1FI5A 3AKBA 4YGEB 1RROA 2ISDA 1SY9A 2V53A 2BCAA 4OKHA 1WRZA 1KK7Z 1A75A 5HYDA 3SJSA 1AJ5A 3BUOB 2PQLA 2WCFA 2YGUA 2KYFA 4MRYA 3Q8IA 3M0WA 2KFFA 2LANA 1XK4C 1SSEB 3RZSA 2BL0B 3BOWA 3BFHA 3BJHA 3MSEB 1IJ6A 1NIWA 1R6PA 1NP8A 2MBXA 3CABA 3GK2A 1C3ZA 1NCYA 3O6BA 4C0JA 2BL0C 3BXKA 2JPOA 4C0LA 1JSAA 1JBAA 1NWDA 5CSIA 2M1KB 5HKWA 4ORCB 4I5JA 1SYMA 2FOTA 1NX2A 1UHNA 1YURA 5DKRA 1D1OA 5IBWA 1X02A 1Y6WA 3UNWA 2HQWA 2KLDA 4YRUA 1PK0D 1Z2CB 5I2QA 3PFVA 1QJTA 1CDNA 2O60A 1BG1A 2JNXA 1XFWO 2K7BA 3I5IB 1TIZA 1JFKA 4CLNA 2JU0A 3B87A 3I5IC 1SCMC 3R1OA 3PN7B 1DJWA 1EL4A 1DJHA 1QV1A 3HX4A 1B8CA 3H4SE 2LHIA 1LA3A 2HPSA 4N1GA 1M39A 1C7WA 1TCOB 4OZDA 1DJXA 3FE9A 3PN7C 2M29A 4JKTA 1OZSA 2OTGC 5KTYA 1IH0A 1AK8A 2F33A 1Q80A 3R1VA 2AAOA 3GOFA 3CZTX 2EHBA 1F70A 2ZRTA 2K60A 4R1EA 1UHIA 1QXPA 1ALWA 1LS8A 2L2EA 3BUWB 3NSIA 1YR5A 2BCBA 2WC6A 4U8DA 3EKJA 4N1FA 1JF2A 2KBIA 3D74A 1FF1A 5AXIA 2QEHA 3SG5A 1CFFA 4CPVA 5CSNA 3O4YA 4PHJA 1LVCD 2OPOA 2CCMA 1DC1A 3K21A 4P5OE 4I5NB 4PE7A 3ZNIA 4WQ2A 4MBEA 3CZ2A 4CFQA 3CS1A 1J55A 1QS7A 4PT1A 1SCVA 1TNPA 1XK4A 1SW8A 4GNKB 4YGBB 1XA5A 1J1EA 1RTP1 1BMOA 1LINA 1UWOA 5DICA 2PVBA 2NXQA 2Y1NA 1QV0A 1WLMA 4HRHA 4YI8A 4MZKA 1K2HA 1KFXL 2QPTA 2LM5A 4I5LB 1J7RA 4UPGA 1PRWA 1WY9A 2KYCA 2JTTA 2L4IA 3K1EA 3KF9A 4OVNF 4NDCA 2LLTA 3S0GA 3EKHA 4DCKA 1JFJA 3SIAA 2LVJA 2KHNA 1A29A 4ZCVA 3NSOA 1OOIX 2Q91A 1KSMA 2ZNEA 2KNEA 3DYEA 1F55A 5DKQA 1B4CA 1PVBA 2F2PA 1BR1B 3TS5B 2QACA 3LLEA 5HLVA 1F4QA 2KQYA 2LUCA 3I5HB 2L2CA 2KFHA 2LVKA 2MLEC 3TS5C 4F0ZB 1T14A 1YRUB 3I5HC 3KEVA 1XFYO 3BYAA 3CWGA 3OX5A 2GGZA 2HQ8A 4MRXA 4ORAB 4A4CA 1CDLA 3F45A 1XFZO 2LHLA 3I5FB 1CLBA 1MXEA 5I2LA 2JNFA 1JUOA 1S6IA 3SIBA 4E68A 5G08A 2WOSA 4I5KA 1UUSA 5CSJA 1QIVA 1EG3A 2HETA 2JWWA 2AMIA 2CBLA 2LLUA 1YRTB 2KI6D 3BFAA 1KWOB 1CB1A 1BLQA 2F3ZA 2CTNA 4PCWA 4CIDA 2ZKMX 1W7IB 5I8NA 1KWOC 1IQ5A 3QMEA 4QJ3B 4BY4A 2G9BA 2JTZA 1MXLC 1F4OA 4WRIA 1DJGA 1MF8B 3PSRA 1RJVA 2G2BA 3UO9A 1LXFC 4M2OA 2LE9B 1OQPA 2K7CA 1HQVA 2MLFC 4M2PA 1C7VA 2E30A 3NSLA 1GGZA 1N0YA 1QX5B 3TDUA 3CZ0A 1YUUA 2WCEA 1QLSA 3N7HA 4P2YB 1NCZA 3DZTA 2BKIB 3D10A 1CDPA 4MVFA 1E8AA 2BE6A 1SBJA 3BUXB 3D0YB 2WCKA 3D75A 3LCPC 3VRPA 1K9PA 4HREE 3CLNA 1CM1A 2CNPA 1M31A 1OSAA 3NSKA 4DIRA 2P71A 3LK0A 4F7FA 1HT9A 2MHHA 1YVLA 2PRUA 2P70A 3PM2A 1B1GA 1TN4A 2FJUB 2KI6C 1WRKA 4IL1A 2ZN9A 1NYAA 5HL1A 3OX6A 4PDZA 1OMRA 2KBMA 3AAKA 1MUXA 1NCXA 3EK7A 1QVIY 1DF0B 2H61C 4YGAA 4A4BA 2LVVA 3S0AA 2GTEA 4YBHB 1DELA 4JPZB 4MEWA 4BY5A 1UHKA 2Y5IA 4PE0A 1EJ3A 2K61A 3SG7A 2OS8B 1OOHA 2BCXA 3TDIA 3PM8A 1CLMA 4Q04A 2H2KA 1DTLA 2LMUA 2OS8C 2SASA 2FCEA 2KAVA 1ZFSA 5D7FA 1KSOA 4FQOA 1QX7A 1CMGA 2BBMA 3D78A 1ORGA 3VRQA 3LK1A 1PSBA 5FI7A 1AP4A 1DJIA 2KAXA 4OR9B 3PALA 5AERA 3L4LA 1QTXA 1TWOA 3ICBA 5AFPA 1A4PA 1B8LA 4QJ5B 2QEBA 2NCOA 3R72A 1YX7A 2WC8A 2M7LA 1SL8A 4TNCA 1TTXA 2KQ6A 3IQQA 3A8RA 1B7TY 5HLOA 3TZ1A 1PVAA 5D3OA 1YVHA
chains in the Genus database with same CATH topology
3KPXA 1SNLA 1SMGA 1WLZA 1QIWA 1K94A 2F3YA 1LKJA 2Y4QA 3OHMB 1M46A 1PSRA 1AJ4A 1BR4B 2JT3A 2K2AA 5J3XA 2I7AA 2Y1MA 2EGDA 1GJYA 1J1DA 1TCFA 3BUMB 3BQ3A 4GFTA 3SG3A 2KGRA 3D0YA 1S5GY 3GK4X 1CFDA 4YI9A 1XFVO 1C07A 2L5XB 3EVRA 2WNDA 2JC2A 2M97A 1K95A 1XFXO 1ALVA 2NLNA 4AOMA 2H61A 2ZNDA 4L9MA 5GQQC 3WHTB 5B8IB 1SL7A 1FI6A 2LMTA 2M8UA 2I94A 2K0JA 1DF0A 4XJKB 3HCMA 2BE4A 3TUYB 4AQIA 1BU3A 2TN4A 3FWCA 4ORBB 1B47A 2JZIA 4GBAA 1CLLA 1SKTA 1NPQA 2K2FA 2LVIA 1BODA 4USLA 1OZOA 4OV2A 2BBNA 1AUIB 1EXRA 1IWQA 5D69A 4PHMA 3WXAA 2A4JA 1G33A 1KFUS 2Q4UA 2KSPA 3CR2A 3DVEA 4XYNA 1Y1AA 4M2QA 1JWDA 1TNXA 1KCYA 3OB2B 3I5FC 5FYXA 2L98A 3WHUB 3WNXB 1FW4A 1NX0A 4N5XA 1DGVA 4GAOA 1H4BA 4AQJA 1QVIZ 3VROA 3E3RA 3RM1A 3VRRA 1SL9A 1KQVA 1ZMZA 1ZUZA 2E6WA 1F71A 1Y1XA 1S6JA 1K93D 1KFXS 2LP2A 5CSFA 2LAPA 5F6TA 5KU1A 1IKUA 4PE1A 2O5GA 1YUSA 1PULA 4MLWA 2EC6B 1DGUA 1QX2A 1GGWA 1UURA 2LC5A 1NX3A 2RGIA 3IQOA 1S3PA 2M49B 5JOLA 1LA0A 3A4UB 1N65A 1RFJA 2L51A 1NX1A 2EC6C 4OCIA 1J7QA 1F54A 1F8HA 1EH2A 2MJWB 1H8BA 1DT7B 1S1EA 2NCPA 2KGBC 2L4HA 3FIAA 1L2OB 4ETOA 1TNWA 5DKNA 1QLKA 1IJ5A 2F8PA 1YUTA 3OP0A 2ZFDA 2B1UA 2JOJA 1JC2A 5K89A 1J7OA 2NZ0A 2PMYA 3O2PA 2I2RE 5ER4X 1IGVA 1WDCB 1B7TZ 2L50A 3QRXA 3VGOA 3OB1B 2LCPA 1SR6B 4MSPA 4NDBA 1K9KA 3DVMA 4D1EA 1UHHA 1WDCC 4MZLA 3DVKA 2ZRSA 2SCPA 1AHRA 1K9UA 1SR6C 1K90D 3NXAA 4XJKA 4DS7A 2KI4B 3CGAA 4CFRA 2KFGA 2JQ6A 2F2OA 1A03A 3EVUA 1S36A 2KI4C 1YTZC 1SRAA 2KOTA 2CXJA 1IQ3A 1BJFA 1ZOTB 3PLFB 1NSHA 2K7OA 2VRGA 1RWYA 1S5GZ 3SG6A 2CT9A 2WORA 1UP5A 1CM4A 2JXLA 1M63B 2M9GA 2P6BB 3KHEA 4GGNA 4HSZA 2LUXA 2GGMA 4JWQA 1U5IB 2COLB 1V1GA 1W7JB 3PATA 1RK9A 1BF5A 3FWBA 1NUBA 1A2XA 3I5GB 1SCMB 1DVIA 1G8IA 1UHJA 2M3WA 1CKKA 3I5GC 4C0KA 3DVJA 1IG5A 1CFPA 4DUQA 3EK4A 1OMDA 2OTGB 1KK7Y 2AUCA 2LNKA 4YGDB 5TNCA 3BUNB 3TDZA 2FCDA 2BECA 4GUKA 1PALA 3DF0B 1CNPA 3SG2A 4PE4A 2PSRA 2D8NA 1XO5A 2K8MB 1TNQA 1CTRA 1Y0VH 2LMVA 2JXCA 2JRFA 2KAYA 1CFCA 3FS7A 3AKAA 1G4YR 4GGFC 3C1VA 2BKHB 2M0RA 1SPYA 5HKZA 2DOQA 3DD4A 4ZCUA 1L7ZA 1ZACA 2JT0A 2ZN8A 1B8RA 1KFUL 1OMVA 5KSZA 1R2UA 3CR4X 2K7DA 2KDHA 1A75B 1K8UA 1XVJA 1Y1UA 1DJZA 1GQMA 2M1UA 1KK8B 1AVSA 1MWNA 1FBVA 3JTDB 1KK8C 3BOWB 1J7PA 3EVVA 4NQGA 2L0PA 2LLSA 2LP3A 2R2IA 1JF0A 2MRDA 3JTDC 3GK1A 3TUYC 1KQMB 3IF7A 2WCBA 1XFUO 4ICBA 4MZJA 2I18A 1YX8A 1FPWA 1DJYA 4QJ4B 1KQMC 1ODBA 5PALA 1CDMA 1CMFA 4JQ0D 1OE9B 1U5IA 4WQ3A 1B9AA 1WRLA 1VRKA 1MR8A 4HRGA 2GV5A 1MQ1A 1QASA 4NDDA 2M7NA 1S6CA 3ZWHA 1QATA 4PHNA 4YGCB 3KO0A 5AEQA 5I2OA 1SK6D 4PHKA 4GPLB 1N2DA 1BT6A 1OOJA 1TRFA 5ER5A 5BPJA 3CTNA 4FTGA 4PALA 1XYDA 2JT8A 1V1FA 2MA2A 2PALA 4MN0A 4DRWA 3DF0A 2JULA 3VRNA 3AAJA 1RECA 2IS9A 2MAZA 3LL8B 2LV7A 1IRJA 3SG4A 4GGFA 2JPTA 5CPVA 5AANA 1MHOA 1EG4A 3CR5X 1M45A 3JVTB 3O78A 2PASA 2HF5A 5JJGA 1DMOA 5HKYA 1TOPA 1L2OC 1S26D 1K96A 3JVTC 3RLZA 3EK8A 1FI5A 3AKBA 4YGEB 1RROA 2ISDA 1SY9A 2V53A 2BCAA 4OKHA 1WRZA 1KK7Z 1A75A 5HYDA 3SJSA 1AJ5A 3BUOB 2WCFA 2KYFA 4MRYA 3M0WA 2KFFA 2LANA 1XK4C 2BL0B 3BOWA 3MSEB 1IJ6A 1NIWA 1R6PA 1NP8A 2MBXA 3GK2A 1NCYA 3O6BA 4C0JA 2BL0C 3BXKA 4C0LA 1JSAA 1JBAA 1NWDA 5CSIA 2M1KB 5HKWA 4ORCB 4I5JA 1SYMA 2FOTA 1NX2A 1UHNA 1YURA 5DKRA 1D1OA 5IBWA 1X02A 1Y6WA 2HQWA 4YRUA 1PK0D 5I2QA 3PFVA 1QJTA 1CDNA 2O60A 1BG1A 2JNXA 1XFWO 2K7BA 3I5IB 1TIZA 1JFKA 4CLNA 2JU0A 3I5IC 1SCMC 3PN7B 1DJWA 1EL4A 1DJHA 1QV1A 3HX4A 1B8CA 3H4SE 2LHIA 1LA3A 2HPSA 4N1GA 1M39A 1C7WA 1TCOB 1DJXA 3PN7C 2M29A 1OZSA 2OTGC 5KTYA 1IH0A 2F33A 1Q80A 2AAOA 3GOFA 3CZTX 2EHBA 1F70A 2ZRTA 4R1EA 1BOCA 1UHIA 1QXPA 1ALWA 3NSIA 2L2EA 3BUWB 1AK8A 1YR5A 2BCBA 4U8DA 3EKJA 4N1FA 1JF2A 2KBIA 1FF1A 5AXIA 3SG5A 1CFFA 4CPVA 5CSNA 3O4YA 4PHJA 1LVCD 2OPOA 2CCMA 3K21A 4P5OE 4I5NB 4PE7A 3ZNIA 4WQ2A 4MBEA 4CFQA 3CS1A 1J55A 1QS7A 1SCVA 1TNPA 1XK4A 1SW8A 4GNKB 4YGBB 1XA5A 1J1EA 1RTP1 1BMOA 1LINA 1UWOA 2PVBA 2NXQA 2Y1NA 1QV0A 1WLMA 4HRHA 4YI8A 4MZKA 1K2HA 1KFXL 2QPTA 2LM5A 4I5LB 1J7RA 4UPGA 1PRWA 1WY9A 2KYCA 2JTTA 2L4IA 3KF9A 4OVNF 4NDCA 2LLTA 3EKHA 4DCKA 1JFJA 3SIAA 2LVJA 2KHNA 1A29A 4ZCVA 3NSOA 2Q91A 1KSMA 2ZNEA 2KNEA 1F55A 5DKQA 1B4CA 1PVBA 2F2PA 1BR1B 3TS5B 2QACA 3LLEA 5HLVA 1F4QA 2KQYA 2LUCA 3I5HB 2KFHA 2LVKA 2MLEC 3TS5C 4F0ZB 1YRUB 3I5HC 3KEVA 1XFYO 3BYAA 3CWGA 3OX5A 2GGZA 2HQ8A 4MRXA 4ORAB 4A4CA 1CDLA 3F45A 1XFZO 2LHLA 3I5FB 1CLBA 1MXEA 5I2LA 2JNFA 1JUOA 1S6IA 3SIBA 4E68A 5G08A 2WOSA 4I5KA 1UUSA 5CSJA 1QIVA 1EG3A 2HETA 2JWWA 2AMIA 2CBLA 2LLUA 1YRTB 2KI6D 1KWOB 1CB1A 1BLQA 2F3ZA 2CTNA 4PCWA 4CIDA 2ZKMX 1W7IB 5I8NA 1KWOC 1IQ5A 4QJ3B 4BY4A 2G9BA 2JTZA 1MXLC 1F4OA 4WRIA 1DJGA 1MF8B 3PSRA 1RJVA 2G2BA 1LXFC 4M2OA 2LE9B 1OQPA 2K7CA 1HQVA 2MLFC 4M2PA 1C7VA 2E30A 3NSLA 1GGZA 1N0YA 1QX5B 3TDUA 1YUUA 2WCEA 1QLSA 4P2YB 1NCZA 2BKIB 3D10A 1CDPA 4MVFA 1E8AA 2BE6A 1SBJA 3BUXB 3D0YB 3VRPA 3LCPC 1K9PA 4HREE 3CLNA 1CM1A 2CNPA 1M31A 1OSAA 3NSKA 4DIRA 3LK0A 1HT9A 2MHHA 1YVLA 2PRUA 1B1GA 1TN4A 2FJUB 2KI6C 1WRKA 4IL1A 2ZN9A 1NYAA 3OX6A 4PDZA 1OMRA 2KBMA 3AAKA 1MUXA 1NCXA 3EK7A 1QVIY 1DF0B 2H61C 4YGAA 4A4BA 2LVVA 4YBHB 4JPZB 4MEWA 4BY5A 1UHKA 2Y5IA 4PE0A 1EJ3A 2K61A 3SG7A 2OS8B 2BCXA 3TDIA 3PM8A 1CLMA 4Q04A 2H2KA 1DTLA 2LMUA 2OS8C 2SASA 2FCEA 2KAVA 1ZFSA 5D7FA 1KSOA 4FQOA 1QX7A 1CMGA 2BBMA 3VRQA 3LK1A 1PSBA 1AP4A 1DJIA 2KAXA 4OR9B 3PALA 5AERA 1QTXA 3ICBA 5AFPA 1A4PA 1B8LA 4QJ5B 2NCOA 1YX7A 2WC8A 2M7LA 1SL8A 4TNCA 1TTXA 2KQ6A 3IQQA 3A8RA 1B7TY 5HLOA 3TZ1A 1PVAA 1YVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPX A;  1SNL A;  1SMG A;  1WLZ A;  1QIW A;  1K94 A;  2F3Y A;  1LKJ A;  2Y4Q A;  3OHM B;  1M46 A;  1PSR A;  1AJ4 A;  1BR4 B;  2JT3 A;  2K2A A;  5J3X A;  2I7A A;  2Y1M A;  2EGD A;  1GJY A;  1J1D A;  1TCF A;  3BUM B;  3BQ3 A;  4GFT A;  3SG3 A;  2KGR A;  3D0Y A;  1S5G Y;  3GK4 X;  1CFD A;  4YI9 A;  1XFV O;  1C07 A;  2L5X B;  3EVR A;  2WND A;  2JC2 A;  2M97 A;  1K95 A;  1XFX O;  1ALV A;  2NLN A;  4AOM A;  2H61 A;  2ZND A;  4L9M A;  5GQQ C;  3WHT B;  5B8I B;  1SL7 A;  1FI6 A;  2LMT A;  2M8U A;  2I94 A;  2K0J A;  1DF0 A;  4XJK B;  3HCM A;  2BE4 A;  3TUY B;  4AQI A;  1BU3 A;  2TN4 A;  3FWC A;  4ORB B;  1B47 A;  2JZI A;  4GBA A;  1CLL A;  1SKT A;  1NPQ A;  2K2F A;  2LVI A;  1BOD A;  4USL A;  1OZO A;  4OV2 A;  2BBN A;  1AUI B;  1EXR A;  1IWQ A;  5D69 A;  4PHM A;  3WXA A;  2A4J A;  1G33 A;  1KFU S;  2Q4U A;  2KSP A;  3CR2 A;  3DVE A;  4XYN A;  1Y1A A;  4M2Q A;  1JWD A;  1TNX A;  1KCY A;  3OB2 B;  3I5F C;  5FYX A;  2L98 A;  3WHU B;  3WNX B;  1FW4 A;  1NX0 A;  4N5X A;  1DGV A;  4GAO A;  1H4B A;  4AQJ A;  1QVI Z;  3VRO A;  3E3R A;  3RM1 A;  3VRR A;  1SL9 A;  1KQV A;  1ZMZ A;  1ZUZ A;  2E6W A;  1F71 A;  1Y1X A;  1S6J A;  1K93 D;  1KFX S;  2LP2 A;  5CSF A;  2LAP A;  5F6T A;  5KU1 A;  1IKU A;  4PE1 A;  2O5G A;  1YUS A;  1PUL A;  4MLW A;  2EC6 B;  1DGU A;  1QX2 A;  1GGW A;  1UUR A;  2LC5 A;  1NX3 A;  2RGI A;  3IQO A;  1S3P A;  2M49 B;  5JOL A;  1LA0 A;  3A4U B;  1N65 A;  1RFJ A;  2L51 A;  1NX1 A;  2EC6 C;  4OCI A;  1J7Q A;  1F54 A;  1F8H A;  1EH2 A;  2MJW B;  1H8B A;  1DT7 B;  1S1E A;  2NCP A;  2KGB C;  2L4H A;  3FIA A;  1L2O B;  4ETO A;  1TNW A;  5DKN A;  1QLK A;  1IJ5 A;  2F8P A;  1YUT A;  3OP0 A;  2ZFD A;  2B1U A;  2JOJ A;  1JC2 A;  5K89 A;  1J7O A;  2NZ0 A;  2PMY A;  3O2P A;  2I2R E;  5ER4 X;  1IGV A;  1WDC B;  1B7T Z;  2L50 A;  3QRX A;  3VGO A;  3OB1 B;  2LCP A;  1SR6 B;  4MSP A;  4NDB A;  1K9K A;  3DVM A;  4D1E A;  1UHH A;  1WDC C;  4MZL A;  3DVK A;  2ZRS A;  2SCP A;  1AHR A;  1K9U A;  1SR6 C;  1K90 D;  3NXA A;  4XJK A;  4DS7 A;  2KI4 B;  3CGA A;  4CFR A;  2KFG A;  2JQ6 A;  2F2O A;  1A03 A;  3EVU A;  1S36 A;  2KI4 C;  1YTZ C;  1SRA A;  2KOT A;  2CXJ A;  1IQ3 A;  1BJF A;  1ZOT B;  3PLF B;  1NSH A;  2K7O A;  2VRG A;  1RWY A;  1S5G Z;  3SG6 A;  2CT9 A;  2WOR A;  1UP5 A;  1CM4 A;  2JXL A;  1M63 B;  2M9G A;  2P6B B;  3KHE A;  4GGN A;  4HSZ A;  2LUX A;  2GGM A;  4JWQ A;  1U5I B;  2COL B;  1V1G A;  1W7J B;  3PAT A;  1RK9 A;  1BF5 A;  3FWB A;  1NUB A;  1A2X A;  3I5G B;  1SCM B;  1DVI A;  1G8I A;  1UHJ A;  2M3W A;  1CKK A;  3I5G C;  4C0K A;  3DVJ A;  1IG5 A;  1CFP A;  4DUQ A;  3EK4 A;  1OMD A;  2OTG B;  1KK7 Y;  2AUC A;  2LNK A;  4YGD B;  5TNC A;  3BUN B;  3TDZ A;  2FCD A;  2BEC A;  4GUK A;  1PAL A;  3DF0 B;  1CNP A;  3SG2 A;  4PE4 A;  2PSR A;  2D8N A;  1XO5 A;  2K8M B;  1TNQ A;  1CTR A;  1Y0V H;  2LMV A;  2JXC A;  2JRF A;  2KAY A;  1CFC A;  3FS7 A;  3AKA A;  1G4Y R;  4GGF C;  3C1V A;  2BKH B;  2M0R A;  1SPY A;  5HKZ A;  2DOQ A;  3DD4 A;  4ZCU A;  1L7Z A;  1ZAC A;  2JT0 A;  2ZN8 A;  1B8R A;  1KFU L;  1OMV A;  5KSZ A;  1R2U A;  3CR4 X;  2K7D A;  2KDH A;  1A75 B;  1K8U A;  1XVJ A;  1Y1U A;  1DJZ A;  1GQM A;  2M1U A;  1KK8 B;  1AVS A;  1MWN A;  1FBV A;  3JTD B;  1KK8 C;  3BOW B;  1J7P A;  3EVV A;  4NQG A;  2L0P A;  2LLS A;  2LP3 A;  2R2I A;  1JF0 A;  2MRD A;  3JTD C;  3GK1 A;  3TUY C;  1KQM B;  3IF7 A;  2WCB A;  1XFU O;  4ICB A;  4MZJ A;  2I18 A;  1YX8 A;  1FPW A;  1DJY A;  4QJ4 B;  1KQM C;  1ODB A;  5PAL A;  1CDM A;  1CMF A;  4JQ0 D;  1OE9 B;  1U5I A;  4WQ3 A;  1B9A A;  1WRL A;  1VRK A;  1MR8 A;  4HRG A;  2GV5 A;  1MQ1 A;  1QAS A;  4NDD A;  2M7N A;  1S6C A;  3ZWH A;  1QAT A;  4PHN A;  4YGC B;  3KO0 A;  5AEQ A;  5I2O A;  1SK6 D;  4PHK A;  4GPL B;  1N2D A;  1BT6 A;  1OOJ A;  1TRF A;  5ER5 A;  5BPJ A;  3CTN A;  4FTG A;  4PAL A;  1XYD A;  2JT8 A;  1V1F A;  2MA2 A;  2PAL A;  4MN0 A;  4DRW A;  3DF0 A;  2JUL A;  3VRN A;  3AAJ A;  1REC A;  2IS9 A;  2MAZ A;  3LL8 B;  2LV7 A;  1IRJ A;  3SG4 A;  4GGF A;  2JPT A;  5CPV A;  5AAN A;  1MHO A;  1EG4 A;  3CR5 X;  1M45 A;  3JVT B;  3O78 A;  2PAS A;  2HF5 A;  5JJG A;  1DMO A;  5HKY A;  1TOP A;  1L2O C;  1S26 D;  1K96 A;  3JVT C;  3RLZ A;  3EK8 A;  1FI5 A;  3AKB A;  4YGE B;  1RRO A;  2ISD A;  1SY9 A;  2V53 A;  2BCA A;  4OKH A;  1WRZ A;  1KK7 Z;  1A75 A;  5HYD A;  3SJS A;  1AJ5 A;  3BUO B;  2WCF A;  2KYF A;  4MRY A;  3M0W A;  2KFF A;  2LAN A;  1XK4 C;  2BL0 B;  3BOW A;  3MSE B;  1IJ6 A;  1NIW A;  1R6P A;  1NP8 A;  2MBX A;  3GK2 A;  1NCY A;  3O6B A;  4C0J A;  2BL0 C;  3BXK A;  4C0L A;  1JSA A;  1JBA A;  1NWD A;  5CSI A;  2M1K B;  5HKW A;  4ORC B;  4I5J A;  1SYM A;  2FOT A;  1NX2 A;  1UHN A;  1YUR A;  5DKR A;  1D1O A;  5IBW A;  1X02 A;  1Y6W A;  2HQW A;  4YRU A;  1PK0 D;  5I2Q A;  3PFV A;  1QJT A;  1CDN A;  2O60 A;  1BG1 A;  2JNX A;  1XFW O;  2K7B A;  3I5I B;  1TIZ A;  1JFK A;  4CLN A;  2JU0 A;  3I5I C;  1SCM C;  3PN7 B;  1DJW A;  1EL4 A;  1DJH A;  1QV1 A;  3HX4 A;  1B8C A;  3H4S E;  2LHI A;  1LA3 A;  2HPS A;  4N1G A;  1M39 A;  1C7W A;  1TCO B;  1DJX A;  3PN7 C;  2M29 A;  1OZS A;  2OTG C;  5KTY A;  1IH0 A;  2F33 A;  1Q80 A;  2AAO A;  3GOF A;  3CZT X;  2EHB A;  1F70 A;  2ZRT A;  4R1E A;  1BOC A;  1UHI A;  1QXP A;  1ALW A;  3NSI A;  2L2E A;  3BUW B;  1AK8 A;  1YR5 A;  2BCB A;  4U8D A;  3EKJ A;  4N1F A;  1JF2 A;  2KBI A;  1FF1 A;  5AXI A;  3SG5 A;  1CFF A;  4CPV A;  5CSN A;  3O4Y A;  4PHJ A;  1LVC D;  2OPO A;  2CCM A;  3K21 A;  4P5O E;  4I5N B;  4PE7 A;  3ZNI A;  4WQ2 A;  4MBE A;  4CFQ A;  3CS1 A;  1J55 A;  1QS7 A;  1SCV A;  1TNP A;  1XK4 A;  1SW8 A;  4GNK B;  4YGB B;  1XA5 A;  1J1E A;  1RTP 1;  1BMO A;  1LIN A;  1UWO A;  2PVB A;  2NXQ A;  2Y1N A;  1QV0 A;  1WLM A;  4HRH A;  4YI8 A;  4MZK A;  1K2H A;  1KFX L;  2QPT A;  2LM5 A;  4I5L B;  1J7R A;  4UPG A;  1PRW A;  1WY9 A;  2KYC A;  2JTT A;  2L4I A;  3KF9 A;  4OVN F;  4NDC A;  2LLT A;  3EKH A;  4DCK A;  1JFJ A;  3SIA A;  2LVJ A;  2KHN A;  1A29 A;  4ZCV A;  3NSO A;  2Q91 A;  1KSM A;  2ZNE A;  2KNE A;  1F55 A;  5DKQ A;  1B4C A;  1PVB A;  2F2P A;  1BR1 B;  3TS5 B;  2QAC A;  3LLE A;  5HLV A;  1F4Q A;  2KQY A;  2LUC A;  3I5H B;  2KFH A;  2LVK A;  2MLE C;  3TS5 C;  4F0Z B;  1YRU B;  3I5H C;  3KEV A;  1XFY O;  3BYA A;  3CWG A;  3OX5 A;  2GGZ A;  2HQ8 A;  4MRX A;  4ORA B;  4A4C A;  1CDL A;  3F45 A;  1XFZ O;  2LHL A;  3I5F B;  1CLB A;  1MXE A;  5I2L A;  2JNF A;  1JUO A;  1S6I A;  3SIB A;  4E68 A;  5G08 A;  2WOS A;  4I5K A;  1UUS A;  5CSJ A;  1QIV A;  1EG3 A;  2HET A;  2JWW A;  2AMI A;  2CBL A;  2LLU A;  1YRT B;  2KI6 D;  1KWO B;  1CB1 A;  1BLQ A;  2F3Z A;  2CTN A;  4PCW A;  4CID A;  2ZKM X;  1W7I B;  5I8N A;  1KWO C;  1IQ5 A;  4QJ3 B;  4BY4 A;  2G9B A;  2JTZ A;  1MXL C;  1F4O A;  4WRI A;  1DJG A;  1MF8 B;  3PSR A;  1RJV A;  2G2B A;  1LXF C;  4M2O A;  2LE9 B;  1OQP A;  2K7C A;  1HQV A;  2MLF C;  4M2P A;  1C7V A;  2E30 A;  3NSL A;  1GGZ A;  1N0Y A;  1QX5 B;  3TDU A;  1YUU A;  2WCE A;  1QLS A;  4P2Y B;  1NCZ A;  2BKI B;  3D10 A;  1CDP A;  4MVF A;  1E8A A;  2BE6 A;  1SBJ A;  3BUX B;  3D0Y B;  3VRP A;  3LCP C;  1K9P A;  4HRE E;  3CLN A;  1CM1 A;  2CNP A;  1M31 A;  1OSA A;  3NSK A;  4DIR A;  3LK0 A;  1HT9 A;  2MHH A;  1YVL A;  2PRU A;  1B1G A;  1TN4 A;  2FJU B;  2KI6 C;  1WRK A;  4IL1 A;  2ZN9 A;  1NYA A;  3OX6 A;  4PDZ A;  1OMR A;  2KBM A;  3AAK A;  1MUX A;  1NCX A;  3EK7 A;  1QVI Y;  1DF0 B;  2H61 C;  4YGA A;  4A4B A;  2LVV A;  4YBH B;  4JPZ B;  4MEW A;  4BY5 A;  1UHK A;  2Y5I A;  4PE0 A;  1EJ3 A;  2K61 A;  3SG7 A;  2OS8 B;  2BCX A;  3TDI A;  3PM8 A;  1CLM A;  4Q04 A;  2H2K A;  1DTL A;  2LMU A;  2OS8 C;  2SAS A;  2FCE A;  2KAV A;  1ZFS A;  5D7F A;  1KSO A;  4FQO A;  1QX7 A;  1CMG A;  2BBM A;  3VRQ A;  3LK1 A;  1PSB A;  1AP4 A;  1DJI A;  2KAX A;  4OR9 B;  3PAL A;  5AER A;  1QTX A;  3ICB A;  5AFP A;  1A4P A;  1B8L A;  4QJ5 B;  2NCO A;  1YX7 A;  2WC8 A;  2M7L A;  1SL8 A;  4TNC A;  1TTX A;  2KQ6 A;  3IQQ A;  3A8R A;  1B7T Y;  5HLO A;  3TZ1 A;  1PVA A;  1YVH A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  3KPX A;  1SNL A;  1SMG A;  1OOF A;  1WLZ A;  1QIW A;  1K94 A;  2ERB A;  2F3Y A;  1LKJ A;  2Y4Q A;  3OHM B;  1M46 A;  1PSR A;  1AJ4 A;  1BR4 B;  2JT3 A;  2K2A A;  5J3X A;  3OGN A;  2I7A A;  2BNX A;  2Y1M A;  2EGD A;  1GJY A;  1J1D A;  1TCF A;  3BUM B;  3BQ3 A;  4GFT A;  3SG3 A;  3CYZ A;  2KGR A;  3D0Y A;  1S5G Y;  3GK4 X;  3IVT A;  1CFD A;  4YI9 A;  1XFV O;  1C07 A;  2L5X B;  3EVR A;  2WND A;  2JC2 A;  2M97 A;  1K95 A;  1XFX O;  1ALV A;  2NLN A;  4AOM A;  1P28 A;  3B86 A;  2H61 A;  2ZND A;  4L9M A;  5GQQ C;  3WHT B;  5B8I B;  1SL7 A;  1FI6 A;  2LMT A;  3CZ1 A;  2M8U A;  2I94 A;  2K0J A;  1DF0 A;  4XJK B;  3HCM A;  2BE4 A;  3TUY B;  4AQI A;  1BU3 A;  2TN4 A;  3FWC A;  4ORB B;  1B47 A;  2JZI A;  2QEV A;  4GBA A;  3R1P A;  5FI6 A;  1CLL A;  1SKT A;  1NPQ A;  4INX A;  2K2F A;  2LVI A;  1BOD A;  4USL A;  1IIO A;  1TUZ A;  1OZO A;  4OV2 A;  2BBN A;  1AUI B;  1DQE A;  1EXR A;  1IWQ A;  5D69 A;  4PHM A;  3WXA A;  2A4J A;  3B6X A;  1G33 A;  1KFU S;  2Q4U A;  2KSP A;  3O4X A;  3CR2 A;  3DVE A;  4XYN A;  1Y1A A;  4M2Q A;  1JWD A;  1TNX A;  1KCY A;  3OB2 B;  2L5Y A;  3I5F C;  2L98 A;  5FYX A;  3WHU B;  1FW4 A;  1NX0 A;  3WNX B;  4N5X A;  1DGV A;  4GAO A;  1H4B A;  4AQJ A;  1QVI Z;  3VRO A;  1C3Y A;  3E3R A;  3RM1 A;  3VRR A;  1BOC A;  1SL9 A;  1KQV A;  3CDN A;  1ZMZ A;  1ZUZ A;  2E6W A;  1F71 A;  3FE6 A;  4JD9 A;  1Y1X A;  1S6J A;  1K93 D;  3B88 A;  1KFX S;  2LP2 A;  5CSF A;  2LAP A;  2KPH A;  5F6T A;  5KU1 A;  1IKU A;  4PE1 A;  2O5G A;  1YUS A;  4FQT A;  1PUL A;  4MLW A;  3SS4 A;  2EC6 B;  1DGU A;  1Z4H A;  1QX2 A;  1GGW A;  1UUR A;  2LC5 A;  1NX3 A;  2RGI A;  3IQO A;  1S3P A;  2M49 B;  5JOL A;  1LA0 A;  3A4U B;  1N65 A;  1RFJ A;  4INW A;  2L51 A;  1NX1 A;  1QWV A;  2EC6 C;  4OCI A;  1J7Q A;  1F54 A;  1F8H A;  1EH2 A;  2MJW B;  1H8B A;  1DT7 B;  1S1E A;  2NCP A;  2KGB C;  2L4H A;  3FIA A;  1L2O B;  4ETO A;  1TNW A;  5DKN A;  1QLK A;  1IJ5 A;  2F8P A;  1YUT A;  3OP0 A;  2ZFD A;  2B1U A;  2JOJ A;  1JC2 A;  5K89 A;  1J7O A;  2NZ0 A;  2PMY A;  3O2P A;  2I2R E;  3S0B A;  5ER4 X;  1IGV A;  1WDC B;  1B7T Z;  2L50 A;  3QRX A;  3VGO A;  3OB1 B;  2LCP A;  1SR6 B;  4MSP A;  4NDB A;  1DEK A;  1K9K A;  2PYQ A;  3DVM A;  4D1E A;  1UHH A;  1WDC C;  4MZL A;  3DVK A;  2ZRS A;  2SCP A;  1AHR A;  1K9U A;  1SR6 C;  1K90 D;  3NXA A;  4XJK A;  4DS7 A;  2KI4 B;  3NGV A;  3CGA A;  4CFR A;  2KFG A;  2JQ6 A;  2F2O A;  1A03 A;  3EVU A;  3PJI A;  1S36 A;  2KI4 C;  1YTZ C;  1TUJ A;  1SRA A;  2KOT A;  2CXJ A;  1IQ3 A;  1BJF A;  1ZOT B;  3PLF B;  1NSH A;  2K7O A;  3SS5 A;  2VRG A;  1RWY A;  1S5G Z;  4KYN A;  3SG6 A;  2CT9 A;  2WOR A;  1UP5 A;  1CM4 A;  2JXL A;  1M63 B;  2M9G A;  2P6B B;  3KHE A;  4GGN A;  4HSZ A;  2KLE A;  2LUX A;  2GGM A;  4JWQ A;  1U5I B;  2COL B;  1V1G A;  1W7J B;  3PAT A;  2WCL A;  2WCJ A;  1RK9 A;  1BF5 A;  3FWB A;  3L47 A;  1NUB A;  1OOG A;  1A2X A;  3I5G B;  1SCM B;  1DVI A;  1G8I A;  1UHJ A;  5FI2 A;  2M3W A;  3OBV A;  3I5G C;  4C0K A;  3DVJ A;  1IG5 A;  1CFP A;  1CKK A;  3L4A A;  4DUQ A;  3EK4 A;  1OMD A;  2OTG B;  1KK7 Y;  2AUC A;  3V2L A;  2LNK A;  4YGD B;  5TNC A;  3BUN B;  3TDZ A;  2FCD A;  2BEC A;  3DY9 A;  1PAL A;  4GUK A;  3DF0 B;  1CNP A;  3SG2 A;  1OW4 A;  4PE4 A;  3SS3 A;  2PSR A;  2D8N A;  1XO5 A;  2K8M B;  1TNQ A;  1CTR A;  3S0F A;  1Y0V H;  2LMV A;  5I94 A;  2JXC A;  2JRF A;  2KAY A;  1CFC A;  3FS7 A;  3AKA A;  1G4Y R;  2BAP A;  2WCH A;  2QEO A;  4GGF C;  3C1V A;  2BKH B;  2M0R A;  1SPY A;  3D77 A;  5HKZ A;  2DOQ A;  3DD4 A;  4ZCU A;  1L7Z A;  1ZAC A;  2JT0 A;  2QDI A;  2ZN8 A;  1B8R A;  1KFU L;  1OMV A;  5KSZ A;  1R2U A;  3CR4 X;  2K7D A;  3D73 A;  2KDH A;  1A75 B;  1K8U A;  1XVJ A;  1Y1U A;  1DJZ A;  1GQM A;  2M1U A;  1KK8 B;  1XFR A;  1AVS A;  3D76 A;  2H8V A;  1MWN A;  1FBV A;  3JTD B;  1KK8 C;  3BOW B;  3S0D A;  3EVV A;  1J7P A;  3DXL A;  4NQG A;  2L0P A;  2WCM A;  2LLS A;  2LP3 A;  2R2I A;  1JF0 A;  2MRD A;  3JTD C;  3GK1 A;  3NHT A;  3TUY C;  1KQM B;  3IF7 A;  2WCB A;  1XFU O;  4ICB A;  4MZJ A;  2I18 A;  3VB1 A;  1YX8 A;  1FPW A;  1DJY A;  4QJ4 B;  1KQM C;  1ODB A;  5PAL A;  1CDM A;  1CMF A;  4JQ0 D;  5EL2 A;  2WC5 A;  1OE9 B;  3BFB A;  1U5I A;  4WQ3 A;  1B9A A;  1WRL A;  1VRK A;  1MR8 A;  4HRG A;  2GV5 A;  1MQ1 A;  1QAS A;  4NDD A;  2FJY A;  2M7N A;  1S6C A;  3ZWH A;  1QAT A;  4PHN A;  4YGC B;  3KO0 A;  5AEQ A;  5I2O A;  3FE8 A;  1SK6 D;  4PHK A;  3NHI A;  4IJ7 A;  4GPL B;  1N2D A;  1BT6 A;  1OOJ A;  1TRF A;  5ER5 A;  5BPJ A;  3CTN A;  4FTG A;  4PAL A;  1XYD A;  2JT8 A;  1V1F A;  2MA2 A;  2PAL A;  4MN0 A;  4DRW A;  3DF0 A;  2JUL A;  3VRN A;  3AAJ A;  1REC A;  3EG5 B;  2IS9 A;  3S0E A;  2MAZ A;  3B7A A;  3LL8 B;  2LV7 A;  1IRJ A;  3SG4 A;  4GGF A;  2JPT A;  5CPV A;  5AAN A;  1MHO A;  1EG4 A;  3CR5 X;  1M45 A;  3JVT B;  3O78 A;  2PAS A;  2HF5 A;  5JJG A;  1DMO A;  5HKY A;  1GM0 A;  1TOP A;  1L2O C;  1S26 D;  1K96 A;  3JVT C;  3RLZ A;  3EK8 A;  1FI5 A;  3AKB A;  4YGE B;  1RRO A;  2ISD A;  1SY9 A;  2V53 A;  2BCA A;  4OKH A;  1WRZ A;  1KK7 Z;  1A75 A;  5HYD A;  3SJS A;  1AJ5 A;  3BUO B;  2PQL A;  2WCF A;  2YGU A;  2KYF A;  4MRY A;  3Q8I A;  3M0W A;  2KFF A;  2LAN A;  1XK4 C;  1SSE B;  3RZS A;  2BL0 B;  3BOW A;  3BFH A;  3BJH A;  3MSE B;  1IJ6 A;  1NIW A;  1R6P A;  1NP8 A;  2MBX A;  3CAB A;  3GK2 A;  1C3Z A;  1NCY A;  3O6B A;  4C0J A;  2BL0 C;  3BXK A;  2JPO A;  4C0L A;  1JSA A;  1JBA A;  1NWD A;  5CSI A;  2M1K B;  5HKW A;  4ORC B;  4I5J A;  1SYM A;  2FOT A;  1NX2 A;  1UHN A;  1YUR A;  5DKR A;  1D1O A;  5IBW A;  1X02 A;  1Y6W A;  3UNW A;  2HQW A;  2KLD A;  4YRU A;  1PK0 D;  1Z2C B;  5I2Q A;  3PFV A;  1QJT A;  1CDN A;  2O60 A;  1BG1 A;  2JNX A;  1XFW O;  2K7B A;  3I5I B;  1TIZ A;  1JFK A;  4CLN A;  2JU0 A;  3B87 A;  3I5I C;  1SCM C;  3R1O A;  3PN7 B;  1DJW A;  1EL4 A;  1DJH A;  1QV1 A;  3HX4 A;  1B8C A;  3H4S E;  2LHI A;  1LA3 A;  2HPS A;  4N1G A;  1M39 A;  1C7W A;  1TCO B;  4OZD A;  1DJX A;  3FE9 A;  3PN7 C;  2M29 A;  4JKT A;  1OZS A;  2OTG C;  5KTY A;  1IH0 A;  1AK8 A;  2F33 A;  1Q80 A;  3R1V A;  2AAO A;  3GOF A;  3CZT X;  2EHB A;  1F70 A;  2ZRT A;  2K60 A;  4R1E A;  1UHI A;  1QXP A;  1ALW A;  1LS8 A;  2L2E A;  3BUW B;  3NSI A;  1YR5 A;  2BCB A;  2WC6 A;  4U8D A;  3EKJ A;  4N1F A;  1JF2 A;  2KBI A;  3D74 A;  1FF1 A;  5AXI A;  2QEH A;  3SG5 A;  1CFF A;  4CPV A;  5CSN A;  3O4Y A;  4PHJ A;  1LVC D;  2OPO A;  2CCM A;  1DC1 A;  3K21 A;  4P5O E;  4I5N B;  4PE7 A;  3ZNI A;  4WQ2 A;  4MBE A;  3CZ2 A;  4CFQ A;  3CS1 A;  1J55 A;  1QS7 A;  4PT1 A;  1SCV A;  1TNP A;  1XK4 A;  1SW8 A;  4GNK B;  4YGB B;  1XA5 A;  1J1E A;  1RTP 1;  1BMO A;  1LIN A;  1UWO A;  5DIC A;  2PVB A;  2NXQ A;  2Y1N A;  1QV0 A;  1WLM A;  4HRH A;  4YI8 A;  4MZK A;  1K2H A;  1KFX L;  2QPT A;  2LM5 A;  4I5L B;  1J7R A;  4UPG A;  1PRW A;  1WY9 A;  2KYC A;  2JTT A;  2L4I A;  3K1E A;  3KF9 A;  4OVN F;  4NDC A;  2LLT A;  3S0G A;  3EKH A;  4DCK A;  1JFJ A;  3SIA A;  2LVJ A;  2KHN A;  1A29 A;  4ZCV A;  3NSO A;  1OOI X;  2Q91 A;  1KSM A;  2ZNE A;  2KNE A;  3DYE A;  1F55 A;  5DKQ A;  1B4C A;  1PVB A;  2F2P A;  1BR1 B;  3TS5 B;  2QAC A;  3LLE A;  5HLV A;  1F4Q A;  2KQY A;  2LUC A;  3I5H B;  2L2C A;  2KFH A;  2LVK A;  2MLE C;  3TS5 C;  4F0Z B;  1T14 A;  1YRU B;  3I5H C;  3KEV A;  1XFY O;  3BYA A;  3CWG A;  3OX5 A;  2GGZ A;  2HQ8 A;  4MRX A;  4ORA B;  4A4C A;  1CDL A;  3F45 A;  1XFZ O;  2LHL A;  3I5F B;  1CLB A;  1MXE A;  5I2L A;  2JNF A;  1JUO A;  1S6I A;  3SIB A;  4E68 A;  5G08 A;  2WOS A;  4I5K A;  1UUS A;  5CSJ A;  1QIV A;  1EG3 A;  2HET A;  2JWW A;  2AMI A;  2CBL A;  2LLU A;  1YRT B;  2KI6 D;  3BFA A;  1KWO B;  1CB1 A;  1BLQ A;  2F3Z A;  2CTN A;  4PCW A;  4CID A;  2ZKM X;  1W7I B;  5I8N A;  1KWO C;  1IQ5 A;  3QME A;  4QJ3 B;  4BY4 A;  2G9B A;  2JTZ A;  1MXL C;  1F4O A;  4WRI A;  1DJG A;  1MF8 B;  3PSR A;  1RJV A;  2G2B A;  3UO9 A;  1LXF C;  4M2O A;  2LE9 B;  1OQP A;  2K7C A;  1HQV A;  2MLF C;  4M2P A;  1C7V A;  2E30 A;  3NSL A;  1GGZ A;  1N0Y A;  1QX5 B;  3TDU A;  3CZ0 A;  1YUU A;  2WCE A;  1QLS A;  3N7H A;  4P2Y B;  1NCZ A;  3DZT A;  2BKI B;  3D10 A;  1CDP A;  4MVF A;  1E8A A;  2BE6 A;  1SBJ A;  3BUX B;  3D0Y B;  2WCK A;  3D75 A;  3LCP C;  3VRP A;  1K9P A;  4HRE E;  3CLN A;  1CM1 A;  2CNP A;  1M31 A;  1OSA A;  3NSK A;  4DIR A;  2P71 A;  3LK0 A;  4F7F A;  1HT9 A;  2MHH A;  1YVL A;  2PRU A;  2P70 A;  3PM2 A;  1B1G A;  1TN4 A;  2FJU B;  2KI6 C;  1WRK A;  4IL1 A;  2ZN9 A;  1NYA A;  5HL1 A;  3OX6 A;  4PDZ A;  1OMR A;  2KBM A;  3AAK A;  1MUX A;  1NCX A;  3EK7 A;  1QVI Y;  1DF0 B;  2H61 C;  4YGA A;  4A4B A;  2LVV A;  3S0A A;  2GTE A;  4YBH B;  1DEL A;  4JPZ B;  4MEW A;  4BY5 A;  1UHK A;  2Y5I A;  4PE0 A;  1EJ3 A;  2K61 A;  3SG7 A;  2OS8 B;  1OOH A;  2BCX A;  3TDI A;  3PM8 A;  1CLM A;  4Q04 A;  2H2K A;  1DTL A;  2LMU A;  2OS8 C;  2SAS A;  2FCE A;  2KAV A;  1ZFS A;  5D7F A;  1KSO A;  4FQO A;  1QX7 A;  1CMG A;  2BBM A;  3D78 A;  1ORG A;  3VRQ A;  3LK1 A;  1PSB A;  5FI7 A;  1AP4 A;  1DJI A;  2KAX A;  4OR9 B;  3PAL A;  5AER A;  3L4L A;  1QTX A;  1TWO A;  3ICB A;  5AFP A;  1A4P A;  1B8L A;  4QJ5 B;  2QEB A;  2NCO A;  3R72 A;  1YX7 A;  2WC8 A;  2M7L A;  1SL8 A;  4TNC A;  1TTX A;  2KQ6 A;  3IQQ A;  3A8R A;  1B7T Y;  5HLO A;  3TZ1 A;  1PVA A;  5D3O A;  1YVH A; 
#chains in the Genus database with same CATH homology
 3KPX A;  1SNL A;  1SMG A;  1WLZ A;  1QIW A;  1K94 A;  2F3Y A;  1LKJ A;  2Y4Q A;  3OHM B;  1M46 A;  1PSR A;  1AJ4 A;  1BR4 B;  2JT3 A;  2K2A A;  5J3X A;  2I7A A;  2Y1M A;  2EGD A;  1GJY A;  1J1D A;  1TCF A;  3BUM B;  3BQ3 A;  4GFT A;  3SG3 A;  2KGR A;  3D0Y A;  1S5G Y;  3GK4 X;  1CFD A;  4YI9 A;  1XFV O;  1C07 A;  2L5X B;  3EVR A;  2WND A;  2JC2 A;  2M97 A;  1K95 A;  1XFX O;  1ALV A;  2NLN A;  4AOM A;  2H61 A;  2ZND A;  4L9M A;  5GQQ C;  3WHT B;  5B8I B;  1SL7 A;  1FI6 A;  2LMT A;  2M8U A;  2I94 A;  2K0J A;  1DF0 A;  4XJK B;  3HCM A;  2BE4 A;  3TUY B;  4AQI A;  1BU3 A;  2TN4 A;  3FWC A;  4ORB B;  1B47 A;  2JZI A;  4GBA A;  1CLL A;  1SKT A;  1NPQ A;  2K2F A;  2LVI A;  1BOD A;  4USL A;  1OZO A;  4OV2 A;  2BBN A;  1AUI B;  1EXR A;  1IWQ A;  5D69 A;  4PHM A;  3WXA A;  2A4J A;  1G33 A;  1KFU S;  2Q4U A;  2KSP A;  3CR2 A;  3DVE A;  4XYN A;  1Y1A A;  4M2Q A;  1JWD A;  1TNX A;  1KCY A;  3OB2 B;  3I5F C;  5FYX A;  2L98 A;  3WHU B;  3WNX B;  1FW4 A;  1NX0 A;  4N5X A;  1DGV A;  4GAO A;  1H4B A;  4AQJ A;  1QVI Z;  3VRO A;  3E3R A;  3RM1 A;  3VRR A;  1SL9 A;  1KQV A;  1ZMZ A;  1ZUZ A;  2E6W A;  1F71 A;  1Y1X A;  1S6J A;  1K93 D;  1KFX S;  2LP2 A;  5CSF A;  2LAP A;  5F6T A;  5KU1 A;  1IKU A;  4PE1 A;  2O5G A;  1YUS A;  1PUL A;  4MLW A;  2EC6 B;  1DGU A;  1QX2 A;  1GGW A;  1UUR A;  2LC5 A;  1NX3 A;  2RGI A;  3IQO A;  1S3P A;  2M49 B;  5JOL A;  1LA0 A;  3A4U B;  1N65 A;  1RFJ A;  2L51 A;  1NX1 A;  2EC6 C;  4OCI A;  1J7Q A;  1F54 A;  1F8H A;  1EH2 A;  2MJW B;  1H8B A;  1DT7 B;  1S1E A;  2NCP A;  2KGB C;  2L4H A;  3FIA A;  1L2O B;  4ETO A;  1TNW A;  5DKN A;  1QLK A;  1IJ5 A;  2F8P A;  1YUT A;  3OP0 A;  2ZFD A;  2B1U A;  2JOJ A;  1JC2 A;  5K89 A;  1J7O A;  2NZ0 A;  2PMY A;  3O2P A;  2I2R E;  5ER4 X;  1IGV A;  1WDC B;  1B7T Z;  2L50 A;  3QRX A;  3VGO A;  3OB1 B;  2LCP A;  1SR6 B;  4MSP A;  4NDB A;  1K9K A;  3DVM A;  4D1E A;  1UHH A;  1WDC C;  4MZL A;  3DVK A;  2ZRS A;  2SCP A;  1AHR A;  1K9U A;  1SR6 C;  1K90 D;  3NXA A;  4XJK A;  4DS7 A;  2KI4 B;  3CGA A;  4CFR A;  2KFG A;  2JQ6 A;  2F2O A;  1A03 A;  3EVU A;  1S36 A;  2KI4 C;  1YTZ C;  1SRA A;  2KOT A;  2CXJ A;  1IQ3 A;  1BJF A;  1ZOT B;  3PLF B;  1NSH A;  2K7O A;  2VRG A;  1RWY A;  1S5G Z;  3SG6 A;  2CT9 A;  2WOR A;  1UP5 A;  1CM4 A;  2JXL A;  1M63 B;  2M9G A;  2P6B B;  3KHE A;  4GGN A;  4HSZ A;  2LUX A;  2GGM A;  4JWQ A;  1U5I B;  2COL B;  1V1G A;  1W7J B;  3PAT A;  1RK9 A;  1BF5 A;  3FWB A;  1NUB A;  1A2X A;  3I5G B;  1SCM B;  1DVI A;  1G8I A;  1UHJ A;  2M3W A;  1CKK A;  3I5G C;  4C0K A;  3DVJ A;  1IG5 A;  1CFP A;  4DUQ A;  3EK4 A;  1OMD A;  2OTG B;  1KK7 Y;  2AUC A;  2LNK A;  4YGD B;  5TNC A;  3BUN B;  3TDZ A;  2FCD A;  2BEC A;  4GUK A;  1PAL A;  3DF0 B;  1CNP A;  3SG2 A;  4PE4 A;  2PSR A;  2D8N A;  1XO5 A;  2K8M B;  1TNQ A;  1CTR A;  1Y0V H;  2LMV A;  2JXC A;  2JRF A;  2KAY A;  1CFC A;  3FS7 A;  3AKA A;  1G4Y R;  4GGF C;  3C1V A;  2BKH B;  2M0R A;  1SPY A;  5HKZ A;  2DOQ A;  3DD4 A;  4ZCU A;  1L7Z A;  1ZAC A;  2JT0 A;  2ZN8 A;  1B8R A;  1KFU L;  1OMV A;  5KSZ A;  1R2U A;  3CR4 X;  2K7D A;  2KDH A;  1A75 B;  1K8U A;  1XVJ A;  1Y1U A;  1DJZ A;  1GQM A;  2M1U A;  1KK8 B;  1AVS A;  1MWN A;  1FBV A;  3JTD B;  1KK8 C;  3BOW B;  1J7P A;  3EVV A;  4NQG A;  2L0P A;  2LLS A;  2LP3 A;  2R2I A;  1JF0 A;  2MRD A;  3JTD C;  3GK1 A;  3TUY C;  1KQM B;  3IF7 A;  2WCB A;  1XFU O;  4ICB A;  4MZJ A;  2I18 A;  1YX8 A;  1FPW A;  1DJY A;  4QJ4 B;  1KQM C;  1ODB A;  5PAL A;  1CDM A;  1CMF A;  4JQ0 D;  1OE9 B;  1U5I A;  4WQ3 A;  1B9A A;  1WRL A;  1VRK A;  1MR8 A;  4HRG A;  2GV5 A;  1MQ1 A;  1QAS A;  4NDD A;  2M7N A;  1S6C A;  3ZWH A;  1QAT A;  4PHN A;  4YGC B;  3KO0 A;  5AEQ A;  5I2O A;  1SK6 D;  4PHK A;  4GPL B;  1N2D A;  1BT6 A;  1OOJ A;  1TRF A;  5ER5 A;  5BPJ A;  3CTN A;  4FTG A;  4PAL A;  1XYD A;  2JT8 A;  1V1F A;  2MA2 A;  2PAL A;  4MN0 A;  4DRW A;  3DF0 A;  2JUL A;  3VRN A;  3AAJ A;  1REC A;  2IS9 A;  2MAZ A;  3LL8 B;  2LV7 A;  1IRJ A;  3SG4 A;  4GGF A;  2JPT A;  5CPV A;  5AAN A;  1MHO A;  1EG4 A;  3CR5 X;  1M45 A;  3JVT B;  3O78 A;  2PAS A;  2HF5 A;  5JJG A;  1DMO A;  5HKY A;  1TOP A;  1L2O C;  1S26 D;  1K96 A;  3JVT C;  3RLZ A;  3EK8 A;  1FI5 A;  3AKB A;  4YGE B;  1RRO A;  2ISD A;  1SY9 A;  2V53 A;  2BCA A;  4OKH A;  1WRZ A;  1KK7 Z;  1A75 A;  5HYD A;  3SJS A;  1AJ5 A;  3BUO B;  2WCF A;  2KYF A;  4MRY A;  3M0W A;  2KFF A;  2LAN A;  1XK4 C;  2BL0 B;  3BOW A;  3MSE B;  1IJ6 A;  1NIW A;  1R6P A;  1NP8 A;  2MBX A;  3GK2 A;  1NCY A;  3O6B A;  4C0J A;  2BL0 C;  3BXK A;  4C0L A;  1JSA A;  1JBA A;  1NWD A;  5CSI A;  2M1K B;  5HKW A;  4ORC B;  4I5J A;  1SYM A;  2FOT A;  1NX2 A;  1UHN A;  1YUR A;  5DKR A;  1D1O A;  5IBW A;  1X02 A;  1Y6W A;  2HQW A;  4YRU A;  1PK0 D;  5I2Q A;  3PFV A;  1QJT A;  1CDN A;  2O60 A;  1BG1 A;  2JNX A;  1XFW O;  2K7B A;  3I5I B;  1TIZ A;  1JFK A;  4CLN A;  2JU0 A;  3I5I C;  1SCM C;  3PN7 B;  1DJW A;  1EL4 A;  1DJH A;  1QV1 A;  3HX4 A;  1B8C A;  3H4S E;  2LHI A;  1LA3 A;  2HPS A;  4N1G A;  1M39 A;  1C7W A;  1TCO B;  1DJX A;  3PN7 C;  2M29 A;  1OZS A;  2OTG C;  5KTY A;  1IH0 A;  2F33 A;  1Q80 A;  2AAO A;  3GOF A;  3CZT X;  2EHB A;  1F70 A;  2ZRT A;  4R1E A;  1BOC A;  1UHI A;  1QXP A;  1ALW A;  3NSI A;  2L2E A;  3BUW B;  1AK8 A;  1YR5 A;  2BCB A;  4U8D A;  3EKJ A;  4N1F A;  1JF2 A;  2KBI A;  1FF1 A;  5AXI A;  3SG5 A;  1CFF A;  4CPV A;  5CSN A;  3O4Y A;  4PHJ A;  1LVC D;  2OPO A;  2CCM A;  3K21 A;  4P5O E;  4I5N B;  4PE7 A;  3ZNI A;  4WQ2 A;  4MBE A;  4CFQ A;  3CS1 A;  1J55 A;  1QS7 A;  1SCV A;  1TNP A;  1XK4 A;  1SW8 A;  4GNK B;  4YGB B;  1XA5 A;  1J1E A;  1RTP 1;  1BMO A;  1LIN A;  1UWO A;  2PVB A;  2NXQ A;  2Y1N A;  1QV0 A;  1WLM A;  4HRH A;  4YI8 A;  4MZK A;  1K2H A;  1KFX L;  2QPT A;  2LM5 A;  4I5L B;  1J7R A;  4UPG A;  1PRW A;  1WY9 A;  2KYC A;  2JTT A;  2L4I A;  3KF9 A;  4OVN F;  4NDC A;  2LLT A;  3EKH A;  4DCK A;  1JFJ A;  3SIA A;  2LVJ A;  2KHN A;  1A29 A;  4ZCV A;  3NSO A;  2Q91 A;  1KSM A;  2ZNE A;  2KNE A;  1F55 A;  5DKQ A;  1B4C A;  1PVB A;  2F2P A;  1BR1 B;  3TS5 B;  2QAC A;  3LLE A;  5HLV A;  1F4Q A;  2KQY A;  2LUC A;  3I5H B;  2KFH A;  2LVK A;  2MLE C;  3TS5 C;  4F0Z B;  1YRU B;  3I5H C;  3KEV A;  1XFY O;  3BYA A;  3CWG A;  3OX5 A;  2GGZ A;  2HQ8 A;  4MRX A;  4ORA B;  4A4C A;  1CDL A;  3F45 A;  1XFZ O;  2LHL A;  3I5F B;  1CLB A;  1MXE A;  5I2L A;  2JNF A;  1JUO A;  1S6I A;  3SIB A;  4E68 A;  5G08 A;  2WOS A;  4I5K A;  1UUS A;  5CSJ A;  1QIV A;  1EG3 A;  2HET A;  2JWW A;  2AMI A;  2CBL A;  2LLU A;  1YRT B;  2KI6 D;  1KWO B;  1CB1 A;  1BLQ A;  2F3Z A;  2CTN A;  4PCW A;  4CID A;  2ZKM X;  1W7I B;  5I8N A;  1KWO C;  1IQ5 A;  4QJ3 B;  4BY4 A;  2G9B A;  2JTZ A;  1MXL C;  1F4O A;  4WRI A;  1DJG A;  1MF8 B;  3PSR A;  1RJV A;  2G2B A;  1LXF C;  4M2O A;  2LE9 B;  1OQP A;  2K7C A;  1HQV A;  2MLF C;  4M2P A;  1C7V A;  2E30 A;  3NSL A;  1GGZ A;  1N0Y A;  1QX5 B;  3TDU A;  1YUU A;  2WCE A;  1QLS A;  4P2Y B;  1NCZ A;  2BKI B;  3D10 A;  1CDP A;  4MVF A;  1E8A A;  2BE6 A;  1SBJ A;  3BUX B;  3D0Y B;  3VRP A;  3LCP C;  1K9P A;  4HRE E;  3CLN A;  1CM1 A;  2CNP A;  1M31 A;  1OSA A;  3NSK A;  4DIR A;  3LK0 A;  1HT9 A;  2MHH A;  1YVL A;  2PRU A;  1B1G A;  1TN4 A;  2FJU B;  2KI6 C;  1WRK A;  4IL1 A;  2ZN9 A;  1NYA A;  3OX6 A;  4PDZ A;  1OMR A;  2KBM A;  3AAK A;  1MUX A;  1NCX A;  3EK7 A;  1QVI Y;  1DF0 B;  2H61 C;  4YGA A;  4A4B A;  2LVV A;  4YBH B;  4JPZ B;  4MEW A;  4BY5 A;  1UHK A;  2Y5I A;  4PE0 A;  1EJ3 A;  2K61 A;  3SG7 A;  2OS8 B;  2BCX A;  3TDI A;  3PM8 A;  1CLM A;  4Q04 A;  2H2K A;  1DTL A;  2LMU A;  2OS8 C;  2SAS A;  2FCE A;  2KAV A;  1ZFS A;  5D7F A;  1KSO A;  4FQO A;  1QX7 A;  1CMG A;  2BBM A;  3VRQ A;  3LK1 A;  1PSB A;  1AP4 A;  1DJI A;  2KAX A;  4OR9 B;  3PAL A;  5AER A;  1QTX A;  3ICB A;  5AFP A;  1A4P A;  1B8L A;  4QJ5 B;  2NCO A;  1YX7 A;  2WC8 A;  2M7L A;  1SL8 A;  4TNC A;  1TTX A;  2KQ6 A;  3IQQ A;  3A8R A;  1B7T Y;  5HLO A;  3TZ1 A;  1PVA A;  1YVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...