2ZFDA

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/transferase
molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 69
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zfdA00
1G33A 2JNFA 3JTDB 2LAPA 5D7FA 1EG4A 4GGFA 1S5GY 2BE6A 2K7DA 2ZRTA 1FF1A 1J7OA 1BR4B 2HQ8A 3CTNA 1K93D 2JT8A 3TS5B 2LUXA 1UHHA 2SCPA 2OTGC 4PHNA 3DF0A 3VROA 1G4YR 2ZNDA 4MRYA 1DMOA 1B47A 2M8UA 1K94A 1J55A 2FCEA 4FTGA 3TDZA 1CFPA 3CWGA 3DF0B 5ER5A 1F70A 4DRWA 4CPVA 2RGIA 3KEVA 1XK4C 2BCBA 3JTDC 3TUYC 2ZN9A 4YRUA 5DKNA 1RWYA 3DVMA 1TIZA 3EKHA 1A75A 5FYXA 5AXIA 1NCXA 2LE9B 1B7TY 5K89A 5G08A 2LNKA 3TS5C 1OOJA 2CCMA 1GJYA 1IKUA 3WHUB 2JQ6A 1S36A 4PHKA 2JC2A 3GK1A 1CDLA 1JF0A 2M1UA 3CR5X 1KQVA 1IG5A 1Y1UA 1KFXS 1A2XA 3O4YA 4ZCVA 2JT3A 3FS7A 1OZOA 2BBMA 2KDHA 1BODA 2E6WA 2M97A 4OV2A 1H8BA 2ZNEA 1OMVA 2AUCA 2JZIA 2LMTA 1SKTA 4QJ5B 1KFUS 1WRLA 1W7IB 4NDDA 2TN4A 1TRFA 2PMYA 1NSHA 2KGBC 2LLUA 2WOSA 1BMOA 2JTTA 5HLVA 1QX5B 1KWOB 2KBIA 1MXEA 2BE4A 3VRRA 1NYAA 2I94A 2GGZA 1WLZA 2K2FA 4YI8A 2MHHA 1B8RA 5I2LA 2H61A 1K9PA 3LCPC 1DJGA 4WQ2A 2L5XB 2LVIA 1J7QA 1GQMA 1YVHA 1BLQA 1Y0VH 3K21A 1CDNA 3BUXB 1CFDA 3IQQA 1IQ5A 4HRGA 1KWOC 5AFPA 2ISDA 4N1GA 2OPOA 1M31A 3BUMB 2LP2A 1TNPA 1V1FA 3I5HB 1NX2A 1YRUB 3CGAA 3TDIA 1NPQA 2LLSA 2GGMA 1D1OA 2LHIA 1BF5A 3SG2A 1A03A 2OS8B 4HRHA 4ORBB 3OB2B 1TOPA 1H4BA 2L2EA 1YUTA 2M3WA 1NIWA 2CT9A 2BCAA 4C0KA 1F71A 3SG7A 1ZMZA 3RM1A 5IBWA 1CM1A 1QTXA 3BQ3A 1GGWA 3D0YB 2QPTA 2JNXA 5TNCA 4R1EA 1B8LA 4I5NB 2MAZA 4ETOA 1CMFA 1YUUA 5BPJA 3I5HC 4PHMA 1ALWA 1QATA 4MBEA 1Q80A 3OX6A 4I5JA 1K9KA 5AANA 1HT9A 2KAVA 2KQYA 1R6PA 2OS8C 1DT7B 3NSKA 1CDMA 1YX7A 2GV5A 2HETA 3AKBA 3I5IB 1DVIA 1Y6WA 4I5LB 4N5XA 2Y4QA 1DJYA 1R2UA 3O78A 1UP5A 1PVBA 2L98A 2MJWB 3BUOB 4C0LA 1YTZC 3TUYB 1IJ5A 1YUSA 2R2IA 4CFRA 2M0RA 2L4IA 1NUBA 4HREE 2JOJA 2MBXA 2JWWA 4PE0A 3WXAA 4QJ4B 1MWNA 5HKYA 5KU1A 2AMIA 1SRAA 5HKZA 1MXLC 4M2QA 1J1DA 2L50A 3SIBA 3ZNIA 3I5IC 3M0WA 1F54A 1TN4A 4P2YB 1BU3A 4MLWA 2FJUB 3TDUA 2PALA 1JBAA 3SG3A 1TNWA 1BG1A 2P6BB 3FWCA 1LA0A 1UHKA 1ZACA 1K90D 2CXJA 2A4JA 2KNEA 1XYDA 1LA3A 2VRGA 2M7LA 4GGFC 1L2OB 3OX5A 2MRDA 3PATA 1TCFA 1QVIZ 1DJZA 1A75B 1CLLA 1IGVA 1RROA 2JT0A 1Y1XA 3LK0A 4WRIA 1X02A 3NXAA 1FPWA 1B9AA 2NZ0A 2K0JA 1PK0D 2LVVA 2WNDA 1QXPA 1AJ5A 2HQWA 1FW4A 1SK6D 3EKJA 4BY4A 2KFFA 1EXRA 2M7NA 4GGNA 4GAOA 2NCOA 2BBNA 2PRUA 4OR9B 1RJVA 3IQOA 3VRQA 3SG6A 1QX7A 2FCDA 1MF8B 1KCYA 1L2OC 2KOTA 1XFWO 3KO0A 1NX1A 2AAOA 3GK4X 1KK7Y 1QS7A 2QACA 1UHJA 2WC8A 4L9MA 1K95A 4NDBA 2MA2A 1SYMA 2HPSA 2LHLA 4YBHB 1U5IA 1J7PA 1MQ1A 2LMUA 1PSRA 2DOQA 2ZN8A 4M2PA 4YGDB 1YURA 2K61A 3VRNA 1SW8A 1C7WA 3EVVA 2HF5A 1PRWA 2JPTA 1IJ6A 2ZRSA 1K96A 4AOMA 3EK7A 3PFVA 4DS7A 1S5GZ 1PALA 3AAJA 4PALA 1CFCA 4CIDA 2L0PA 1XFVO 2JXCA 2CTNA 3WNXB 1QJTA 1DF0A 4PDZA 2F3YA 2JU0A 1ALVA 4ORCB 4QJ3B 4XJKA 3SJSA 1OSAA 2PASA 5I2OA 2V53A 1JF2A 1BT6A 1TNQA 2CBLA 1SMGA 3ICBA 5CSJA 2KI6C 3PLFB 1CKKA 2LVKA 3C1VA 5JOLA 2K7OA 1AK8A 3EVRA 4BY5A 1L7ZA 4JQ0D 1KSOA 3O2PA 4MRXA 3DVEA 4JPZB 4MZLA 1AHRA 1PULA 2L51A 3O6BA 4DIRA 3D10A 2IS9A 1B7TZ 1B8CA 1NX0A 2H61C 1NCYA 1N65A 1M46A 3I5FB 2Y1NA 4YGCB 5I8NA 1EJ3A 1WRKA 2KAXA 3TZ1A 1RECA 1AVSA 3NSLA 4MZKA 4YGAA 1BOCA 2G9BA 5I2QA 1UHNA 3SIAA 1YX8A 2Y1MA 3CR4X 1OE9B 1JFKA 5HLOA 1NWDA 1M63B 1QV1A 3PM8A 1UHIA 2K7BA 1PVAA 5DKRA 1XA5A 2MLEC 2I2RE 2KI6D 1FI6A 1OZSA 1UURA 2H2KA 2LCPA 3CR2A 1CTRA 1ODBA 5DKQA 3I5FC 1K2HA 1S3PA 3BOWA 1WDCB 1AP4A 3KHEA 2EC6B 1CLBA 2WCFA 1SCVA 2EHBA 1QLSA 1SR6B 1WRZA 1DJHA 1RTP1 2F8PA 2MLFC 3VRPA 5KTYA 2BECA 2KYCA 2WCBA 1N0YA 2K7CA 2WCEA 4USLA 3MSEB 1IQ3A 1F55A 3F45A 1XO5A 4OKHA 1XK4A 1OMDA 1EH2A 1Y1AA 1YRTB 2NLNA 2F3ZA 1PSBA 2WORA 1WDCC 1CM4A 2SASA 2BKHB 2M9GA 2EC6C 3KF9A 1A4PA 2K8MB 3SG4A 4P5OE 4E68A 1XFYO 1A29A 1SR6C 1B4CA 1CNPA 1G8IA 1SNLA 3SG5A 1IH0A 1XVJA 1TNXA 2LC5A 1BR1B 2KGRA 1NX3A 2M49B 2NXQA 1RFJA 5PALA 1DTLA 2KSPA 3RLZA 2PVBA 1XFXO 1LINA 1SL8A 1B1GA 1DGUA 2JULA 2G2BA 1F8HA 1K8UA 3A4UB 1DJWA 1WY9A 3NSOA 3GK2A 3AAKA 2KQ6A 2Y5IA 4YGBB 3EK8A 5GQQC 3OP0A 1F4OA 4ORAB 3LLEA 1SCMB 4AQIA 3HCMA 2BKIB 1QV0A 4TNCA 2LV7A 3A8RA 2LANA 4NQGA 1S1EA 1LVCD 1S6IA 2Q91A 2L4HA 4PCWA 1SL7A 4U8DA 2E30A 5ER4X 3PALA 1KFXL 2LP3A 4Q04A 3H4SE 4YI9A 4MEWA 1W7JB 1SPYA 3BYAA 4NDCA 4M2OA 1M39A 1QLKA 3HX4A 1K9UA 3OHMB 4ICBA 4DUQA 1M45A 2B1UA 3QRXA 4IL1A 2LMVA 3DD4A 4CLNA 2ZKMX 4YGEB 3AKAA 5JJGA 1SCMC 1U5IB 3BXKA 4MZJA 1JSAA 1NCZA 2I18A 2LLTA 4GNKB 2O60A 3IF7A 1KFUL 1AJ4A 5J3XA 1KSMA 1N2DA 4A4BA 1QIWA 4CFQA 3E3RA 5CPVA 1BJFA 2M1KB 4GUKA 1JUOA 1CFFA 1YR5A 3VGOA 1SL9A 4OCIA 1FI5A 2KFHA 1TCOB 1CDPA 2I7AA 5KSZA 4PHJA 3DVJA 3FWBA 1DF0B 1MUXA 1GGZA 2BCXA 1OMRA 2ZFDA 1CB1A 1TTXA 4MSPA 5AEQA 5HYDA 1XFUO 4XJKB 4FQOA 4JWQA 1VRKA 2CNPA 1ZFSA 5CSNA 3DVKA 1KQMB 4GBAA 1J7RA 2LVJA 2K2AA 1C07A 1EL4A 3PSRA 1S6CA 1SBJA 4HSZA 3PN7B 5AERA 1QIVA 2Q4UA 4MN0A 3CS1A 5B8IB 1IRJA 2D8NA 4I5KA 1CMGA 1ZUZA 4DCKA 1XFZO 3EVUA 3WHTB 4ZCUA 1MHOA 2KHNA 1ZOTB 2KYFA 4A4CA 2BL0B 1UUSA 1C7VA 1CLMA 5CSIA 1LKJA 4N1FA 1MR8A 1OQPA 1DJIA 2COLB 1V1GA 1J1EA 1KQMC 2KAYA 2EGDA 2LUCA 5F6TA 1DJXA 1QVIY 2O5GA 5D69A 1UWOA 3PN7C 1HQVA 3BUWB 4UPGA 2F2OA 4OVNF 1FBVA 1DGVA 1JC2A 2KI4B 3I5GB 1EG3A 3FIAA 1NP8A 2KBMA 1KK8B 3D0YA 5CSFA 1KK7Z 5HKWA 2FOTA 1S26D 2BL0C 4PE7A 3JVTB 4F0ZB 1SY9A 2M29A 1QASA 1F4QA 2KFGA 1LXFC 2F33A 3BOWB 3EK4A 1WLMA 4AQJA 3ZWHA 1JFJA 2F2PA 1AUIB 3BUNB 4XYNA 4MVFA 2NCPA 4PE4A 3GOFA 2OTGB 2LM5A 3LL8B 3NSIA 2KI4C 3I5GC 3LK1A 1S6JA 1JWDA 4PE1A 1QX2A 3CZTX 4WQ3A 4D1EA 1KK8C 2PSRA 3KPXA 3OB1B 4GFTA 4GPLB 2JTZA 1E8AA 1YVLA 2JRFA 3JVTC 1RK9A 1IWQA 2JXLA 3CLNA 4C0JA
chains in the Genus database with same CATH superfamily
1G33A 2JNFA 3JTDB 2LAPA 2WC6A 5D7FA 1EG4A 4GGFA 1S5GY 2BE6A 2K7DA 2ZRTA 1FF1A 1J7OA 1BR4B 2HQ8A 3CABA 3CTNA 1K93D 2JT8A 3TS5B 2LUXA 1UHHA 2SCPA 2OTGC 4PHNA 3DF0A 3VROA 1G4YR 2ZNDA 3K1EA 4MRYA 1DMOA 1B47A 2M8UA 1K94A 1J55A 2FCEA 4FTGA 3TDZA 3S0DA 3CWGA 1CFPA 3DF0B 3S0EA 5ER5A 1F70A 4DRWA 3D75A 4CPVA 2RGIA 3KEVA 1XK4C 2BCBA 3JTDC 3TUYC 2ZN9A 4YRUA 4PT1A 5DKNA 5I94A 1RWYA 3DVMA 1TIZA 3EKHA 1A75A 3DY9A 5FYXA 1NCXA 2LE9B 1B7TY 5AXIA 5G08A 2LNKA 1LS8A 1OOJA 2CCMA 3TS5C 1GJYA 1IKUA 3WHUB 2JQ6A 1S36A 4PHKA 2JC2A 3GK1A 1CDLA 1JF0A 2M1UA 3CR5X 1KQVA 1IG5A 1Y1UA 1KFXS 1A2XA 3O4YA 4ZCVA 2JT3A 3FS7A 1OZOA 2BBMA 2WCHA 2KDHA 3D73A 2E6WA 2M97A 3SS4A 3FE8A 1BODA 4OV2A 1H8BA 2ZNEA 1OMVA 2AUCA 2JZIA 2LMTA 1SKTA 3BFBA 3B87A 4JKTA 4QJ5B 1KFUS 1WRLA 3EG5B 1W7IB 3D77A 4NDDA 2TN4A 1TRFA 2PMYA 1NSHA 3D74A 2KGBC 2LLUA 2WOSA 1BMOA 2JTTA 5HLVA 1QX5B 1KWOB 2KBIA 3CDNA 1MXEA 2BE4A 3VRRA 1NYAA 3DXLA 3PJIA 2I94A 2GGZA 1WLZA 2K2FA 4YI8A 2MHHA 1B8RA 5I2LA 2KLEA 2H61A 1K9PA 3LCPC 1DJGA 4WQ2A 2L5XB 2LVIA 1J7QA 1GQMA 1YVHA 1BLQA 1Y0VH 3K21A 1CDNA 3BUXB 3S0FA 1CFDA 3IQQA 1IQ5A 4HRGA 1DQEA 1KWOC 5AFPA 2ISDA 4N1GA 2OPOA 3L47A 2WCJA 1M31A 3BUMB 3D78A 2LP2A 1TNPA 1V1FA 3I5HB 2P71A 1NX2A 1YRUB 3CGAA 3TDIA 1NPQA 2LLSA 5FI2A 2GGMA 1D1OA 2LHIA 1BF5A 3SG2A 1A03A 2OS8B 4HRHA 3BFHA 4ORBB 3OB2B 3BFAA 4C0JA 1QWVA 1TOPA 1H4BA 2L2EA 1YUTA 2M3WA 1NIWA 2CT9A 2BCAA 4C0KA 1F71A 3SG7A 1ZMZA 3RM1A 5IBWA 1CM1A 1QTXA 3BQ3A 1GGWA 3D0YB 2QPTA 2JNXA 5TNCA 4R1EA 1B8LA 2WCKA 4I5NB 2MAZA 4ETOA 1CMFA 1YUUA 5BPJA 3I5HC 4PHMA 2FJYA 3D76A 3O4XA 1ALWA 1QATA 4MBEA 1Q80A 3OX6A 4I5JA 1K9KA 4IJ7A 1HT9A 5AANA 2KAVA 2KQYA 1R6PA 2OS8C 1DT7B 3NSKA 1CDMA 1YX7A 2GV5A 2HETA 3CZ1A 1TUJA 3AKBA 3I5IB 1DVIA 1Y6WA 4I5LB 4N5XA 1DEKA 2Y4QA 1DJYA 1R2UA 3O78A 1UP5A 1PVBA 2L98A 2MJWB 3BUOB 3OGNA 4C0LA 1YTZC 3TUYB 1IJ5A 1YUSA 2R2IA 3V2LA 4CFRA 2M0RA 2L4IA 1NUBA 4HREE 2JOJA 2BNXA 2JWWA 4PE0A 2MBXA 3WXAA 1MWNA 4QJ4B 5HKYA 5KU1A 2AMIA 1SRAA 5HKZA 1MXLC 4M2QA 1J1DA 2L50A 3SIBA 3ZNIA 3I5IC 3M0WA 1F54A 1TN4A 4P2YB 1BU3A 4MLWA 2QEHA 2FJUB 3TDUA 2PALA 1JBAA 3SG3A 1TNWA 1BG1A 2P6BB 3FWCA 2QEVA 1LA0A 1UHKA 1ZACA 4INWA 1K90D 2CXJA 2A4JA 2KNEA 1XYDA 1LA3A 2VRGA 2M7LA 3RZSA 4GGFC 1L2OB 3OX5A 2MRDA 3PATA 1TCFA 1QVIZ 1DJZA 1A75B 1CLLA 1IGVA 1RROA 2JT0A 1Y1XA 3LK0A 4FQTA 4WRIA 1X02A 3NXAA 1FPWA 5HL1A 1B9AA 2NZ0A 2K0JA 1PK0D 2LVVA 2WNDA 1QXPA 1AJ5A 2HQWA 1FW4A 1SK6D 3EKJA 4BY4A 2KFFA 1EXRA 2M7NA 2QDIA 4GGNA 4GAOA 2NCOA 2BBNA 2PRUA 4OR9B 1RJVA 3IQOA 3VRQA 3SG6A 3DYEA 1QX7A 2FCDA 1MF8B 1KCYA 1L2OC 2KOTA 1XFWO 3KO0A 1NX1A 2AAOA 3BJHA 3GK4X 1KK7Y 1QS7A 2QACA 1UHJA 2WC8A 4L9MA 1K95A 4NDBA 1P28A 2MA2A 1SYMA 2HPSA 2LHLA 4YBHB 1U5IA 1J7PA 1MQ1A 2LMUA 1PSRA 2DOQA 2ZN8A 4M2PA 4YGDB 1YURA 2K61A 3L4LA 3VRNA 1SW8A 2QEOA 1C7WA 3EVVA 2HF5A 1PRWA 2JPTA 3CZ2A 1IJ6A 2ZRSA 1T14A 1K96A 4AOMA 5EL2A 3EK7A 3PFVA 2PQLA 4DS7A 1S5GZ 1PALA 3AAJA 4PALA 1CFCA 4CIDA 2L0PA 1XFVO 2JXCA 2CTNA 3WNXB 1QJTA 1DF0A 4PDZA 2H8VA 2F3YA 2JU0A 1ALVA 3DZTA 4ORCB 4QJ3B 4XJKA 3SJSA 1OSAA 2PASA 1W9ZA 2V53A 3NHIA 5I2OA 1JF2A 1BT6A 1TNQA 2CBLA 1SMGA 3ICBA 5CSJA 2KI6C 3PLFB 1CKKA 2LVKA 3C1VA 5JOLA 2K7OA 1AK8A 3EVRA 4BY5A 2WCMA 1L7ZA 4JQ0D 1KSOA 3O2PA 4MRXA 3DVEA 4JPZB 4MZLA 1AHRA 1PULA 1DELA 2L51A 3O6BA 4DIRA 3D10A 2IS9A 1B7TZ 1B8CA 1NX0A 2H61C 1NCYA 1N65A 1M46A 3I5FB 2Y1NA 4YGCB 5I8NA 1EJ3A 1WRKA 2KAXA 3TZ1A 3B86A 1RECA 1AVSA 3NSLA 4MZKA 4YGAA 1BOCA 2G9BA 5I2QA 1UHNA 3SIAA 1YX8A 2Y1MA 3CR4X 1OE9B 1JFKA 5HLOA 1NWDA 1M63B 1QV1A 3PM8A 1UHIA 2K7BA 1PVAA 1TUZA 5DKRA 1XA5A 2MLEC 1C3YA 2I2RE 2KI6D 3SS3A 1FI6A 1OZSA 1UURA 3Q8IA 2H2KA 2GTEA 2LCPA 3CR2A 1CTRA 1ODBA 5DKQA 3I5FC 2ERBA 1K2HA 1S3PA 3BOWA 1WDCB 1AP4A 3KHEA 2EC6B 1CLBA 2WCFA 1SCVA 1OOGA 2EHBA 1QLSA 3UNWA 1SR6B 1WRZA 1DJHA 1RTP1 2F8PA 2MLFC 3VRPA 5KTYA 2BECA 2KYCA 2WCBA 3SS5A 1N0YA 2K7CA 2L5YA 2WCEA 3MSEB 4USLA 1IQ3A 1F55A 3F45A 1XO5A 4OKHA 1XK4A 1OMDA 1EH2A 1Y1AA 1YRTB 2NLNA 2JPOA 2F3ZA 1PSBA 2WORA 1WDCC 1CM4A 2SASA 2BKHB 2M9GA 2EC6C 3KF9A 1A4PA 1OOHA 2K8MB 3SG4A 4P5OE 4E68A 1XFYO 2WCLA 1A29A 1SR6C 1B4CA 3R72A 1CNPA 1G8IA 1SNLA 3SG5A 1IH0A 1XVJA 1TNXA 2LC5A 1SSEB 1BR1B 2KGRA 1NX3A 2M49B 2NXQA 1RFJA 5PALA 1DTLA 2KSPA 3RLZA 2PVBA 1XFXO 1LINA 4INXA 1SL8A 1B1GA 1DGUA 2JULA 2G2BA 1F8HA 1K8UA 3A4UB 1DJWA 1OOFA 1WY9A 3L4AA 3NSOA 3GK2A 3AAKA 2KQ6A 2Y5IA 4YGBB 3EK8A 1GM0A 5GQQC 3OP0A 1F4OA 4ORAB 3LLEA 1SCMB 4AQIA 3HCMA 2BKIB 1QV0A 4TNCA 2LV7A 3A8RA 2LANA 3CYZA 4NQGA 1S1EA 1LVCD 1S6IA 2Q91A 2L4HA 3B6XA 4PCWA 3NHTA 1SL7A 1XFRA 4U8DA 2KLDA 2E30A 5D3OA 5ER4X 3PALA 1KFXL 2LP3A 4Q04A 3H4SE 4YI9A 4MEWA 1W7JB 1SPYA 3BYAA 4NDCA 4M2OA 1M39A 1QLKA 3B88A 3UO9A 3HX4A 1K9UA 3OHMB 4ICBA 4DUQA 1M45A 2B1UA 3QRXA 4IL1A 2LMVA 3DD4A 4CLNA 2ZKMX 4YGEB 3AKAA 5JJGA 1SCMC 1U5IB 3BXKA 4MZJA 1JSAA 1NCZA 2I18A 2LLTA 4GNKB 2O60A 3IF7A 1KFUL 2K60A 1AJ4A 5J3XA 1KSMA 1N2DA 2P70A 1QIWA 1OW4A 4A4BA 4CFQA 3E3RA 5CPVA 1BJFA 2M1KB 1C3ZA 4GUKA 1JUOA 3VB1A 1CFFA 1YR5A 3VGOA 1SL9A 4OCIA 5FI7A 1FI5A 3QMEA 2KFHA 1TCOB 1CDPA 2I7AA 2YGUA 4PHJA 5KSZA 2WC5A 1OOIX 3DVJA 3FWBA 1DF0B 1MUXA 1GGZA 2BCXA 1OMRA 2ZFDA 1CB1A 1TTXA 4MSPA 5AEQA 5K89A 1Z4HA 4F7FA 5HYDA 1XFUO 4XJKB 4FQOA 4JWQA 1VRKA 2CNPA 1ZFSA 5CSNA 3DVKA 1KQMB 4GBAA 1J7RA 2LVJA 3IVTA 2K2AA 1C07A 1EL4A 3B7AA 3PSRA 1S6CA 1SBJA 3OBVA 4HSZA 3PN7B 3S0GA 5AERA 1QIVA 2Q4UA 4MN0A 3CS1A 5B8IB 1IRJA 2D8NA 4I5KA 5FI6A 1ZUZA 1ORGA 4DCKA 1XFZO 3EVUA 3WHTB 3CZ0A 1MHOA 4ZCUA 1TWOA 2KHNA 1ZOTB 2KYFA 2QEBA 4A4CA 2BL0B 1CMGA 1UUSA 1C7VA 1CLMA 5CSIA 1LKJA 4N1FA 1MR8A 1OQPA 1DJIA 2COLB 1V1GA 1J1EA 1KQMC 2KAYA 2EGDA 2LUCA 5F6TA 1DJXA 1QVIY 2O5GA 5D69A 1UWOA 3PN7C 1HQVA 3BUWB 3PM2A 4UPGA 2F2OA 4OVNF 3R1OA 1FBVA 1DC1A 1DGVA 1JC2A 2KI4B 3I5GB 1EG3A 3FIAA 1NP8A 3R1VA 2KBMA 1KK8B 2BAPA 3D0YA 1KK7Z 5CSFA 5HKWA 2FOTA 3R1PA 4OZDA 1IIOA 1S26D 2BL0C 4PE7A 3JVTB 4F0ZB 1SY9A 2M29A 1QASA 2PYQA 1F4QA 2KFGA 1LXFC 2F33A 2L2CA 3BOWB 3EK4A 1WLMA 3NGVA 5DICA 4AQJA 3ZWHA 1JFJA 3S0BA 2F2PA 1AUIB 3BUNB 3N7HA 4JD9A 3S0AA 4XYNA 1Z2CB 3FE9A 2NCPA 4KYNA 3GOFA 2OTGB 4MVFA 2LM5A 4PE4A 3LL8B 3NSIA 2KI4C 3I5GC 3LK1A 1S6JA 1JWDA 4PE1A 1QX2A 3CZTX 4WQ3A 4D1EA 1KK8C 3FE6A 2PSRA 3KPXA 3OB1B 4GFTA 4GPLB 2JTZA 1E8AA 1YVLA 2JRFA 3JVTC 1RK9A 1IWQA 2JXLA 3CLNA 2KPHA
chains in the Genus database with same CATH topology
1G33A 2JNFA 3JTDB 2LAPA 5D7FA 1EG4A 4GGFA 1S5GY 2BE6A 2K7DA 2ZRTA 1FF1A 1J7OA 1BR4B 2HQ8A 3CTNA 1K93D 2JT8A 3TS5B 2LUXA 1UHHA 2SCPA 2OTGC 4PHNA 3DF0A 3VROA 1G4YR 2ZNDA 4MRYA 1DMOA 1B47A 2M8UA 1K94A 1J55A 2FCEA 4FTGA 3TDZA 1CFPA 3CWGA 3DF0B 5ER5A 1F70A 4DRWA 4CPVA 2RGIA 3KEVA 1XK4C 2BCBA 3JTDC 3TUYC 2ZN9A 4YRUA 5DKNA 1RWYA 3DVMA 1TIZA 3EKHA 1A75A 5FYXA 5AXIA 1NCXA 2LE9B 1B7TY 5K89A 5G08A 2LNKA 3TS5C 1OOJA 2CCMA 1GJYA 1IKUA 3WHUB 2JQ6A 1S36A 4PHKA 2JC2A 3GK1A 1CDLA 1JF0A 2M1UA 3CR5X 1KQVA 1IG5A 1Y1UA 1KFXS 1A2XA 3O4YA 4ZCVA 2JT3A 3FS7A 1OZOA 2BBMA 2KDHA 1BODA 2E6WA 2M97A 4OV2A 1H8BA 2ZNEA 1OMVA 2AUCA 2JZIA 2LMTA 1SKTA 4QJ5B 1KFUS 1WRLA 1W7IB 4NDDA 2TN4A 1TRFA 2PMYA 1NSHA 2KGBC 2LLUA 2WOSA 1BMOA 2JTTA 5HLVA 1QX5B 1KWOB 2KBIA 1MXEA 2BE4A 3VRRA 1NYAA 2I94A 2GGZA 1WLZA 2K2FA 4YI8A 2MHHA 1B8RA 5I2LA 2H61A 1K9PA 3LCPC 1DJGA 4WQ2A 2L5XB 2LVIA 1J7QA 1GQMA 1YVHA 1BLQA 1Y0VH 3K21A 1CDNA 3BUXB 1CFDA 3IQQA 1IQ5A 4HRGA 1KWOC 5AFPA 2ISDA 4N1GA 2OPOA 1M31A 3BUMB 2LP2A 1TNPA 1V1FA 3I5HB 1NX2A 1YRUB 3CGAA 3TDIA 1NPQA 2LLSA 2GGMA 1D1OA 2LHIA 1BF5A 3SG2A 1A03A 2OS8B 4HRHA 4ORBB 3OB2B 1TOPA 1H4BA 2L2EA 1YUTA 2M3WA 1NIWA 2CT9A 2BCAA 4C0KA 1F71A 3SG7A 1ZMZA 3RM1A 5IBWA 1CM1A 1QTXA 3BQ3A 1GGWA 3D0YB 2QPTA 2JNXA 5TNCA 4R1EA 1B8LA 4I5NB 2MAZA 4ETOA 1CMFA 1YUUA 5BPJA 3I5HC 4PHMA 1ALWA 1QATA 4MBEA 1Q80A 3OX6A 4I5JA 1K9KA 5AANA 1HT9A 2KAVA 2KQYA 1R6PA 2OS8C 1DT7B 3NSKA 1CDMA 1YX7A 2GV5A 2HETA 3AKBA 3I5IB 1DVIA 1Y6WA 4I5LB 4N5XA 2Y4QA 1DJYA 1R2UA 3O78A 1UP5A 1PVBA 2L98A 2MJWB 3BUOB 4C0LA 1YTZC 3TUYB 1IJ5A 1YUSA 2R2IA 4CFRA 2M0RA 2L4IA 1NUBA 4HREE 2JOJA 2MBXA 2JWWA 4PE0A 3WXAA 4QJ4B 1MWNA 5HKYA 5KU1A 2AMIA 1SRAA 5HKZA 1MXLC 4M2QA 1J1DA 2L50A 3SIBA 3ZNIA 3I5IC 3M0WA 1F54A 1TN4A 4P2YB 1BU3A 4MLWA 2FJUB 3TDUA 2PALA 1JBAA 3SG3A 1TNWA 1BG1A 2P6BB 3FWCA 1LA0A 1UHKA 1ZACA 1K90D 2CXJA 2A4JA 2KNEA 1XYDA 1LA3A 2VRGA 2M7LA 4GGFC 1L2OB 3OX5A 2MRDA 3PATA 1TCFA 1QVIZ 1DJZA 1A75B 1CLLA 1IGVA 1RROA 2JT0A 1Y1XA 3LK0A 4WRIA 1X02A 3NXAA 1FPWA 1B9AA 2NZ0A 2K0JA 1PK0D 2LVVA 2WNDA 1QXPA 1AJ5A 2HQWA 1FW4A 1SK6D 3EKJA 4BY4A 2KFFA 1EXRA 2M7NA 4GGNA 4GAOA 2NCOA 2BBNA 2PRUA 4OR9B 1RJVA 3IQOA 3VRQA 3SG6A 1QX7A 2FCDA 1MF8B 1KCYA 1L2OC 2KOTA 1XFWO 3KO0A 1NX1A 2AAOA 3GK4X 1KK7Y 1QS7A 2QACA 1UHJA 2WC8A 4L9MA 1K95A 4NDBA 2MA2A 1SYMA 2HPSA 2LHLA 4YBHB 1U5IA 1J7PA 1MQ1A 2LMUA 1PSRA 2DOQA 2ZN8A 4M2PA 4YGDB 1YURA 2K61A 3VRNA 1SW8A 1C7WA 3EVVA 2HF5A 1PRWA 2JPTA 1IJ6A 2ZRSA 1K96A 4AOMA 3EK7A 3PFVA 4DS7A 1S5GZ 1PALA 3AAJA 4PALA 1CFCA 4CIDA 2L0PA 1XFVO 2JXCA 2CTNA 3WNXB 1QJTA 1DF0A 4PDZA 2F3YA 2JU0A 1ALVA 4ORCB 4QJ3B 4XJKA 3SJSA 1OSAA 2PASA 5I2OA 2V53A 1JF2A 1BT6A 1TNQA 2CBLA 1SMGA 3ICBA 5CSJA 2KI6C 3PLFB 1CKKA 2LVKA 3C1VA 5JOLA 2K7OA 1AK8A 3EVRA 4BY5A 1L7ZA 4JQ0D 1KSOA 3O2PA 4MRXA 3DVEA 4JPZB 4MZLA 1AHRA 1PULA 2L51A 3O6BA 4DIRA 3D10A 2IS9A 1B7TZ 1B8CA 1NX0A 2H61C 1NCYA 1N65A 1M46A 3I5FB 2Y1NA 4YGCB 5I8NA 1EJ3A 1WRKA 2KAXA 3TZ1A 1RECA 1AVSA 3NSLA 4MZKA 4YGAA 1BOCA 2G9BA 5I2QA 1UHNA 3SIAA 1YX8A 2Y1MA 3CR4X 1OE9B 1JFKA 5HLOA 1NWDA 1M63B 1QV1A 3PM8A 1UHIA 2K7BA 1PVAA 5DKRA 1XA5A 2MLEC 2I2RE 2KI6D 1FI6A 1OZSA 1UURA 2H2KA 2LCPA 3CR2A 1CTRA 1ODBA 5DKQA 3I5FC 1K2HA 1S3PA 3BOWA 1WDCB 1AP4A 3KHEA 2EC6B 1CLBA 2WCFA 1SCVA 2EHBA 1QLSA 1SR6B 1WRZA 1DJHA 1RTP1 2F8PA 2MLFC 3VRPA 5KTYA 2BECA 2KYCA 2WCBA 1N0YA 2K7CA 2WCEA 4USLA 3MSEB 1IQ3A 1F55A 3F45A 1XO5A 4OKHA 1XK4A 1OMDA 1EH2A 1Y1AA 1YRTB 2NLNA 2F3ZA 1PSBA 2WORA 1WDCC 1CM4A 2SASA 2BKHB 2M9GA 2EC6C 3KF9A 1A4PA 2K8MB 3SG4A 4P5OE 4E68A 1XFYO 1A29A 1SR6C 1B4CA 1CNPA 1G8IA 1SNLA 3SG5A 1IH0A 1XVJA 1TNXA 2LC5A 1BR1B 2KGRA 1NX3A 2M49B 2NXQA 1RFJA 5PALA 1DTLA 2KSPA 3RLZA 2PVBA 1XFXO 1LINA 1SL8A 1B1GA 1DGUA 2JULA 2G2BA 1F8HA 1K8UA 3A4UB 1DJWA 1WY9A 3NSOA 3GK2A 3AAKA 2KQ6A 2Y5IA 4YGBB 3EK8A 5GQQC 3OP0A 1F4OA 4ORAB 3LLEA 1SCMB 4AQIA 3HCMA 2BKIB 1QV0A 4TNCA 2LV7A 3A8RA 2LANA 4NQGA 1S1EA 1LVCD 1S6IA 2Q91A 2L4HA 4PCWA 1SL7A 4U8DA 2E30A 5ER4X 3PALA 1KFXL 2LP3A 4Q04A 3H4SE 4YI9A 4MEWA 1W7JB 1SPYA 3BYAA 4NDCA 4M2OA 1M39A 1QLKA 3HX4A 1K9UA 3OHMB 4ICBA 4DUQA 1M45A 2B1UA 3QRXA 4IL1A 2LMVA 3DD4A 4CLNA 2ZKMX 4YGEB 3AKAA 5JJGA 1SCMC 1U5IB 3BXKA 4MZJA 1JSAA 1NCZA 2I18A 2LLTA 4GNKB 2O60A 3IF7A 1KFUL 1AJ4A 5J3XA 1KSMA 1N2DA 4A4BA 1QIWA 4CFQA 3E3RA 5CPVA 1BJFA 2M1KB 4GUKA 1JUOA 1CFFA 1YR5A 3VGOA 1SL9A 4OCIA 1FI5A 2KFHA 1TCOB 1CDPA 2I7AA 5KSZA 4PHJA 3DVJA 3FWBA 1DF0B 1MUXA 1GGZA 2BCXA 1OMRA 2ZFDA 1CB1A 1TTXA 4MSPA 5AEQA 5HYDA 1XFUO 4XJKB 4FQOA 4JWQA 1VRKA 2CNPA 1ZFSA 5CSNA 3DVKA 1KQMB 4GBAA 1J7RA 2LVJA 2K2AA 1C07A 1EL4A 3PSRA 1S6CA 1SBJA 4HSZA 3PN7B 5AERA 1QIVA 2Q4UA 4MN0A 3CS1A 5B8IB 1IRJA 2D8NA 4I5KA 1CMGA 1ZUZA 4DCKA 1XFZO 3EVUA 3WHTB 4ZCUA 1MHOA 2KHNA 1ZOTB 2KYFA 4A4CA 2BL0B 1UUSA 1C7VA 1CLMA 5CSIA 1LKJA 4N1FA 1MR8A 1OQPA 1DJIA 2COLB 1V1GA 1J1EA 1KQMC 2KAYA 2EGDA 2LUCA 5F6TA 1DJXA 1QVIY 2O5GA 5D69A 1UWOA 3PN7C 1HQVA 3BUWB 4UPGA 2F2OA 4OVNF 1FBVA 1DGVA 1JC2A 2KI4B 3I5GB 1EG3A 3FIAA 1NP8A 2KBMA 1KK8B 3D0YA 5CSFA 1KK7Z 5HKWA 2FOTA 1S26D 2BL0C 4PE7A 3JVTB 4F0ZB 1SY9A 2M29A 1QASA 1F4QA 2KFGA 1LXFC 2F33A 3BOWB 3EK4A 1WLMA 4AQJA 3ZWHA 1JFJA 2F2PA 1AUIB 3BUNB 4XYNA 4MVFA 2NCPA 4PE4A 3GOFA 2OTGB 2LM5A 3LL8B 3NSIA 2KI4C 3I5GC 3LK1A 1S6JA 1JWDA 4PE1A 1QX2A 3CZTX 4WQ3A 4D1EA 1KK8C 2PSRA 3KPXA 3OB1B 4GFTA 4GPLB 2JTZA 1E8AA 1YVLA 2JRFA 3JVTC 1RK9A 1IWQA 2JXLA 3CLNA 4C0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G33 A;  2JNF A;  3JTD B;  2LAP A;  5D7F A;  1EG4 A;  4GGF A;  1S5G Y;  2BE6 A;  2K7D A;  2ZRT A;  1FF1 A;  1J7O A;  1BR4 B;  2HQ8 A;  3CTN A;  1K93 D;  2JT8 A;  3TS5 B;  2LUX A;  1UHH A;  2SCP A;  2OTG C;  4PHN A;  3DF0 A;  3VRO A;  1G4Y R;  2ZND A;  4MRY A;  1DMO A;  1B47 A;  2M8U A;  1K94 A;  1J55 A;  2FCE A;  4FTG A;  3TDZ A;  1CFP A;  3CWG A;  3DF0 B;  5ER5 A;  1F70 A;  4DRW A;  4CPV A;  2RGI A;  3KEV A;  1XK4 C;  2BCB A;  3JTD C;  3TUY C;  2ZN9 A;  4YRU A;  5DKN A;  1RWY A;  3DVM A;  1TIZ A;  3EKH A;  1A75 A;  5FYX A;  5AXI A;  1NCX A;  2LE9 B;  1B7T Y;  5K89 A;  5G08 A;  2LNK A;  3TS5 C;  1OOJ A;  2CCM A;  1GJY A;  1IKU A;  3WHU B;  2JQ6 A;  1S36 A;  4PHK A;  2JC2 A;  3GK1 A;  1CDL A;  1JF0 A;  2M1U A;  3CR5 X;  1KQV A;  1IG5 A;  1Y1U A;  1KFX S;  1A2X A;  3O4Y A;  4ZCV A;  2JT3 A;  3FS7 A;  1OZO A;  2BBM A;  2KDH A;  1BOD A;  2E6W A;  2M97 A;  4OV2 A;  1H8B A;  2ZNE A;  1OMV A;  2AUC A;  2JZI A;  2LMT A;  1SKT A;  4QJ5 B;  1KFU S;  1WRL A;  1W7I B;  4NDD A;  2TN4 A;  1TRF A;  2PMY A;  1NSH A;  2KGB C;  2LLU A;  2WOS A;  1BMO A;  2JTT A;  5HLV A;  1QX5 B;  1KWO B;  2KBI A;  1MXE A;  2BE4 A;  3VRR A;  1NYA A;  2I94 A;  2GGZ A;  1WLZ A;  2K2F A;  4YI8 A;  2MHH A;  1B8R A;  5I2L A;  2H61 A;  1K9P A;  3LCP C;  1DJG A;  4WQ2 A;  2L5X B;  2LVI A;  1J7Q A;  1GQM A;  1YVH A;  1BLQ A;  1Y0V H;  3K21 A;  1CDN A;  3BUX B;  1CFD A;  3IQQ A;  1IQ5 A;  4HRG A;  1KWO C;  5AFP A;  2ISD A;  4N1G A;  2OPO A;  1M31 A;  3BUM B;  2LP2 A;  1TNP A;  1V1F A;  3I5H B;  1NX2 A;  1YRU B;  3CGA A;  3TDI A;  1NPQ A;  2LLS A;  2GGM A;  1D1O A;  2LHI A;  1BF5 A;  3SG2 A;  1A03 A;  2OS8 B;  4HRH A;  4ORB B;  3OB2 B;  1TOP A;  1H4B A;  2L2E A;  1YUT A;  2M3W A;  1NIW A;  2CT9 A;  2BCA A;  4C0K A;  1F71 A;  3SG7 A;  1ZMZ A;  3RM1 A;  5IBW A;  1CM1 A;  1QTX A;  3BQ3 A;  1GGW A;  3D0Y B;  2QPT A;  2JNX A;  5TNC A;  4R1E A;  1B8L A;  4I5N B;  2MAZ A;  4ETO A;  1CMF A;  1YUU A;  5BPJ A;  3I5H C;  4PHM A;  1ALW A;  1QAT A;  4MBE A;  1Q80 A;  3OX6 A;  4I5J A;  1K9K A;  5AAN A;  1HT9 A;  2KAV A;  2KQY A;  1R6P A;  2OS8 C;  1DT7 B;  3NSK A;  1CDM A;  1YX7 A;  2GV5 A;  2HET A;  3AKB A;  3I5I B;  1DVI A;  1Y6W A;  4I5L B;  4N5X A;  2Y4Q A;  1DJY A;  1R2U A;  3O78 A;  1UP5 A;  1PVB A;  2L98 A;  2MJW B;  3BUO B;  4C0L A;  1YTZ C;  3TUY B;  1IJ5 A;  1YUS A;  2R2I A;  4CFR A;  2M0R A;  2L4I A;  1NUB A;  4HRE E;  2JOJ A;  2MBX A;  2JWW A;  4PE0 A;  3WXA A;  4QJ4 B;  1MWN A;  5HKY A;  5KU1 A;  2AMI A;  1SRA A;  5HKZ A;  1MXL C;  4M2Q A;  1J1D A;  2L50 A;  3SIB A;  3ZNI A;  3I5I C;  3M0W A;  1F54 A;  1TN4 A;  4P2Y B;  1BU3 A;  4MLW A;  2FJU B;  3TDU A;  2PAL A;  1JBA A;  3SG3 A;  1TNW A;  1BG1 A;  2P6B B;  3FWC A;  1LA0 A;  1UHK A;  1ZAC A;  1K90 D;  2CXJ A;  2A4J A;  2KNE A;  1XYD A;  1LA3 A;  2VRG A;  2M7L A;  4GGF C;  1L2O B;  3OX5 A;  2MRD A;  3PAT A;  1TCF A;  1QVI Z;  1DJZ A;  1A75 B;  1CLL A;  1IGV A;  1RRO A;  2JT0 A;  1Y1X A;  3LK0 A;  4WRI A;  1X02 A;  3NXA A;  1FPW A;  1B9A A;  2NZ0 A;  2K0J A;  1PK0 D;  2LVV A;  2WND A;  1QXP A;  1AJ5 A;  2HQW A;  1FW4 A;  1SK6 D;  3EKJ A;  4BY4 A;  2KFF A;  1EXR A;  2M7N A;  4GGN A;  4GAO A;  2NCO A;  2BBN A;  2PRU A;  4OR9 B;  1RJV A;  3IQO A;  3VRQ A;  3SG6 A;  1QX7 A;  2FCD A;  1MF8 B;  1KCY A;  1L2O C;  2KOT A;  1XFW O;  3KO0 A;  1NX1 A;  2AAO A;  3GK4 X;  1KK7 Y;  1QS7 A;  2QAC A;  1UHJ A;  2WC8 A;  4L9M A;  1K95 A;  4NDB A;  2MA2 A;  1SYM A;  2HPS A;  2LHL A;  4YBH B;  1U5I A;  1J7P A;  1MQ1 A;  2LMU A;  1PSR A;  2DOQ A;  2ZN8 A;  4M2P A;  4YGD B;  1YUR A;  2K61 A;  3VRN A;  1SW8 A;  1C7W A;  3EVV A;  2HF5 A;  1PRW A;  2JPT A;  1IJ6 A;  2ZRS A;  1K96 A;  4AOM A;  3EK7 A;  3PFV A;  4DS7 A;  1S5G Z;  1PAL A;  3AAJ A;  4PAL A;  1CFC A;  4CID A;  2L0P A;  1XFV O;  2JXC A;  2CTN A;  3WNX B;  1QJT A;  1DF0 A;  4PDZ A;  2F3Y A;  2JU0 A;  1ALV A;  4ORC B;  4QJ3 B;  4XJK A;  3SJS A;  1OSA A;  2PAS A;  5I2O A;  2V53 A;  1JF2 A;  1BT6 A;  1TNQ A;  2CBL A;  1SMG A;  3ICB A;  5CSJ A;  2KI6 C;  3PLF B;  1CKK A;  2LVK A;  3C1V A;  5JOL A;  2K7O A;  1AK8 A;  3EVR A;  4BY5 A;  1L7Z A;  4JQ0 D;  1KSO A;  3O2P A;  4MRX A;  3DVE A;  4JPZ B;  4MZL A;  1AHR A;  1PUL A;  2L51 A;  3O6B A;  4DIR A;  3D10 A;  2IS9 A;  1B7T Z;  1B8C A;  1NX0 A;  2H61 C;  1NCY A;  1N65 A;  1M46 A;  3I5F B;  2Y1N A;  4YGC B;  5I8N A;  1EJ3 A;  1WRK A;  2KAX A;  3TZ1 A;  1REC A;  1AVS A;  3NSL A;  4MZK A;  4YGA A;  1BOC A;  2G9B A;  5I2Q A;  1UHN A;  3SIA A;  1YX8 A;  2Y1M A;  3CR4 X;  1OE9 B;  1JFK A;  5HLO A;  1NWD A;  1M63 B;  1QV1 A;  3PM8 A;  1UHI A;  2K7B A;  1PVA A;  5DKR A;  1XA5 A;  2MLE C;  2I2R E;  2KI6 D;  1FI6 A;  1OZS A;  1UUR A;  2H2K A;  2LCP A;  3CR2 A;  1CTR A;  1ODB A;  5DKQ A;  3I5F C;  1K2H A;  1S3P A;  3BOW A;  1WDC B;  1AP4 A;  3KHE A;  2EC6 B;  1CLB A;  2WCF A;  1SCV A;  2EHB A;  1QLS A;  1SR6 B;  1WRZ A;  1DJH A;  1RTP 1;  2F8P A;  2MLF C;  3VRP A;  5KTY A;  2BEC A;  2KYC A;  2WCB A;  1N0Y A;  2K7C A;  2WCE A;  4USL A;  3MSE B;  1IQ3 A;  1F55 A;  3F45 A;  1XO5 A;  4OKH A;  1XK4 A;  1OMD A;  1EH2 A;  1Y1A A;  1YRT B;  2NLN A;  2F3Z A;  1PSB A;  2WOR A;  1WDC C;  1CM4 A;  2SAS A;  2BKH B;  2M9G A;  2EC6 C;  3KF9 A;  1A4P A;  2K8M B;  3SG4 A;  4P5O E;  4E68 A;  1XFY O;  1A29 A;  1SR6 C;  1B4C A;  1CNP A;  1G8I A;  1SNL A;  3SG5 A;  1IH0 A;  1XVJ A;  1TNX A;  2LC5 A;  1BR1 B;  2KGR A;  1NX3 A;  2M49 B;  2NXQ A;  1RFJ A;  5PAL A;  1DTL A;  2KSP A;  3RLZ A;  2PVB A;  1XFX O;  1LIN A;  1SL8 A;  1B1G A;  1DGU A;  2JUL A;  2G2B A;  1F8H A;  1K8U A;  3A4U B;  1DJW A;  1WY9 A;  3NSO A;  3GK2 A;  3AAK A;  2KQ6 A;  2Y5I A;  4YGB B;  3EK8 A;  5GQQ C;  3OP0 A;  1F4O A;  4ORA B;  3LLE A;  1SCM B;  4AQI A;  3HCM A;  2BKI B;  1QV0 A;  4TNC A;  2LV7 A;  3A8R A;  2LAN A;  4NQG A;  1S1E A;  1LVC D;  1S6I A;  2Q91 A;  2L4H A;  4PCW A;  1SL7 A;  4U8D A;  2E30 A;  5ER4 X;  3PAL A;  1KFX L;  2LP3 A;  4Q04 A;  3H4S E;  4YI9 A;  4MEW A;  1W7J B;  1SPY A;  3BYA A;  4NDC A;  4M2O A;  1M39 A;  1QLK A;  3HX4 A;  1K9U A;  3OHM B;  4ICB A;  4DUQ A;  1M45 A;  2B1U A;  3QRX A;  4IL1 A;  2LMV A;  3DD4 A;  4CLN A;  2ZKM X;  4YGE B;  3AKA A;  5JJG A;  1SCM C;  1U5I B;  3BXK A;  4MZJ A;  1JSA A;  1NCZ A;  2I18 A;  2LLT A;  4GNK B;  2O60 A;  3IF7 A;  1KFU L;  1AJ4 A;  5J3X A;  1KSM A;  1N2D A;  4A4B A;  1QIW A;  4CFQ A;  3E3R A;  5CPV A;  1BJF A;  2M1K B;  4GUK A;  1JUO A;  1CFF A;  1YR5 A;  3VGO A;  1SL9 A;  4OCI A;  1FI5 A;  2KFH A;  1TCO B;  1CDP A;  2I7A A;  5KSZ A;  4PHJ A;  3DVJ A;  3FWB A;  1DF0 B;  1MUX A;  1GGZ A;  2BCX A;  1OMR A;  2ZFD A;  1CB1 A;  1TTX A;  4MSP A;  5AEQ A;  5HYD A;  1XFU O;  4XJK B;  4FQO A;  4JWQ A;  1VRK A;  2CNP A;  1ZFS A;  5CSN A;  3DVK A;  1KQM B;  4GBA A;  1J7R A;  2LVJ A;  2K2A A;  1C07 A;  1EL4 A;  3PSR A;  1S6C A;  1SBJ A;  4HSZ A;  3PN7 B;  5AER A;  1QIV A;  2Q4U A;  4MN0 A;  3CS1 A;  5B8I B;  1IRJ A;  2D8N A;  4I5K A;  1CMG A;  1ZUZ A;  4DCK A;  1XFZ O;  3EVU A;  3WHT B;  4ZCU A;  1MHO A;  2KHN A;  1ZOT B;  2KYF A;  4A4C A;  2BL0 B;  1UUS A;  1C7V A;  1CLM A;  5CSI A;  1LKJ A;  4N1F A;  1MR8 A;  1OQP A;  1DJI A;  2COL B;  1V1G A;  1J1E A;  1KQM C;  2KAY A;  2EGD A;  2LUC A;  5F6T A;  1DJX A;  1QVI Y;  2O5G A;  5D69 A;  1UWO A;  3PN7 C;  1HQV A;  3BUW B;  4UPG A;  2F2O A;  4OVN F;  1FBV A;  1DGV A;  1JC2 A;  2KI4 B;  3I5G B;  1EG3 A;  3FIA A;  1NP8 A;  2KBM A;  1KK8 B;  3D0Y A;  5CSF A;  1KK7 Z;  5HKW A;  2FOT A;  1S26 D;  2BL0 C;  4PE7 A;  3JVT B;  4F0Z B;  1SY9 A;  2M29 A;  1QAS A;  1F4Q A;  2KFG A;  1LXF C;  2F33 A;  3BOW B;  3EK4 A;  1WLM A;  4AQJ A;  3ZWH A;  1JFJ A;  2F2P A;  1AUI B;  3BUN B;  4XYN A;  4MVF A;  2NCP A;  4PE4 A;  3GOF A;  2OTG B;  2LM5 A;  3LL8 B;  3NSI A;  2KI4 C;  3I5G C;  3LK1 A;  1S6J A;  1JWD A;  4PE1 A;  1QX2 A;  3CZT X;  4WQ3 A;  4D1E A;  1KK8 C;  2PSR A;  3KPX A;  3OB1 B;  4GFT A;  4GPL B;  2JTZ A;  1E8A A;  1YVL A;  2JRF A;  3JVT C;  1RK9 A;  1IWQ A;  2JXL A;  3CLN A;  4C0J A; 
#chains in the Genus database with same CATH topology
 1G33 A;  2JNF A;  3JTD B;  2LAP A;  2WC6 A;  5D7F A;  1EG4 A;  4GGF A;  1S5G Y;  2BE6 A;  2K7D A;  2ZRT A;  1FF1 A;  1J7O A;  1BR4 B;  2HQ8 A;  3CAB A;  3CTN A;  1K93 D;  2JT8 A;  3TS5 B;  2LUX A;  1UHH A;  2SCP A;  2OTG C;  4PHN A;  3DF0 A;  3VRO A;  1G4Y R;  2ZND A;  3K1E A;  4MRY A;  1DMO A;  1B47 A;  2M8U A;  1K94 A;  1J55 A;  2FCE A;  4FTG A;  3TDZ A;  3S0D A;  3CWG A;  1CFP A;  3DF0 B;  3S0E A;  5ER5 A;  1F70 A;  4DRW A;  3D75 A;  4CPV A;  2RGI A;  3KEV A;  1XK4 C;  2BCB A;  3JTD C;  3TUY C;  2ZN9 A;  4YRU A;  4PT1 A;  5DKN A;  5I94 A;  1RWY A;  3DVM A;  1TIZ A;  3EKH A;  1A75 A;  3DY9 A;  5FYX A;  1NCX A;  2LE9 B;  1B7T Y;  5AXI A;  5G08 A;  2LNK A;  1LS8 A;  1OOJ A;  2CCM A;  3TS5 C;  1GJY A;  1IKU A;  3WHU B;  2JQ6 A;  1S36 A;  4PHK A;  2JC2 A;  3GK1 A;  1CDL A;  1JF0 A;  2M1U A;  3CR5 X;  1KQV A;  1IG5 A;  1Y1U A;  1KFX S;  1A2X A;  3O4Y A;  4ZCV A;  2JT3 A;  3FS7 A;  1OZO A;  2BBM A;  2WCH A;  2KDH A;  3D73 A;  2E6W A;  2M97 A;  3SS4 A;  3FE8 A;  1BOD A;  4OV2 A;  1H8B A;  2ZNE A;  1OMV A;  2AUC A;  2JZI A;  2LMT A;  1SKT A;  3BFB A;  3B87 A;  4JKT A;  4QJ5 B;  1KFU S;  1WRL A;  3EG5 B;  1W7I B;  3D77 A;  4NDD A;  2TN4 A;  1TRF A;  2PMY A;  1NSH A;  3D74 A;  2KGB C;  2LLU A;  2WOS A;  1BMO A;  2JTT A;  5HLV A;  1QX5 B;  1KWO B;  2KBI A;  3CDN A;  1MXE A;  2BE4 A;  3VRR A;  1NYA A;  3DXL A;  3PJI A;  2I94 A;  2GGZ A;  1WLZ A;  2K2F A;  4YI8 A;  2MHH A;  1B8R A;  5I2L A;  2KLE A;  2H61 A;  1K9P A;  3LCP C;  1DJG A;  4WQ2 A;  2L5X B;  2LVI A;  1J7Q A;  1GQM A;  1YVH A;  1BLQ A;  1Y0V H;  3K21 A;  1CDN A;  3BUX B;  3S0F A;  1CFD A;  3IQQ A;  1IQ5 A;  4HRG A;  1DQE A;  1KWO C;  5AFP A;  2ISD A;  4N1G A;  2OPO A;  3L47 A;  2WCJ A;  1M31 A;  3BUM B;  3D78 A;  2LP2 A;  1TNP A;  1V1F A;  3I5H B;  2P71 A;  1NX2 A;  1YRU B;  3CGA A;  3TDI A;  1NPQ A;  2LLS A;  5FI2 A;  2GGM A;  1D1O A;  2LHI A;  1BF5 A;  3SG2 A;  1A03 A;  2OS8 B;  4HRH A;  3BFH A;  4ORB B;  3OB2 B;  3BFA A;  4C0J A;  1QWV A;  1TOP A;  1H4B A;  2L2E A;  1YUT A;  2M3W A;  1NIW A;  2CT9 A;  2BCA A;  4C0K A;  1F71 A;  3SG7 A;  1ZMZ A;  3RM1 A;  5IBW A;  1CM1 A;  1QTX A;  3BQ3 A;  1GGW A;  3D0Y B;  2QPT A;  2JNX A;  5TNC A;  4R1E A;  1B8L A;  2WCK A;  4I5N B;  2MAZ A;  4ETO A;  1CMF A;  1YUU A;  5BPJ A;  3I5H C;  4PHM A;  2FJY A;  3D76 A;  3O4X A;  1ALW A;  1QAT A;  4MBE A;  1Q80 A;  3OX6 A;  4I5J A;  1K9K A;  4IJ7 A;  1HT9 A;  5AAN A;  2KAV A;  2KQY A;  1R6P A;  2OS8 C;  1DT7 B;  3NSK A;  1CDM A;  1YX7 A;  2GV5 A;  2HET A;  3CZ1 A;  1TUJ A;  3AKB A;  3I5I B;  1DVI A;  1Y6W A;  4I5L B;  4N5X A;  1DEK A;  2Y4Q A;  1DJY A;  1R2U A;  3O78 A;  1UP5 A;  1PVB A;  2L98 A;  2MJW B;  3BUO B;  3OGN A;  4C0L A;  1YTZ C;  3TUY B;  1IJ5 A;  1YUS A;  2R2I A;  3V2L A;  4CFR A;  2M0R A;  2L4I A;  1NUB A;  4HRE E;  2JOJ A;  2BNX A;  2JWW A;  4PE0 A;  2MBX A;  3WXA A;  1MWN A;  4QJ4 B;  5HKY A;  5KU1 A;  2AMI A;  1SRA A;  5HKZ A;  1MXL C;  4M2Q A;  1J1D A;  2L50 A;  3SIB A;  3ZNI A;  3I5I C;  3M0W A;  1F54 A;  1TN4 A;  4P2Y B;  1BU3 A;  4MLW A;  2QEH A;  2FJU B;  3TDU A;  2PAL A;  1JBA A;  3SG3 A;  1TNW A;  1BG1 A;  2P6B B;  3FWC A;  2QEV A;  1LA0 A;  1UHK A;  1ZAC A;  4INW A;  1K90 D;  2CXJ A;  2A4J A;  2KNE A;  1XYD A;  1LA3 A;  2VRG A;  2M7L A;  3RZS A;  4GGF C;  1L2O B;  3OX5 A;  2MRD A;  3PAT A;  1TCF A;  1QVI Z;  1DJZ A;  1A75 B;  1CLL A;  1IGV A;  1RRO A;  2JT0 A;  1Y1X A;  3LK0 A;  4FQT A;  4WRI A;  1X02 A;  3NXA A;  1FPW A;  5HL1 A;  1B9A A;  2NZ0 A;  2K0J A;  1PK0 D;  2LVV A;  2WND A;  1QXP A;  1AJ5 A;  2HQW A;  1FW4 A;  1SK6 D;  3EKJ A;  4BY4 A;  2KFF A;  1EXR A;  2M7N A;  2QDI A;  4GGN A;  4GAO A;  2NCO A;  2BBN A;  2PRU A;  4OR9 B;  1RJV A;  3IQO A;  3VRQ A;  3SG6 A;  3DYE A;  1QX7 A;  2FCD A;  1MF8 B;  1KCY A;  1L2O C;  2KOT A;  1XFW O;  3KO0 A;  1NX1 A;  2AAO A;  3BJH A;  3GK4 X;  1KK7 Y;  1QS7 A;  2QAC A;  1UHJ A;  2WC8 A;  4L9M A;  1K95 A;  4NDB A;  1P28 A;  2MA2 A;  1SYM A;  2HPS A;  2LHL A;  4YBH B;  1U5I A;  1J7P A;  1MQ1 A;  2LMU A;  1PSR A;  2DOQ A;  2ZN8 A;  4M2P A;  4YGD B;  1YUR A;  2K61 A;  3L4L A;  3VRN A;  1SW8 A;  2QEO A;  1C7W A;  3EVV A;  2HF5 A;  1PRW A;  2JPT A;  3CZ2 A;  1IJ6 A;  2ZRS A;  1T14 A;  1K96 A;  4AOM A;  5EL2 A;  3EK7 A;  3PFV A;  2PQL A;  4DS7 A;  1S5G Z;  1PAL A;  3AAJ A;  4PAL A;  1CFC A;  4CID A;  2L0P A;  1XFV O;  2JXC A;  2CTN A;  3WNX B;  1QJT A;  1DF0 A;  4PDZ A;  2H8V A;  2F3Y A;  2JU0 A;  1ALV A;  3DZT A;  4ORC B;  4QJ3 B;  4XJK A;  3SJS A;  1OSA A;  2PAS A;  1W9Z A;  2V53 A;  3NHI A;  5I2O A;  1JF2 A;  1BT6 A;  1TNQ A;  2CBL A;  1SMG A;  3ICB A;  5CSJ A;  2KI6 C;  3PLF B;  1CKK A;  2LVK A;  3C1V A;  5JOL A;  2K7O A;  1AK8 A;  3EVR A;  4BY5 A;  2WCM A;  1L7Z A;  4JQ0 D;  1KSO A;  3O2P A;  4MRX A;  3DVE A;  4JPZ B;  4MZL A;  1AHR A;  1PUL A;  1DEL A;  2L51 A;  3O6B A;  4DIR A;  3D10 A;  2IS9 A;  1B7T Z;  1B8C A;  1NX0 A;  2H61 C;  1NCY A;  1N65 A;  1M46 A;  3I5F B;  2Y1N A;  4YGC B;  5I8N A;  1EJ3 A;  1WRK A;  2KAX A;  3TZ1 A;  3B86 A;  1REC A;  1AVS A;  3NSL A;  4MZK A;  4YGA A;  1BOC A;  2G9B A;  5I2Q A;  1UHN A;  3SIA A;  1YX8 A;  2Y1M A;  3CR4 X;  1OE9 B;  1JFK A;  5HLO A;  1NWD A;  1M63 B;  1QV1 A;  3PM8 A;  1UHI A;  2K7B A;  1PVA A;  1TUZ A;  5DKR A;  1XA5 A;  2MLE C;  1C3Y A;  2I2R E;  2KI6 D;  3SS3 A;  1FI6 A;  1OZS A;  1UUR A;  3Q8I A;  2H2K A;  2GTE A;  2LCP A;  3CR2 A;  1CTR A;  1ODB A;  5DKQ A;  3I5F C;  2ERB A;  1K2H A;  1S3P A;  3BOW A;  1WDC B;  1AP4 A;  3KHE A;  2EC6 B;  1CLB A;  2WCF A;  1SCV A;  1OOG A;  2EHB A;  1QLS A;  3UNW A;  1SR6 B;  1WRZ A;  1DJH A;  1RTP 1;  2F8P A;  2MLF C;  3VRP A;  5KTY A;  2BEC A;  2KYC A;  2WCB A;  3SS5 A;  1N0Y A;  2K7C A;  2L5Y A;  2WCE A;  3MSE B;  4USL A;  1IQ3 A;  1F55 A;  3F45 A;  1XO5 A;  4OKH A;  1XK4 A;  1OMD A;  1EH2 A;  1Y1A A;  1YRT B;  2NLN A;  2JPO A;  2F3Z A;  1PSB A;  2WOR A;  1WDC C;  1CM4 A;  2SAS A;  2BKH B;  2M9G A;  2EC6 C;  3KF9 A;  1A4P A;  1OOH A;  2K8M B;  3SG4 A;  4P5O E;  4E68 A;  1XFY O;  2WCL A;  1A29 A;  1SR6 C;  1B4C A;  3R72 A;  1CNP A;  1G8I A;  1SNL A;  3SG5 A;  1IH0 A;  1XVJ A;  1TNX A;  2LC5 A;  1SSE B;  1BR1 B;  2KGR A;  1NX3 A;  2M49 B;  2NXQ A;  1RFJ A;  5PAL A;  1DTL A;  2KSP A;  3RLZ A;  2PVB A;  1XFX O;  1LIN A;  4INX A;  1SL8 A;  1B1G A;  1DGU A;  2JUL A;  2G2B A;  1F8H A;  1K8U A;  3A4U B;  1DJW A;  1OOF A;  1WY9 A;  3L4A A;  3NSO A;  3GK2 A;  3AAK A;  2KQ6 A;  2Y5I A;  4YGB B;  3EK8 A;  1GM0 A;  5GQQ C;  3OP0 A;  1F4O A;  4ORA B;  3LLE A;  1SCM B;  4AQI A;  3HCM A;  2BKI B;  1QV0 A;  4TNC A;  2LV7 A;  3A8R A;  2LAN A;  3CYZ A;  4NQG A;  1S1E A;  1LVC D;  1S6I A;  2Q91 A;  2L4H A;  3B6X A;  4PCW A;  3NHT A;  1SL7 A;  1XFR A;  4U8D A;  2KLD A;  2E30 A;  5D3O A;  5ER4 X;  3PAL A;  1KFX L;  2LP3 A;  4Q04 A;  3H4S E;  4YI9 A;  4MEW A;  1W7J B;  1SPY A;  3BYA A;  4NDC A;  4M2O A;  1M39 A;  1QLK A;  3B88 A;  3UO9 A;  3HX4 A;  1K9U A;  3OHM B;  4ICB A;  4DUQ A;  1M45 A;  2B1U A;  3QRX A;  4IL1 A;  2LMV A;  3DD4 A;  4CLN A;  2ZKM X;  4YGE B;  3AKA A;  5JJG A;  1SCM C;  1U5I B;  3BXK A;  4MZJ A;  1JSA A;  1NCZ A;  2I18 A;  2LLT A;  4GNK B;  2O60 A;  3IF7 A;  1KFU L;  2K60 A;  1AJ4 A;  5J3X A;  1KSM A;  1N2D A;  2P70 A;  1QIW A;  1OW4 A;  4A4B A;  4CFQ A;  3E3R A;  5CPV A;  1BJF A;  2M1K B;  1C3Z A;  4GUK A;  1JUO A;  3VB1 A;  1CFF A;  1YR5 A;  3VGO A;  1SL9 A;  4OCI A;  5FI7 A;  1FI5 A;  3QME A;  2KFH A;  1TCO B;  1CDP A;  2I7A A;  2YGU A;  4PHJ A;  5KSZ A;  2WC5 A;  1OOI X;  3DVJ A;  3FWB A;  1DF0 B;  1MUX A;  1GGZ A;  2BCX A;  1OMR A;  2ZFD A;  1CB1 A;  1TTX A;  4MSP A;  5AEQ A;  5K89 A;  1Z4H A;  4F7F A;  5HYD A;  1XFU O;  4XJK B;  4FQO A;  4JWQ A;  1VRK A;  2CNP A;  1ZFS A;  5CSN A;  3DVK A;  1KQM B;  4GBA A;  1J7R A;  2LVJ A;  3IVT A;  2K2A A;  1C07 A;  1EL4 A;  3B7A A;  3PSR A;  1S6C A;  1SBJ A;  3OBV A;  4HSZ A;  3PN7 B;  3S0G A;  5AER A;  1QIV A;  2Q4U A;  4MN0 A;  3CS1 A;  5B8I B;  1IRJ A;  2D8N A;  4I5K A;  5FI6 A;  1ZUZ A;  1ORG A;  4DCK A;  1XFZ O;  3EVU A;  3WHT B;  3CZ0 A;  1MHO A;  4ZCU A;  1TWO A;  2KHN A;  1ZOT B;  2KYF A;  2QEB A;  4A4C A;  2BL0 B;  1CMG A;  1UUS A;  1C7V A;  1CLM A;  5CSI A;  1LKJ A;  4N1F A;  1MR8 A;  1OQP A;  1DJI A;  2COL B;  1V1G A;  1J1E A;  1KQM C;  2KAY A;  2EGD A;  2LUC A;  5F6T A;  1DJX A;  1QVI Y;  2O5G A;  5D69 A;  1UWO A;  3PN7 C;  1HQV A;  3BUW B;  3PM2 A;  4UPG A;  2F2O A;  4OVN F;  3R1O A;  1FBV A;  1DC1 A;  1DGV A;  1JC2 A;  2KI4 B;  3I5G B;  1EG3 A;  3FIA A;  1NP8 A;  3R1V A;  2KBM A;  1KK8 B;  2BAP A;  3D0Y A;  1KK7 Z;  5CSF A;  5HKW A;  2FOT A;  3R1P A;  4OZD A;  1IIO A;  1S26 D;  2BL0 C;  4PE7 A;  3JVT B;  4F0Z B;  1SY9 A;  2M29 A;  1QAS A;  2PYQ A;  1F4Q A;  2KFG A;  1LXF C;  2F33 A;  2L2C A;  3BOW B;  3EK4 A;  1WLM A;  3NGV A;  5DIC A;  4AQJ A;  3ZWH A;  1JFJ A;  3S0B A;  2F2P A;  1AUI B;  3BUN B;  3N7H A;  4JD9 A;  3S0A A;  4XYN A;  1Z2C B;  3FE9 A;  2NCP A;  4KYN A;  3GOF A;  2OTG B;  4MVF A;  2LM5 A;  4PE4 A;  3LL8 B;  3NSI A;  2KI4 C;  3I5G C;  3LK1 A;  1S6J A;  1JWD A;  4PE1 A;  1QX2 A;  3CZT X;  4WQ3 A;  4D1E A;  1KK8 C;  3FE6 A;  2PSR A;  3KPX A;  3OB1 B;  4GFT A;  4GPL B;  2JTZ A;  1E8A A;  1YVL A;  2JRF A;  3JVT C;  1RK9 A;  1IWQ A;  2JXL A;  3CLN A;  2KPH A; 
#chains in the Genus database with same CATH homology
 1G33 A;  2JNF A;  3JTD B;  2LAP A;  5D7F A;  1EG4 A;  4GGF A;  1S5G Y;  2BE6 A;  2K7D A;  2ZRT A;  1FF1 A;  1J7O A;  1BR4 B;  2HQ8 A;  3CTN A;  1K93 D;  2JT8 A;  3TS5 B;  2LUX A;  1UHH A;  2SCP A;  2OTG C;  4PHN A;  3DF0 A;  3VRO A;  1G4Y R;  2ZND A;  4MRY A;  1DMO A;  1B47 A;  2M8U A;  1K94 A;  1J55 A;  2FCE A;  4FTG A;  3TDZ A;  1CFP A;  3CWG A;  3DF0 B;  5ER5 A;  1F70 A;  4DRW A;  4CPV A;  2RGI A;  3KEV A;  1XK4 C;  2BCB A;  3JTD C;  3TUY C;  2ZN9 A;  4YRU A;  5DKN A;  1RWY A;  3DVM A;  1TIZ A;  3EKH A;  1A75 A;  5FYX A;  5AXI A;  1NCX A;  2LE9 B;  1B7T Y;  5K89 A;  5G08 A;  2LNK A;  3TS5 C;  1OOJ A;  2CCM A;  1GJY A;  1IKU A;  3WHU B;  2JQ6 A;  1S36 A;  4PHK A;  2JC2 A;  3GK1 A;  1CDL A;  1JF0 A;  2M1U A;  3CR5 X;  1KQV A;  1IG5 A;  1Y1U A;  1KFX S;  1A2X A;  3O4Y A;  4ZCV A;  2JT3 A;  3FS7 A;  1OZO A;  2BBM A;  2KDH A;  1BOD A;  2E6W A;  2M97 A;  4OV2 A;  1H8B A;  2ZNE A;  1OMV A;  2AUC A;  2JZI A;  2LMT A;  1SKT A;  4QJ5 B;  1KFU S;  1WRL A;  1W7I B;  4NDD A;  2TN4 A;  1TRF A;  2PMY A;  1NSH A;  2KGB C;  2LLU A;  2WOS A;  1BMO A;  2JTT A;  5HLV A;  1QX5 B;  1KWO B;  2KBI A;  1MXE A;  2BE4 A;  3VRR A;  1NYA A;  2I94 A;  2GGZ A;  1WLZ A;  2K2F A;  4YI8 A;  2MHH A;  1B8R A;  5I2L A;  2H61 A;  1K9P A;  3LCP C;  1DJG A;  4WQ2 A;  2L5X B;  2LVI A;  1J7Q A;  1GQM A;  1YVH A;  1BLQ A;  1Y0V H;  3K21 A;  1CDN A;  3BUX B;  1CFD A;  3IQQ A;  1IQ5 A;  4HRG A;  1KWO C;  5AFP A;  2ISD A;  4N1G A;  2OPO A;  1M31 A;  3BUM B;  2LP2 A;  1TNP A;  1V1F A;  3I5H B;  1NX2 A;  1YRU B;  3CGA A;  3TDI A;  1NPQ A;  2LLS A;  2GGM A;  1D1O A;  2LHI A;  1BF5 A;  3SG2 A;  1A03 A;  2OS8 B;  4HRH A;  4ORB B;  3OB2 B;  1TOP A;  1H4B A;  2L2E A;  1YUT A;  2M3W A;  1NIW A;  2CT9 A;  2BCA A;  4C0K A;  1F71 A;  3SG7 A;  1ZMZ A;  3RM1 A;  5IBW A;  1CM1 A;  1QTX A;  3BQ3 A;  1GGW A;  3D0Y B;  2QPT A;  2JNX A;  5TNC A;  4R1E A;  1B8L A;  4I5N B;  2MAZ A;  4ETO A;  1CMF A;  1YUU A;  5BPJ A;  3I5H C;  4PHM A;  1ALW A;  1QAT A;  4MBE A;  1Q80 A;  3OX6 A;  4I5J A;  1K9K A;  5AAN A;  1HT9 A;  2KAV A;  2KQY A;  1R6P A;  2OS8 C;  1DT7 B;  3NSK A;  1CDM A;  1YX7 A;  2GV5 A;  2HET A;  3AKB A;  3I5I B;  1DVI A;  1Y6W A;  4I5L B;  4N5X A;  2Y4Q A;  1DJY A;  1R2U A;  3O78 A;  1UP5 A;  1PVB A;  2L98 A;  2MJW B;  3BUO B;  4C0L A;  1YTZ C;  3TUY B;  1IJ5 A;  1YUS A;  2R2I A;  4CFR A;  2M0R A;  2L4I A;  1NUB A;  4HRE E;  2JOJ A;  2MBX A;  2JWW A;  4PE0 A;  3WXA A;  4QJ4 B;  1MWN A;  5HKY A;  5KU1 A;  2AMI A;  1SRA A;  5HKZ A;  1MXL C;  4M2Q A;  1J1D A;  2L50 A;  3SIB A;  3ZNI A;  3I5I C;  3M0W A;  1F54 A;  1TN4 A;  4P2Y B;  1BU3 A;  4MLW A;  2FJU B;  3TDU A;  2PAL A;  1JBA A;  3SG3 A;  1TNW A;  1BG1 A;  2P6B B;  3FWC A;  1LA0 A;  1UHK A;  1ZAC A;  1K90 D;  2CXJ A;  2A4J A;  2KNE A;  1XYD A;  1LA3 A;  2VRG A;  2M7L A;  4GGF C;  1L2O B;  3OX5 A;  2MRD A;  3PAT A;  1TCF A;  1QVI Z;  1DJZ A;  1A75 B;  1CLL A;  1IGV A;  1RRO A;  2JT0 A;  1Y1X A;  3LK0 A;  4WRI A;  1X02 A;  3NXA A;  1FPW A;  1B9A A;  2NZ0 A;  2K0J A;  1PK0 D;  2LVV A;  2WND A;  1QXP A;  1AJ5 A;  2HQW A;  1FW4 A;  1SK6 D;  3EKJ A;  4BY4 A;  2KFF A;  1EXR A;  2M7N A;  4GGN A;  4GAO A;  2NCO A;  2BBN A;  2PRU A;  4OR9 B;  1RJV A;  3IQO A;  3VRQ A;  3SG6 A;  1QX7 A;  2FCD A;  1MF8 B;  1KCY A;  1L2O C;  2KOT A;  1XFW O;  3KO0 A;  1NX1 A;  2AAO A;  3GK4 X;  1KK7 Y;  1QS7 A;  2QAC A;  1UHJ A;  2WC8 A;  4L9M A;  1K95 A;  4NDB A;  2MA2 A;  1SYM A;  2HPS A;  2LHL A;  4YBH B;  1U5I A;  1J7P A;  1MQ1 A;  2LMU A;  1PSR A;  2DOQ A;  2ZN8 A;  4M2P A;  4YGD B;  1YUR A;  2K61 A;  3VRN A;  1SW8 A;  1C7W A;  3EVV A;  2HF5 A;  1PRW A;  2JPT A;  1IJ6 A;  2ZRS A;  1K96 A;  4AOM A;  3EK7 A;  3PFV A;  4DS7 A;  1S5G Z;  1PAL A;  3AAJ A;  4PAL A;  1CFC A;  4CID A;  2L0P A;  1XFV O;  2JXC A;  2CTN A;  3WNX B;  1QJT A;  1DF0 A;  4PDZ A;  2F3Y A;  2JU0 A;  1ALV A;  4ORC B;  4QJ3 B;  4XJK A;  3SJS A;  1OSA A;  2PAS A;  5I2O A;  2V53 A;  1JF2 A;  1BT6 A;  1TNQ A;  2CBL A;  1SMG A;  3ICB A;  5CSJ A;  2KI6 C;  3PLF B;  1CKK A;  2LVK A;  3C1V A;  5JOL A;  2K7O A;  1AK8 A;  3EVR A;  4BY5 A;  1L7Z A;  4JQ0 D;  1KSO A;  3O2P A;  4MRX A;  3DVE A;  4JPZ B;  4MZL A;  1AHR A;  1PUL A;  2L51 A;  3O6B A;  4DIR A;  3D10 A;  2IS9 A;  1B7T Z;  1B8C A;  1NX0 A;  2H61 C;  1NCY A;  1N65 A;  1M46 A;  3I5F B;  2Y1N A;  4YGC B;  5I8N A;  1EJ3 A;  1WRK A;  2KAX A;  3TZ1 A;  1REC A;  1AVS A;  3NSL A;  4MZK A;  4YGA A;  1BOC A;  2G9B A;  5I2Q A;  1UHN A;  3SIA A;  1YX8 A;  2Y1M A;  3CR4 X;  1OE9 B;  1JFK A;  5HLO A;  1NWD A;  1M63 B;  1QV1 A;  3PM8 A;  1UHI A;  2K7B A;  1PVA A;  5DKR A;  1XA5 A;  2MLE C;  2I2R E;  2KI6 D;  1FI6 A;  1OZS A;  1UUR A;  2H2K A;  2LCP A;  3CR2 A;  1CTR A;  1ODB A;  5DKQ A;  3I5F C;  1K2H A;  1S3P A;  3BOW A;  1WDC B;  1AP4 A;  3KHE A;  2EC6 B;  1CLB A;  2WCF A;  1SCV A;  2EHB A;  1QLS A;  1SR6 B;  1WRZ A;  1DJH A;  1RTP 1;  2F8P A;  2MLF C;  3VRP A;  5KTY A;  2BEC A;  2KYC A;  2WCB A;  1N0Y A;  2K7C A;  2WCE A;  4USL A;  3MSE B;  1IQ3 A;  1F55 A;  3F45 A;  1XO5 A;  4OKH A;  1XK4 A;  1OMD A;  1EH2 A;  1Y1A A;  1YRT B;  2NLN A;  2F3Z A;  1PSB A;  2WOR A;  1WDC C;  1CM4 A;  2SAS A;  2BKH B;  2M9G A;  2EC6 C;  3KF9 A;  1A4P A;  2K8M B;  3SG4 A;  4P5O E;  4E68 A;  1XFY O;  1A29 A;  1SR6 C;  1B4C A;  1CNP A;  1G8I A;  1SNL A;  3SG5 A;  1IH0 A;  1XVJ A;  1TNX A;  2LC5 A;  1BR1 B;  2KGR A;  1NX3 A;  2M49 B;  2NXQ A;  1RFJ A;  5PAL A;  1DTL A;  2KSP A;  3RLZ A;  2PVB A;  1XFX O;  1LIN A;  1SL8 A;  1B1G A;  1DGU A;  2JUL A;  2G2B A;  1F8H A;  1K8U A;  3A4U B;  1DJW A;  1WY9 A;  3NSO A;  3GK2 A;  3AAK A;  2KQ6 A;  2Y5I A;  4YGB B;  3EK8 A;  5GQQ C;  3OP0 A;  1F4O A;  4ORA B;  3LLE A;  1SCM B;  4AQI A;  3HCM A;  2BKI B;  1QV0 A;  4TNC A;  2LV7 A;  3A8R A;  2LAN A;  4NQG A;  1S1E A;  1LVC D;  1S6I A;  2Q91 A;  2L4H A;  4PCW A;  1SL7 A;  4U8D A;  2E30 A;  5ER4 X;  3PAL A;  1KFX L;  2LP3 A;  4Q04 A;  3H4S E;  4YI9 A;  4MEW A;  1W7J B;  1SPY A;  3BYA A;  4NDC A;  4M2O A;  1M39 A;  1QLK A;  3HX4 A;  1K9U A;  3OHM B;  4ICB A;  4DUQ A;  1M45 A;  2B1U A;  3QRX A;  4IL1 A;  2LMV A;  3DD4 A;  4CLN A;  2ZKM X;  4YGE B;  3AKA A;  5JJG A;  1SCM C;  1U5I B;  3BXK A;  4MZJ A;  1JSA A;  1NCZ A;  2I18 A;  2LLT A;  4GNK B;  2O60 A;  3IF7 A;  1KFU L;  1AJ4 A;  5J3X A;  1KSM A;  1N2D A;  4A4B A;  1QIW A;  4CFQ A;  3E3R A;  5CPV A;  1BJF A;  2M1K B;  4GUK A;  1JUO A;  1CFF A;  1YR5 A;  3VGO A;  1SL9 A;  4OCI A;  1FI5 A;  2KFH A;  1TCO B;  1CDP A;  2I7A A;  5KSZ A;  4PHJ A;  3DVJ A;  3FWB A;  1DF0 B;  1MUX A;  1GGZ A;  2BCX A;  1OMR A;  2ZFD A;  1CB1 A;  1TTX A;  4MSP A;  5AEQ A;  5HYD A;  1XFU O;  4XJK B;  4FQO A;  4JWQ A;  1VRK A;  2CNP A;  1ZFS A;  5CSN A;  3DVK A;  1KQM B;  4GBA A;  1J7R A;  2LVJ A;  2K2A A;  1C07 A;  1EL4 A;  3PSR A;  1S6C A;  1SBJ A;  4HSZ A;  3PN7 B;  5AER A;  1QIV A;  2Q4U A;  4MN0 A;  3CS1 A;  5B8I B;  1IRJ A;  2D8N A;  4I5K A;  1CMG A;  1ZUZ A;  4DCK A;  1XFZ O;  3EVU A;  3WHT B;  4ZCU A;  1MHO A;  2KHN A;  1ZOT B;  2KYF A;  4A4C A;  2BL0 B;  1UUS A;  1C7V A;  1CLM A;  5CSI A;  1LKJ A;  4N1F A;  1MR8 A;  1OQP A;  1DJI A;  2COL B;  1V1G A;  1J1E A;  1KQM C;  2KAY A;  2EGD A;  2LUC A;  5F6T A;  1DJX A;  1QVI Y;  2O5G A;  5D69 A;  1UWO A;  3PN7 C;  1HQV A;  3BUW B;  4UPG A;  2F2O A;  4OVN F;  1FBV A;  1DGV A;  1JC2 A;  2KI4 B;  3I5G B;  1EG3 A;  3FIA A;  1NP8 A;  2KBM A;  1KK8 B;  3D0Y A;  5CSF A;  1KK7 Z;  5HKW A;  2FOT A;  1S26 D;  2BL0 C;  4PE7 A;  3JVT B;  4F0Z B;  1SY9 A;  2M29 A;  1QAS A;  1F4Q A;  2KFG A;  1LXF C;  2F33 A;  3BOW B;  3EK4 A;  1WLM A;  4AQJ A;  3ZWH A;  1JFJ A;  2F2P A;  1AUI B;  3BUN B;  4XYN A;  4MVF A;  2NCP A;  4PE4 A;  3GOF A;  2OTG B;  2LM5 A;  3LL8 B;  3NSI A;  2KI4 C;  3I5G C;  3LK1 A;  1S6J A;  1JWD A;  4PE1 A;  1QX2 A;  3CZT X;  4WQ3 A;  4D1E A;  1KK8 C;  2PSR A;  3KPX A;  3OB1 B;  4GFT A;  4GPL B;  2JTZ A;  1E8A A;  1YVL A;  2JRF A;  3JVT C;  1RK9 A;  1IWQ A;  2JXL A;  3CLN A;  4C0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...