2ZFDA

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein/transferase
total genus 69
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zfdA00
4M2QA 4Q04A 5CSJA 1QX2A 1OSAA 2OS8B 2ZNDA 3CZTX 1J7RA 1S6CA 1K9UA 1WRLA 1KSMA 1IH0A 2HF5A 1PVBA 1RECA 1XFVO 1GGZA 1FW4A 1YVHA 3VRQA 2FJUB 2ZN9A 1JUOA 1CMFA 2BE6A 1SR6C 2L51A 1L7ZA 1XFUO 2LCPA 2VRGA 1D1OA 1UHJA 1KWOC 2M1KB 3NSLA 4GPLB 1RJVA 1A75B 2L98A 1Y0VH 5I2LA 1A03A 4P2YB 4FTGA 3M0WA 4N1GA 3PFVA 2KFGA 4HRGA 4PE1A 1F8HA 3WXAA 1ALWA 1DJHA 1ZOTB 2L0PA 1G4YR 1F4OA 4E68A 1RROA 3ICBA 2LE9B 4CIDA 1OMVA 2B1UA 2H61A 2L2EA 1A2XA 2QPTA 2KNEA 3NSIA 2KGBC 3MSEB 1NWDA 3FS7A 1DJXA 1ALVA 1IG5A 4MZLA 1IWQA 2MJWB 5AXIA 3BUOB 4M2PA 1XFYO 2BCBA 3A8RA 3O78A 1JSAA 2M29A 1OZOA 1SNLA 1W7JB 1AUIB 1N2DA 4NDBA 2G9BA 2MHHA 2NCPA 1CM4A 4C0LA 1NCZA 1N65A 4ORAB 1LA3A 1QLSA 1Y6WA 2ZRTA 3BUNB 4UPGA 1GGWA 2K61A 1WDCB 1AHRA 3JTDC 1BMOA 1YX7A 2LM5A 4WQ2A 2MAZA 5D69A 2NZ0A 2CT9A 3O2PA 1M39A 1AP4A 2JU0A 3NXAA 3OX5A 1B1GA 1B8LA 5AEQA 1LVCD 1QASA 4DCKA 2JPTA 1V1GA 1UURA 1CTRA 1SCMB 4YGDB 2LHLA 1CMGA 5JOLA 2Q91A 1SMGA 2BL0C 5D7FA 1SL8A 3BUWB 2LVIA 4ICBA 1CDLA 3I5IC 5CSIA 5BPJA 1S5GY 1ZFSA 1CDMA 2K8MB 4YI8A 3AAJA 1SY9A 3DVEA 1RTP1 1J7PA 1FF1A 3CTNA 1YX8A 2SCPA 2JNFA 1G8IA 2K7OA 3TUYC 1TCFA 3CLNA 1JWDA 2LV7A 4XJKA 2Y4QA 2JOJA 1JF0A 4GBAA 5I8NA 2QACA 1DJWA 2KQ6A 1KQVA 1KFXS 1M63B 2Q4UA 3GK4X 4PHNA 1LXFC 3BQ3A 5F6TA 1AJ4A 1JF2A 2LVVA 1DJGA 2O60A 1XK4C 3FIAA 2L4IA 2WCFA 2OS8C 1CLMA 4YGBB 1F70A 4AQJA 1QLKA 2K7CA 1YUUA 3CWGA 1KFXL 3ZWHA 2BKHB 1Q80A 2EC6B 4JPZB 1H4BA 4OV2A 4OR9B 1AK8A 1K8UA 2G2BA 3OB1B 2WNDA 4PALA 5ER4X 3VROA 4QJ3B 2KI6C 2Y5IA 3K21A 2EGDA 3DVKA 1J55A 1C7VA 1SBJA 2K2AA 1EG4A 4YGAA 1MF8B 1Y1AA 2KQYA 3TDZA 2DOQA 4F0ZB 1RWYA 1YR5A 3KEVA 1C7WA 1XFXO 3TS5C 1PSRA 1V1FA 2M1UA 1L2OB 2SASA 3CGAA 1UWOA 2JWWA 1DF0B 1MQ1A 3AAKA 1QXPA 4I5KA 3SG4A 2KI6D 1YRTB 3TDIA 3C1VA 5CSNA 2IS9A 1ZMZA 1KK8B 2LVJA 3LL8B 4MN0A 1WY9A 5GQQC 1AVSA 2H61C 2BBNA 2RGIA 3KHEA 3I5GC 2AAOA 1JC2A 2BE4A 4BY5A 2I18A 3BYAA 1TRFA 1W7IB 4U8DA 1NCXA 1A75A 4N5XA 1B7TY 3FWBA 4MZKA 1QX7A 1QATA 5HKYA 2I7AA 1WLMA 4N1FA 1DMOA 1H8BA 1M46A 1S5GZ 1MXLC 3OP0A 1A4PA 5HYDA 1DGUA 1PK0D 1FI6A 4MLWA 4XYNA 1WDCC 5HLOA 1PALA 1B8RA 1DJZA 3PM8A 2OTGB 1UHNA 4C0KA 2NLNA 5I2QA 3IQQA 1OQPA 1QJTA 2L5XB 2ZFDA 1OE9B 3I5HB 2L4HA 4QJ4B 3EVUA 5HKZA 1ZACA 2LLTA 1MHOA 2PVBA 1SCMC 1SCVA 4A4BA 1CDPA 1RFJA 2K7BA 1SW8A 1YTZC 2CCMA 3I5FB 1NX2A 3BUXB 4OKHA 3RLZA 1BLQA 2K2FA 4C0JA 5FYXA 2MRDA 3PALA 1UP5A 2LNKA 2O5GA 1CM1A 1ODBA 3TZ1A 2JT0A 4I5LB 5JJGA 1NPQA 1TNWA 2F8PA 3BXKA 1K96A 1TNQA 1PULA 1G33A 2LMVA 2KHNA 3CR2A 3A4UB 2KYCA 2LVKA 1MR8A 3LLEA 2HQWA 1QX5B 3VGOA 3DF0B 2R2IA 3PATA 1OZSA 4HREE 1KK7Y 2JQ6A 2BCXA 2KAVA 5B8IB 2F3ZA 1QIVA 2ISDA 3TDUA 1TNXA 1XVJA 2JT8A 3PN7C 1DTLA 2M0RA 2WOSA 3EK4A 1QV0A 2LANA 3OB2B 3GOFA 3WHUB 1KWOB 4TNCA 1CKKA 1B9AA 3VRNA 1BODA 2LUXA 5HLVA 1KFUL 4GFTA 4CFRA 3JVTC 2KAXA 2ZRSA 1JFJA 1WRZA 3AKBA 2TN4A 4AQIA 2E30A 1B7TZ 4CFQA 3O6BA 3QRXA 1TCOB 5AANA 2EHBA 1J7QA 2PALA 4WQ3A 5DKNA 1S1EA 2GV5A 4DS7A 4DUQA 4BY4A 1B8CA 3PSRA 2FOTA 1K90D 2NCOA 5K89A 1YURA 1QV1A 3SG6A 4DIRA 2BBMA 5AERA 1EL4A 2M97A 2HQ8A 3HX4A 5DKRA 4MZJA 2BCAA 4P5OE 5KU1A 1XYDA 2JZIA 1YVLA 5J3XA 2F2PA 3EVRA 2KFHA 2WORA 2I94A 1M45A 2KBMA 2KFFA 2V53A 1DF0A 4R1EA 1KCYA 1B47A 1J1EA 1CB1A 1DJYA 3KPXA 4PDZA 1QS7A 2LP3A 2FCDA 2M49B 1F54A 1NSHA 1XFWO 1NIWA 2KI4B 4ORCB 4HRHA 1B4CA 4GNKB 4MSPA 1AJ5A 1CFDA 2KGRA 1MUXA 4USLA 1TOPA 3EVVA 1NP8A 1A29A 1CLBA 1SL9A 2BL0B 1OOJA 1NUBA 5G08A 4QJ5B 4YRUA 4GUKA 4GGFA 3DVJA 1KK7Z 2COLB 4I5JA 3VRRA 4AOMA 1CFPA 3LK0A 1YRUB 4MVFA 1YUSA 3TUYB 2K7DA 1CFCA 4A4CA 2H2KA 1RK9A 1U5IB 4PHJA 2FCEA 4FQOA 1XFZO 1EH2A 1IJ6A 4YBHB 4PE0A 4D1EA 4NDCA 5CPVA 4PE4A 2CNPA 1WRKA 3WNXB 1XO5A 5HKWA 1R2UA 1QVIY 1QIWA 1UHHA 3BOWB 5KTYA 2LP2A 5AFPA 2LHIA 3VRPA 4OCIA 1BU3A 1EJ3A 2LUCA 2LLUA 2P6BB 3IQOA 4I5NB 3SJSA 1JFKA 5IBWA 2JXCA 1XA5A 2HETA 1TNPA 1IQ5A 3DVMA 3PLFB 1MWNA 1BF5A 3LCPC 2KDHA 4NQGA 4DRWA 2E6WA 2LC5A 3LK1A 1DVIA 5ER5A 2M9GA 4PE7A 1UUSA 3TS5B 2KSPA 2CTNA 3SG2A 1IKUA 2WCBA 2OPOA 1N0YA 1S26D 3DF0A 3IF7A 1SYMA 1NX1A 2MLFC 1WLZA 3EK7A 1GQMA 1KQMB 3CS1A 1BR1B 3KO0A 2AUCA 1IQ3A 3KF9A 4JWQA 1R6PA 2WC8A 3F45A 1IGVA 3I5GB 2GGMA 1UHKA 4PHMA 2ZNEA 1J7OA 1NYAA 1ZUZA 1LKJA 2M8UA 1KFUS 1CNPA 1K9KA 2LMUA 3O4YA 5TNCA 4GGNA 1C07A 1S3PA 2CXJA 5PALA 5CSFA 1SR6B 1DJIA 1X02A 1FI5A 2EC6C 1K95A 2KAYA 3GK2A 4IL1A 1BG1A 1F71A 2L50A 2PRUA 1VRKA 2JTZA 2JTTA 3FWCA 2CBLA 4GAOA 2JRFA 1S6IA 2BECA 1LA0A 1QTXA 2HPSA 4OVNF 3NSOA 2MBXA 4MEWA 2A4JA 1J1DA 3GK1A 4M2OA 3E3RA 1YUTA 2MLEC 2PSRA 1EG3A 1K9PA 3OX6A 2F3YA 2KOTA 1OMDA 1BJFA 4CPVA 2Y1NA 4ORBB 2I2RE 1BT6A 1L2OC 1Y1XA 2KI4C 2Y1MA 3D10A 4MRYA 4PCWA 1NX0A 1PSBA 2KBIA 1KSOA 4HSZA 2F33A 1DGVA 1MXEA 1PRWA 1KK8C 4WRIA 1IJ5A 1OMRA 1QVIZ 1SPYA 1BR4B 1F55A 2BKIB 1K2HA 4YGCB 1SRAA 3SG3A 1IRJA 3EKHA 1CDNA 1M31A 1HQVA 1BOCA 4GGFC 1S36A 1K94A 3SIBA 2ZKMX 3BUMB 1HT9A 1SKTA 2AMIA 2JC2A 1GJYA 2JT3A 3WHTB 4XJKB 1JBAA 3JTDB 2NXQA 3AKAA 2JNXA 3NSKA 3RM1A 2K0JA 2LLSA 2MA2A 3OHMB 2OTGC 1SL7A 1EXRA 3HCMA 2WCEA 3CR5X 3H4SE 3SIAA 4CLNA 3EKJA 3CR4X 4ETOA 1CLLA 3I5HC 2F2OA 4NDDA 1NCYA 1Y1UA 4PHKA 4MBEA 1S6JA 4ZCUA 1UHIA 1TN4A 3PN7B 2LAPA 2ZN8A 1CFFA 2JULA 5DKQA 1NX3A 4JQ0D 1SK6D 1DT7B 1FPWA 3I5IB 2PASA 3D0YA 4L9MA 1F4QA 1U5IA 2JXLA 5I2OA 3EK8A 1TIZA 3I5FC 3ZNIA 3JVTB 4YGEB 1LINA 5KSZA 4YI9A 1E8AA 1TTXA 2LMTA 3D0YB 4MRXA 4ZCVA 3SG5A 2PMYA 1FBVA 1PVAA 3SG7A 2M7LA 1XK4A 3DD4A 2M3WA 2KYFA 1K93D 2D8NA 2M7NA 2GGZA 1KQMC 3BOWA
chains in the Genus database with same CATH superfamily
4M2QA 4Q04A 5CSJA 3CZ1A 1QX2A 1OSAA 2OS8B 2ZNDA 3CZTX 1J7RA 1S6CA 1K9UA 1WRLA 1KSMA 1IH0A 2HF5A 1PVBA 1RECA 3S0AA 1XFVO 1GGZA 1FW4A 1YVHA 3VRQA 2WCJA 1OOHA 2FJUB 2ZN9A 1JUOA 2KLEA 1CMFA 2BE6A 1SR6C 2L51A 1L7ZA 1XFUO 2LCPA 2VRGA 3DY9A 1D1OA 1UHJA 3RZSA 1KWOC 2M1KB 3NSLA 4GPLB 1RJVA 1A75B 2L98A 1Y0VH 5I2LA 1A03A 4P2YB 4FTGA 3M0WA 4N1GA 3PFVA 2KFGA 4HRGA 4PE1A 5I94A 1F8HA 3WXAA 1ALWA 1DJHA 1ZOTB 2L0PA 1G4YR 1F4OA 4E68A 1RROA 3ICBA 5DICA 2LE9B 2K60A 4CIDA 1OMVA 2B1UA 2H61A 2L2EA 1A2XA 4FQTA 2QPTA 2KNEA 3NSIA 2KGBC 3MSEB 1NWDA 3FS7A 1DJXA 1ALVA 1IG5A 3R1OA 4MZLA 3VB1A 1IWQA 2MJWB 5AXIA 3BUOB 3IVTA 4M2PA 1XFYO 2BCBA 3A8RA 3O78A 1JSAA 2M29A 1OZOA 1SNLA 1W7JB 2L2CA 1AUIB 1N2DA 3L4AA 4NDBA 2G9BA 2MHHA 2NCPA 3D76A 1CM4A 4C0LA 1NCZA 1N65A 4ORAB 1LA3A 1OOFA 1QLSA 1Y6WA 2ZRTA 1Z2CB 3BUNB 4UPGA 1GGWA 2K61A 1WDCB 2WC6A 3S0EA 1AHRA 3JTDC 1BMOA 1YX7A 2LM5A 4WQ2A 2MAZA 5D69A 3S0FA 2NZ0A 4KYNA 2CT9A 3O2PA 1M39A 3FE6A 1AP4A 2JU0A 3NXAA 3OX5A 1B1GA 2BNXA 1B8LA 5AEQA 1LVCD 2QEVA 1QASA 4DCKA 2P70A 2JPTA 1V1GA 1UURA 1CTRA 1SCMB 4YGDB 2LHLA 1CMGA 5JOLA 2Q91A 3B6XA 1SMGA 2BL0C 5D7FA 1SL8A 3BUWB 2LVIA 4ICBA 1CDLA 3I5IC 5CSIA 5BPJA 1S5GY 1ZFSA 1CDMA 2K8MB 4YI8A 3AAJA 1IIOA 1SY9A 3DVEA 1RTP1 1J7PA 1FF1A 3D73A 3CTNA 1YX8A 2SCPA 3CDNA 1W9ZA 2JNFA 1G8IA 2K7OA 3TUYC 1TCFA 2WCHA 3CLNA 3K1EA 1JWDA 2LV7A 3FE9A 4XJKA 2Y4QA 2JOJA 1JF0A 4GBAA 5I8NA 2QACA 1DJWA 2KQ6A 1KQVA 3D74A 1KFXS 1M63B 2Q4UA 1TUZA 3GK4X 4PHNA 1LXFC 3BQ3A 5F6TA 1AJ4A 1JF2A 2LVVA 1DJGA 2O60A 1XK4C 3FIAA 3PJIA 5FI2A 2L4IA 2WCFA 2OS8C 3V2LA 1CLMA 3SS3A 4YGBB 3NGVA 1F70A 4AQJA 1QLKA 2K7CA 1YUUA 3CWGA 1KFXL 3ZWHA 2BKHB 2QEHA 1Q80A 2EC6B 4JPZB 1H4BA 4OV2A 4OR9B 1AK8A 1C3YA 1K8UA 2G2BA 3OB1B 2WNDA 4PALA 5ER4X 3VROA 4QJ3B 2KI6C 2Y5IA 3K21A 2EGDA 3DVKA 1J55A 1C7VA 1SBJA 2K2AA 1EG4A 4YGAA 1MF8B 1Y1AA 2KQYA 3TDZA 4INXA 2DOQA 4PHKA 4F0ZB 1RWYA 1YR5A 3R1PA 3KEVA 1C7WA 1XFXO 2GTEA 1PSRA 1V1FA 2M1UA 1L2OB 2SASA 3CGAA 3DZTA 1UWOA 2JWWA 1DF0B 1MQ1A 3AAKA 1QXPA 4I5KA 3SG4A 2KI6D 1YRTB 3TDIA 3C1VA 5CSNA 2IS9A 1ZMZA 1KK8B 2LVJA 3LL8B 4MN0A 3D77A 1WY9A 4JKTA 5GQQC 1AVSA 2H61C 2BBNA 2RGIA 3KHEA 3I5GC 2AAOA 1JC2A 1OW4A 2BE4A 4BY5A 2I18A 3SS4A 3UNWA 3BYAA 1TRFA 3D75A 1W7IB 4U8DA 1NCXA 1A75A 4N5XA 1B7TY 3FWBA 4MZKA 1QX7A 1QATA 3D78A 5HKYA 2I7AA 1WLMA 4N1FA 1DMOA 1H8BA 1M46A 1S5GZ 1MXLC 3OP0A 1A4PA 3BFAA 2KPHA 2WCLA 5HYDA 1DGUA 1PK0D 1FI6A 3L4LA 4MLWA 4PT1A 4XYNA 1WDCC 5HLOA 1PALA 1B8RA 1DJZA 3PM8A 2OTGB 1UHNA 4C0KA 2NLNA 5I2QA 3IQQA 1OQPA 1QJTA 2L5XB 2ZFDA 1OE9B 3I5HB 2L4HA 4QJ4B 3EVUA 5HKZA 1ZACA 2LLTA 3CYZA 3B87A 1MHOA 2PVBA 3DXLA 1SCMC 1SCVA 4A4BA 1CDPA 1RFJA 2K7BA 1SW8A 2WC5A 1YTZC 2CCMA 3I5FB 1NX2A 3BUXB 4OKHA 3RLZA 1BLQA 2K2FA 4C0JA 5FYXA 2MRDA 3N7HA 4JD9A 3PALA 1UP5A 2LNKA 2O5GA 3SS5A 1CM1A 1ODBA 3TZ1A 2JT0A 4I5LB 5JJGA 1NPQA 1TNWA 2F8PA 3BXKA 1K96A 1TNQA 3Q8IA 1PULA 1G33A 2LMVA 2L5YA 2KHNA 3CR2A 3A4UB 2KYCA 2LVKA 1MR8A 3LLEA 2HQWA 1QX5B 3VGOA 3DF0B 2KLDA 2R2IA 3PATA 1OZSA 4HREE 1KK7Y 2JQ6A 2BCXA 2KAVA 5B8IB 2F3ZA 1QIVA 2ISDA 3TDUA 1TNXA 1XVJA 2JT8A 5D3OA 3PN7C 2WCMA 1DTLA 2M0RA 2WOSA 3EK4A 1QV0A 2LANA 3EG5B 3PM2A 3OB2B 3GOFA 3WHUB 1KWOB 3S0DA 2QDIA 4TNCA 1CKKA 1B9AA 3VRNA 1BODA 2LUXA 5HLVA 1KFUL 4GFTA 4CFRA 5EL2A 3JVTC 2KAXA 2QEOA 2ZRSA 1JFJA 1WRZA 3AKBA 3BFBA 2TN4A 4AQIA 2E30A 1B7TZ 4CFQA 3O6BA 3QRXA 1TCOB 5AANA 2EHBA 1J7QA 1C3ZA 2PALA 4WQ3A 5DKNA 1S1EA 2GV5A 4DS7A 4DUQA 4BY4A 1B8CA 3PSRA 2FOTA 1K90D 2NCOA 3S0BA 1YURA 5K89A 1QV1A 3SG6A 4DIRA 2BBMA 5AERA 1EL4A 2M97A 2HQ8A 3HX4A 5DKRA 1XFRA 4MZJA 2BCAA 4P5OE 5KU1A 1XYDA 2JZIA 1OOGA 1YVLA 5J3XA 2F2PA 3EVRA 2KFHA 2WORA 2I94A 1M45A 2KBMA 2KFFA 2V53A 1DF0A 4R1EA 3S0GA 1KCYA 1B47A 1J1EA 1ORGA 1CB1A 1DJYA 3KPXA 3R1VA 4PDZA 1QS7A 2LP3A 3B88A 2FCDA 2M49B 1F54A 1NSHA 1XFWO 1NIWA 2KI4B 4ORCB 1OOIX 4HRHA 1B4CA 4GNKB 4MSPA 1AJ5A 1CFDA 2KGRA 1MUXA 3OGNA 1TOPA 3EVVA 1NP8A 1A29A 4USLA 1SL9A 2BL0B 1OOJA 2YGUA 1CLBA 1NUBA 5G08A 4QJ5B 4YRUA 4GUKA 3FE8A 4GGFA 1LS8A 2FJYA 1KK7Z 2COLB 3DVJA 4I5JA 3VRRA 4AOMA 1CFPA 3LK0A 1YRUB 4MVFA 1YUSA 3TUYB 2K7DA 1CFCA 2ERBA 2WCKA 3CZ0A 4A4CA 2H2KA 1RK9A 1U5IB 4PHJA 2FCEA 4FQOA 1XFZO 3NHTA 1EH2A 1IJ6A 4YBHB 2BAPA 4PE0A 4D1EA 4NDCA 5CPVA 4PE4A 2CNPA 1WRKA 3R72A 3WNXB 1XO5A 5HKWA 1R2UA 1QVIY 1QIWA 2PQLA 1UHHA 3BOWB 5KTYA 1TUJA 2LP2A 5AFPA 2QEBA 2LHIA 3VRPA 4OCIA 1BU3A 1EJ3A 2LUCA 2LLUA 2P6BB 3IQOA 4I5NB 3SJSA 3UO9A 1JFKA 5IBWA 2JXCA 1XA5A 2HETA 1TNPA 1IQ5A 3DVMA 3DYEA 3PLFB 1MWNA 1BF5A 3LCPC 2KDHA 4NQGA 4DRWA 2E6WA 2LC5A 1DC1A 1QWVA 3L47A 3LK1A 1DVIA 4F7FA 5ER5A 2M9GA 1GM0A 4PE7A 1P28A 1UUSA 2KSPA 2CTNA 3SG2A 3TS5B 1IKUA 1DEKA 2WCBA 2OPOA 1N0YA 1S26D 3DF0A 3IF7A 1SYMA 1NX1A 2MLFC 3NHIA 1WLZA 3EK7A 1GQMA 1KQMB 3CS1A 1BR1B 3KO0A 2AUCA 1IQ3A 3KF9A 4JWQA 1R6PA 2WC8A 3F45A 1IGVA 1DELA 5FI7A 3I5GB 2GGMA 1UHKA 4PHMA 2ZNEA 1J7OA 1NYAA 1ZUZA 1LKJA 1SSEB 2M8UA 1KFUS 1CNPA 1K9KA 2LMUA 3O4YA 5TNCA 4GGNA 1C07A 1S3PA 2CXJA 5PALA 5CSFA 5FI6A 1SR6B 1DJIA 1X02A 1FI5A 2EC6C 1K95A 2KAYA 3GK2A 4IL1A 1BG1A 1F71A 2L50A 2PRUA 1VRKA 2JTZA 2JTTA 3FWCA 2CBLA 4GAOA 2JRFA 1S6IA 2BECA 1LA0A 1QTXA 1T14A 2HPSA 3NSOA 4OVNF 2MBXA 4MEWA 2A4JA 1J1DA 3GK1A 4M2OA 3E3RA 1YUTA 2MLEC 2PSRA 1EG3A 1K9PA 3OX6A 2F3YA 2KOTA 1OMDA 1BJFA 4CPVA 2Y1NA 4ORBB 2I2RE 1BT6A 1L2OC 1Y1XA 2KI4C 2Y1MA 3D10A 4MRYA 4PCWA 1NX0A 1PSBA 2KBIA 1KSOA 4HSZA 2F33A 4OZDA 1DGVA 1MXEA 1PRWA 1KK8C 4WRIA 1IJ5A 1OMRA 1QVIZ 1SPYA 1BR4B 1F55A 4INWA 2BKIB 1K2HA 4YGCB 1SRAA 3SG3A 1IRJA 3EKHA 1CDNA 1M31A 1HQVA 1BOCA 4GGFC 1S36A 3B86A 3OBVA 2PYQA 1K94A 3CZ2A 3SIBA 2ZKMX 3BUMB 1HT9A 1SKTA 2AMIA 2JC2A 1GJYA 2JT3A 3WHTB 4XJKB 1JBAA 3JTDB 2NXQA 5HL1A 3AKAA 2JNXA 3BJHA 3BFHA 2K0JA 2LLSA 3NSKA 2MA2A 3OHMB 3RM1A 2OTGC 1SL7A 1EXRA 3HCMA 2WCEA 3CR5X 2H8VA 3H4SE 3SIAA 4CLNA 3EKJA 3CR4X 4ETOA 1CLLA 3I5HC 2F2OA 3CABA 1NCYA 1Y1UA 1Z4HA 3QMEA 1S6JA 4MBEA 4NDDA 1UHIA 1TN4A 3PN7B 2LAPA 2ZN8A 4ZCUA 2JULA 1CFFA 5DKQA 1NX3A 4JQ0D 1SK6D 1DT7B 1FPWA 3I5IB 3O4XA 1TWOA 2PASA 3B7AA 3D0YA 4L9MA 1F4QA 1U5IA 2JXLA 5I2OA 3EK8A 1TIZA 3I5FC 3ZNIA 3JVTB 4YGEB 1LINA 5KSZA 4YI9A 1E8AA 1TTXA 2LMTA 3D0YB 4MRXA 4ZCVA 3SG5A 2PMYA 1FBVA 1PVAA 3SG7A 2JPOA 2M7LA 1XK4A 3DD4A 2M3WA 4IJ7A 2KYFA 1K93D 2P71A 1DQEA 2D8NA 2M7NA 2GGZA 1KQMC 3TS5C 3BOWA
chains in the Genus database with same CATH topology
4M2QA 4Q04A 5CSJA 1QX2A 1OSAA 2OS8B 2ZNDA 3CZTX 1J7RA 1S6CA 1K9UA 1WRLA 1KSMA 1IH0A 2HF5A 1PVBA 1RECA 1XFVO 1GGZA 1FW4A 1YVHA 3VRQA 2FJUB 2ZN9A 1JUOA 1CMFA 2BE6A 1SR6C 2L51A 1L7ZA 1XFUO 2LCPA 2VRGA 1D1OA 1UHJA 1KWOC 2M1KB 3NSLA 4GPLB 1RJVA 1A75B 2L98A 1Y0VH 5I2LA 1A03A 4P2YB 4FTGA 3M0WA 4N1GA 3PFVA 2KFGA 4HRGA 4PE1A 1F8HA 3WXAA 1ALWA 1DJHA 1ZOTB 2L0PA 1G4YR 1F4OA 4E68A 1RROA 3ICBA 2LE9B 4CIDA 1OMVA 2B1UA 2H61A 2L2EA 1A2XA 2QPTA 2KNEA 3NSIA 2KGBC 3MSEB 1NWDA 3FS7A 1DJXA 1ALVA 1IG5A 4MZLA 1IWQA 2MJWB 5AXIA 3BUOB 4M2PA 1XFYO 2BCBA 3A8RA 3O78A 1JSAA 2M29A 1OZOA 1SNLA 1W7JB 1AUIB 1N2DA 4NDBA 2G9BA 2MHHA 2NCPA 1CM4A 4C0LA 1NCZA 1N65A 4ORAB 1LA3A 1QLSA 1Y6WA 2ZRTA 3BUNB 4UPGA 1GGWA 2K61A 1WDCB 1AHRA 3JTDC 1BMOA 1YX7A 2LM5A 4WQ2A 2MAZA 5D69A 2NZ0A 2CT9A 3O2PA 1M39A 1AP4A 2JU0A 3NXAA 3OX5A 1B1GA 1B8LA 5AEQA 1LVCD 1QASA 4DCKA 2JPTA 1V1GA 1UURA 1CTRA 1SCMB 4YGDB 2LHLA 1CMGA 5JOLA 2Q91A 1SMGA 2BL0C 5D7FA 1SL8A 3BUWB 2LVIA 4ICBA 1CDLA 3I5IC 5CSIA 5BPJA 1S5GY 1ZFSA 1CDMA 2K8MB 4YI8A 3AAJA 1SY9A 3DVEA 1RTP1 1J7PA 1FF1A 3CTNA 1YX8A 2SCPA 2JNFA 1G8IA 2K7OA 3TUYC 1TCFA 3CLNA 1JWDA 2LV7A 4XJKA 2Y4QA 2JOJA 1JF0A 4GBAA 5I8NA 2QACA 1DJWA 2KQ6A 1KQVA 1KFXS 1M63B 2Q4UA 3GK4X 4PHNA 1LXFC 3BQ3A 5F6TA 1AJ4A 1JF2A 2LVVA 1DJGA 2O60A 1XK4C 3FIAA 2L4IA 2WCFA 2OS8C 1CLMA 4YGBB 1F70A 4AQJA 1QLKA 2K7CA 1YUUA 3CWGA 1KFXL 3ZWHA 2BKHB 1Q80A 2EC6B 4JPZB 1H4BA 4OV2A 4OR9B 1AK8A 1K8UA 2G2BA 3OB1B 2WNDA 4PALA 5ER4X 3VROA 4QJ3B 2KI6C 2Y5IA 3K21A 2EGDA 3DVKA 1J55A 1C7VA 1SBJA 2K2AA 1EG4A 4YGAA 1MF8B 1Y1AA 2KQYA 3TDZA 2DOQA 4F0ZB 1RWYA 1YR5A 3KEVA 1C7WA 1XFXO 3TS5C 1PSRA 1V1FA 2M1UA 1L2OB 2SASA 3CGAA 1UWOA 2JWWA 1DF0B 1MQ1A 3AAKA 1QXPA 4I5KA 3SG4A 2KI6D 1YRTB 3TDIA 3C1VA 5CSNA 2IS9A 1ZMZA 1KK8B 2LVJA 3LL8B 4MN0A 1WY9A 5GQQC 1AVSA 2H61C 2BBNA 2RGIA 3KHEA 3I5GC 2AAOA 1JC2A 2BE4A 4BY5A 2I18A 3BYAA 1TRFA 1W7IB 4U8DA 1NCXA 1A75A 4N5XA 1B7TY 3FWBA 4MZKA 1QX7A 1QATA 5HKYA 2I7AA 1WLMA 4N1FA 1DMOA 1H8BA 1M46A 1S5GZ 1MXLC 3OP0A 1A4PA 5HYDA 1DGUA 1PK0D 1FI6A 4MLWA 4XYNA 1WDCC 5HLOA 1PALA 1B8RA 1DJZA 3PM8A 2OTGB 1UHNA 4C0KA 2NLNA 5I2QA 3IQQA 1OQPA 1QJTA 2L5XB 2ZFDA 1OE9B 3I5HB 2L4HA 4QJ4B 3EVUA 5HKZA 1ZACA 2LLTA 1MHOA 2PVBA 1SCMC 1SCVA 4A4BA 1CDPA 1RFJA 2K7BA 1SW8A 1YTZC 2CCMA 3I5FB 1NX2A 3BUXB 4OKHA 3RLZA 1BLQA 2K2FA 4C0JA 5FYXA 2MRDA 3PALA 1UP5A 2LNKA 2O5GA 1CM1A 1ODBA 3TZ1A 2JT0A 4I5LB 5JJGA 1NPQA 1TNWA 2F8PA 3BXKA 1K96A 1TNQA 1PULA 1G33A 2LMVA 2KHNA 3CR2A 3A4UB 2KYCA 2LVKA 1MR8A 3LLEA 2HQWA 1QX5B 3VGOA 3DF0B 2R2IA 3PATA 1OZSA 4HREE 1KK7Y 2JQ6A 2BCXA 2KAVA 5B8IB 2F3ZA 1QIVA 2ISDA 3TDUA 1TNXA 1XVJA 2JT8A 3PN7C 1DTLA 2M0RA 2WOSA 3EK4A 1QV0A 2LANA 3OB2B 3GOFA 3WHUB 1KWOB 4TNCA 1CKKA 1B9AA 3VRNA 1BODA 2LUXA 5HLVA 1KFUL 4GFTA 4CFRA 3JVTC 2KAXA 2ZRSA 1JFJA 1WRZA 3AKBA 2TN4A 4AQIA 2E30A 1B7TZ 4CFQA 3O6BA 3QRXA 1TCOB 5AANA 2EHBA 1J7QA 2PALA 4WQ3A 5DKNA 1S1EA 2GV5A 4DS7A 4DUQA 4BY4A 1B8CA 3PSRA 2FOTA 1K90D 2NCOA 5K89A 1YURA 1QV1A 3SG6A 4DIRA 2BBMA 5AERA 1EL4A 2M97A 2HQ8A 3HX4A 5DKRA 4MZJA 2BCAA 4P5OE 5KU1A 1XYDA 2JZIA 1YVLA 5J3XA 2F2PA 3EVRA 2KFHA 2WORA 2I94A 1M45A 2KBMA 2KFFA 2V53A 1DF0A 4R1EA 1KCYA 1B47A 1J1EA 1CB1A 1DJYA 3KPXA 4PDZA 1QS7A 2LP3A 2FCDA 2M49B 1F54A 1NSHA 1XFWO 1NIWA 2KI4B 4ORCB 4HRHA 1B4CA 4GNKB 4MSPA 1AJ5A 1CFDA 2KGRA 1MUXA 4USLA 1TOPA 3EVVA 1NP8A 1A29A 1CLBA 1SL9A 2BL0B 1OOJA 1NUBA 5G08A 4QJ5B 4YRUA 4GUKA 4GGFA 3DVJA 1KK7Z 2COLB 4I5JA 3VRRA 4AOMA 1CFPA 3LK0A 1YRUB 4MVFA 1YUSA 3TUYB 2K7DA 1CFCA 4A4CA 2H2KA 1RK9A 1U5IB 4PHJA 2FCEA 4FQOA 1XFZO 1EH2A 1IJ6A 4YBHB 4PE0A 4D1EA 4NDCA 5CPVA 4PE4A 2CNPA 1WRKA 3WNXB 1XO5A 5HKWA 1R2UA 1QVIY 1QIWA 1UHHA 3BOWB 5KTYA 2LP2A 5AFPA 2LHIA 3VRPA 4OCIA 1BU3A 1EJ3A 2LUCA 2LLUA 2P6BB 3IQOA 4I5NB 3SJSA 1JFKA 5IBWA 2JXCA 1XA5A 2HETA 1TNPA 1IQ5A 3DVMA 3PLFB 1MWNA 1BF5A 3LCPC 2KDHA 4NQGA 4DRWA 2E6WA 2LC5A 3LK1A 1DVIA 5ER5A 2M9GA 4PE7A 1UUSA 3TS5B 2KSPA 2CTNA 3SG2A 1IKUA 2WCBA 2OPOA 1N0YA 1S26D 3DF0A 3IF7A 1SYMA 1NX1A 2MLFC 1WLZA 3EK7A 1GQMA 1KQMB 3CS1A 1BR1B 3KO0A 2AUCA 1IQ3A 3KF9A 4JWQA 1R6PA 2WC8A 3F45A 1IGVA 3I5GB 2GGMA 1UHKA 4PHMA 2ZNEA 1J7OA 1NYAA 1ZUZA 1LKJA 2M8UA 1KFUS 1CNPA 1K9KA 2LMUA 3O4YA 5TNCA 4GGNA 1C07A 1S3PA 2CXJA 5PALA 5CSFA 1SR6B 1DJIA 1X02A 1FI5A 2EC6C 1K95A 2KAYA 3GK2A 4IL1A 1BG1A 1F71A 2L50A 2PRUA 1VRKA 2JTZA 2JTTA 3FWCA 2CBLA 4GAOA 2JRFA 1S6IA 2BECA 1LA0A 1QTXA 2HPSA 4OVNF 3NSOA 2MBXA 4MEWA 2A4JA 1J1DA 3GK1A 4M2OA 3E3RA 1YUTA 2MLEC 2PSRA 1EG3A 1K9PA 3OX6A 2F3YA 2KOTA 1OMDA 1BJFA 4CPVA 2Y1NA 4ORBB 2I2RE 1BT6A 1L2OC 1Y1XA 2KI4C 2Y1MA 3D10A 4MRYA 4PCWA 1NX0A 1PSBA 2KBIA 1KSOA 4HSZA 2F33A 1DGVA 1MXEA 1PRWA 1KK8C 4WRIA 1IJ5A 1OMRA 1QVIZ 1SPYA 1BR4B 1F55A 2BKIB 1K2HA 4YGCB 1SRAA 3SG3A 1IRJA 3EKHA 1CDNA 1M31A 1HQVA 1BOCA 4GGFC 1S36A 1K94A 3SIBA 2ZKMX 3BUMB 1HT9A 1SKTA 2AMIA 2JC2A 1GJYA 2JT3A 3WHTB 4XJKB 1JBAA 3JTDB 2NXQA 3AKAA 2JNXA 3NSKA 3RM1A 2K0JA 2LLSA 2MA2A 3OHMB 2OTGC 1SL7A 1EXRA 3HCMA 2WCEA 3CR5X 3H4SE 3SIAA 4CLNA 3EKJA 3CR4X 4ETOA 1CLLA 3I5HC 2F2OA 4NDDA 1NCYA 1Y1UA 4PHKA 4MBEA 1S6JA 4ZCUA 1UHIA 1TN4A 3PN7B 2LAPA 2ZN8A 1CFFA 2JULA 5DKQA 1NX3A 4JQ0D 1SK6D 1DT7B 1FPWA 3I5IB 2PASA 3D0YA 4L9MA 1F4QA 1U5IA 2JXLA 5I2OA 3EK8A 1TIZA 3I5FC 3ZNIA 3JVTB 4YGEB 1LINA 5KSZA 4YI9A 1E8AA 1TTXA 2LMTA 3D0YB 4MRXA 4ZCVA 3SG5A 2PMYA 1FBVA 1PVAA 3SG7A 2M7LA 1XK4A 3DD4A 2M3WA 2KYFA 1K93D 2D8NA 2M7NA 2GGZA 1KQMC 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M2Q A;  4Q04 A;  5CSJ A;  1QX2 A;  1OSA A;  2OS8 B;  2ZND A;  3CZT X;  1J7R A;  1S6C A;  1K9U A;  1WRL A;  1KSM A;  1IH0 A;  2HF5 A;  1PVB A;  1REC A;  1XFV O;  1GGZ A;  1FW4 A;  1YVH A;  3VRQ A;  2FJU B;  2ZN9 A;  1JUO A;  1CMF A;  2BE6 A;  1SR6 C;  2L51 A;  1L7Z A;  1XFU O;  2LCP A;  2VRG A;  1D1O A;  1UHJ A;  1KWO C;  2M1K B;  3NSL A;  4GPL B;  1RJV A;  1A75 B;  2L98 A;  1Y0V H;  5I2L A;  1A03 A;  4P2Y B;  4FTG A;  3M0W A;  4N1G A;  3PFV A;  2KFG A;  4HRG A;  4PE1 A;  1F8H A;  3WXA A;  1ALW A;  1DJH A;  1ZOT B;  2L0P A;  1G4Y R;  1F4O A;  4E68 A;  1RRO A;  3ICB A;  2LE9 B;  4CID A;  1OMV A;  2B1U A;  2H61 A;  2L2E A;  1A2X A;  2QPT A;  2KNE A;  3NSI A;  2KGB C;  3MSE B;  1NWD A;  3FS7 A;  1DJX A;  1ALV A;  1IG5 A;  4MZL A;  1IWQ A;  2MJW B;  5AXI A;  3BUO B;  4M2P A;  1XFY O;  2BCB A;  3A8R A;  3O78 A;  1JSA A;  2M29 A;  1OZO A;  1SNL A;  1W7J B;  1AUI B;  1N2D A;  4NDB A;  2G9B A;  2MHH A;  2NCP A;  1CM4 A;  4C0L A;  1NCZ A;  1N65 A;  4ORA B;  1LA3 A;  1QLS A;  1Y6W A;  2ZRT A;  3BUN B;  4UPG A;  1GGW A;  2K61 A;  1WDC B;  1AHR A;  3JTD C;  1BMO A;  1YX7 A;  2LM5 A;  4WQ2 A;  2MAZ A;  5D69 A;  2NZ0 A;  2CT9 A;  3O2P A;  1M39 A;  1AP4 A;  2JU0 A;  3NXA A;  3OX5 A;  1B1G A;  1B8L A;  5AEQ A;  1LVC D;  1QAS A;  4DCK A;  2JPT A;  1V1G A;  1UUR A;  1CTR A;  1SCM B;  4YGD B;  2LHL A;  1CMG A;  5JOL A;  2Q91 A;  1SMG A;  2BL0 C;  5D7F A;  1SL8 A;  3BUW B;  2LVI A;  4ICB A;  1CDL A;  3I5I C;  5CSI A;  5BPJ A;  1S5G Y;  1ZFS A;  1CDM A;  2K8M B;  4YI8 A;  3AAJ A;  1SY9 A;  3DVE A;  1RTP 1;  1J7P A;  1FF1 A;  3CTN A;  1YX8 A;  2SCP A;  2JNF A;  1G8I A;  2K7O A;  3TUY C;  1TCF A;  3CLN A;  1JWD A;  2LV7 A;  4XJK A;  2Y4Q A;  2JOJ A;  1JF0 A;  4GBA A;  5I8N A;  2QAC A;  1DJW A;  2KQ6 A;  1KQV A;  1KFX S;  1M63 B;  2Q4U A;  3GK4 X;  4PHN A;  1LXF C;  3BQ3 A;  5F6T A;  1AJ4 A;  1JF2 A;  2LVV A;  1DJG A;  2O60 A;  1XK4 C;  3FIA A;  2L4I A;  2WCF A;  2OS8 C;  1CLM A;  4YGB B;  1F70 A;  4AQJ A;  1QLK A;  2K7C A;  1YUU A;  3CWG A;  1KFX L;  3ZWH A;  2BKH B;  1Q80 A;  2EC6 B;  4JPZ B;  1H4B A;  4OV2 A;  4OR9 B;  1AK8 A;  1K8U A;  2G2B A;  3OB1 B;  2WND A;  4PAL A;  5ER4 X;  3VRO A;  4QJ3 B;  2KI6 C;  2Y5I A;  3K21 A;  2EGD A;  3DVK A;  1J55 A;  1C7V A;  1SBJ A;  2K2A A;  1EG4 A;  4YGA A;  1MF8 B;  1Y1A A;  2KQY A;  3TDZ A;  2DOQ A;  4F0Z B;  1RWY A;  1YR5 A;  3KEV A;  1C7W A;  1XFX O;  3TS5 C;  1PSR A;  1V1F A;  2M1U A;  1L2O B;  2SAS A;  3CGA A;  1UWO A;  2JWW A;  1DF0 B;  1MQ1 A;  3AAK A;  1QXP A;  4I5K A;  3SG4 A;  2KI6 D;  1YRT B;  3TDI A;  3C1V A;  5CSN A;  2IS9 A;  1ZMZ A;  1KK8 B;  2LVJ A;  3LL8 B;  4MN0 A;  1WY9 A;  5GQQ C;  1AVS A;  2H61 C;  2BBN A;  2RGI A;  3KHE A;  3I5G C;  2AAO A;  1JC2 A;  2BE4 A;  4BY5 A;  2I18 A;  3BYA A;  1TRF A;  1W7I B;  4U8D A;  1NCX A;  1A75 A;  4N5X A;  1B7T Y;  3FWB A;  4MZK A;  1QX7 A;  1QAT A;  5HKY A;  2I7A A;  1WLM A;  4N1F A;  1DMO A;  1H8B A;  1M46 A;  1S5G Z;  1MXL C;  3OP0 A;  1A4P A;  5HYD A;  1DGU A;  1PK0 D;  1FI6 A;  4MLW A;  4XYN A;  1WDC C;  5HLO A;  1PAL A;  1B8R A;  1DJZ A;  3PM8 A;  2OTG B;  1UHN A;  4C0K A;  2NLN A;  5I2Q A;  3IQQ A;  1OQP A;  1QJT A;  2L5X B;  2ZFD A;  1OE9 B;  3I5H B;  2L4H A;  4QJ4 B;  3EVU A;  5HKZ A;  1ZAC A;  2LLT A;  1MHO A;  2PVB A;  1SCM C;  1SCV A;  4A4B A;  1CDP A;  1RFJ A;  2K7B A;  1SW8 A;  1YTZ C;  2CCM A;  3I5F B;  1NX2 A;  3BUX B;  4OKH A;  3RLZ A;  1BLQ A;  2K2F A;  4C0J A;  5FYX A;  2MRD A;  3PAL A;  1UP5 A;  2LNK A;  2O5G A;  1CM1 A;  1ODB A;  3TZ1 A;  2JT0 A;  4I5L B;  5JJG A;  1NPQ A;  1TNW A;  2F8P A;  3BXK A;  1K96 A;  1TNQ A;  1PUL A;  1G33 A;  2LMV A;  2KHN A;  3CR2 A;  3A4U B;  2KYC A;  2LVK A;  1MR8 A;  3LLE A;  2HQW A;  1QX5 B;  3VGO A;  3DF0 B;  2R2I A;  3PAT A;  1OZS A;  4HRE E;  1KK7 Y;  2JQ6 A;  2BCX A;  2KAV A;  5B8I B;  2F3Z A;  1QIV A;  2ISD A;  3TDU A;  1TNX A;  1XVJ A;  2JT8 A;  3PN7 C;  1DTL A;  2M0R A;  2WOS A;  3EK4 A;  1QV0 A;  2LAN A;  3OB2 B;  3GOF A;  3WHU B;  1KWO B;  4TNC A;  1CKK A;  1B9A A;  3VRN A;  1BOD A;  2LUX A;  5HLV A;  1KFU L;  4GFT A;  4CFR A;  3JVT C;  2KAX A;  2ZRS A;  1JFJ A;  1WRZ A;  3AKB A;  2TN4 A;  4AQI A;  2E30 A;  1B7T Z;  4CFQ A;  3O6B A;  3QRX A;  1TCO B;  5AAN A;  2EHB A;  1J7Q A;  2PAL A;  4WQ3 A;  5DKN A;  1S1E A;  2GV5 A;  4DS7 A;  4DUQ A;  4BY4 A;  1B8C A;  3PSR A;  2FOT A;  1K90 D;  2NCO A;  5K89 A;  1YUR A;  1QV1 A;  3SG6 A;  4DIR A;  2BBM A;  5AER A;  1EL4 A;  2M97 A;  2HQ8 A;  3HX4 A;  5DKR A;  4MZJ A;  2BCA A;  4P5O E;  5KU1 A;  1XYD A;  2JZI A;  1YVL A;  5J3X A;  2F2P A;  3EVR A;  2KFH A;  2WOR A;  2I94 A;  1M45 A;  2KBM A;  2KFF A;  2V53 A;  1DF0 A;  4R1E A;  1KCY A;  1B47 A;  1J1E A;  1CB1 A;  1DJY A;  3KPX A;  4PDZ A;  1QS7 A;  2LP3 A;  2FCD A;  2M49 B;  1F54 A;  1NSH A;  1XFW O;  1NIW A;  2KI4 B;  4ORC B;  4HRH A;  1B4C A;  4GNK B;  4MSP A;  1AJ5 A;  1CFD A;  2KGR A;  1MUX A;  4USL A;  1TOP A;  3EVV A;  1NP8 A;  1A29 A;  1CLB A;  1SL9 A;  2BL0 B;  1OOJ A;  1NUB A;  5G08 A;  4QJ5 B;  4YRU A;  4GUK A;  4GGF A;  3DVJ A;  1KK7 Z;  2COL B;  4I5J A;  3VRR A;  4AOM A;  1CFP A;  3LK0 A;  1YRU B;  4MVF A;  1YUS A;  3TUY B;  2K7D A;  1CFC A;  4A4C A;  2H2K A;  1RK9 A;  1U5I B;  4PHJ A;  2FCE A;  4FQO A;  1XFZ O;  1EH2 A;  1IJ6 A;  4YBH B;  4PE0 A;  4D1E A;  4NDC A;  5CPV A;  4PE4 A;  2CNP A;  1WRK A;  3WNX B;  1XO5 A;  5HKW A;  1R2U A;  1QVI Y;  1QIW A;  1UHH A;  3BOW B;  5KTY A;  2LP2 A;  5AFP A;  2LHI A;  3VRP A;  4OCI A;  1BU3 A;  1EJ3 A;  2LUC A;  2LLU A;  2P6B B;  3IQO A;  4I5N B;  3SJS A;  1JFK A;  5IBW A;  2JXC A;  1XA5 A;  2HET A;  1TNP A;  1IQ5 A;  3DVM A;  3PLF B;  1MWN A;  1BF5 A;  3LCP C;  2KDH A;  4NQG A;  4DRW A;  2E6W A;  2LC5 A;  3LK1 A;  1DVI A;  5ER5 A;  2M9G A;  4PE7 A;  1UUS A;  3TS5 B;  2KSP A;  2CTN A;  3SG2 A;  1IKU A;  2WCB A;  2OPO A;  1N0Y A;  1S26 D;  3DF0 A;  3IF7 A;  1SYM A;  1NX1 A;  2MLF C;  1WLZ A;  3EK7 A;  1GQM A;  1KQM B;  3CS1 A;  1BR1 B;  3KO0 A;  2AUC A;  1IQ3 A;  3KF9 A;  4JWQ A;  1R6P A;  2WC8 A;  3F45 A;  1IGV A;  3I5G B;  2GGM A;  1UHK A;  4PHM A;  2ZNE A;  1J7O A;  1NYA A;  1ZUZ A;  1LKJ A;  2M8U A;  1KFU S;  1CNP A;  1K9K A;  2LMU A;  3O4Y A;  5TNC A;  4GGN A;  1C07 A;  1S3P A;  2CXJ A;  5PAL A;  5CSF A;  1SR6 B;  1DJI A;  1X02 A;  1FI5 A;  2EC6 C;  1K95 A;  2KAY A;  3GK2 A;  4IL1 A;  1BG1 A;  1F71 A;  2L50 A;  2PRU A;  1VRK A;  2JTZ A;  2JTT A;  3FWC A;  2CBL A;  4GAO A;  2JRF A;  1S6I A;  2BEC A;  1LA0 A;  1QTX A;  2HPS A;  4OVN F;  3NSO A;  2MBX A;  4MEW A;  2A4J A;  1J1D A;  3GK1 A;  4M2O A;  3E3R A;  1YUT A;  2MLE C;  2PSR A;  1EG3 A;  1K9P A;  3OX6 A;  2F3Y A;  2KOT A;  1OMD A;  1BJF A;  4CPV A;  2Y1N A;  4ORB B;  2I2R E;  1BT6 A;  1L2O C;  1Y1X A;  2KI4 C;  2Y1M A;  3D10 A;  4MRY A;  4PCW A;  1NX0 A;  1PSB A;  2KBI A;  1KSO A;  4HSZ A;  2F33 A;  1DGV A;  1MXE A;  1PRW A;  1KK8 C;  4WRI A;  1IJ5 A;  1OMR A;  1QVI Z;  1SPY A;  1BR4 B;  1F55 A;  2BKI B;  1K2H A;  4YGC B;  1SRA A;  3SG3 A;  1IRJ A;  3EKH A;  1CDN A;  1M31 A;  1HQV A;  1BOC A;  4GGF C;  1S36 A;  1K94 A;  3SIB A;  2ZKM X;  3BUM B;  1HT9 A;  1SKT A;  2AMI A;  2JC2 A;  1GJY A;  2JT3 A;  3WHT B;  4XJK B;  1JBA A;  3JTD B;  2NXQ A;  3AKA A;  2JNX A;  3NSK A;  3RM1 A;  2K0J A;  2LLS A;  2MA2 A;  3OHM B;  2OTG C;  1SL7 A;  1EXR A;  3HCM A;  2WCE A;  3CR5 X;  3H4S E;  3SIA A;  4CLN A;  3EKJ A;  3CR4 X;  4ETO A;  1CLL A;  3I5H C;  2F2O A;  4NDD A;  1NCY A;  1Y1U A;  4PHK A;  4MBE A;  1S6J A;  4ZCU A;  1UHI A;  1TN4 A;  3PN7 B;  2LAP A;  2ZN8 A;  1CFF A;  2JUL A;  5DKQ A;  1NX3 A;  4JQ0 D;  1SK6 D;  1DT7 B;  1FPW A;  3I5I B;  2PAS A;  3D0Y A;  4L9M A;  1F4Q A;  1U5I A;  2JXL A;  5I2O A;  3EK8 A;  1TIZ A;  3I5F C;  3ZNI A;  3JVT B;  4YGE B;  1LIN A;  5KSZ A;  4YI9 A;  1E8A A;  1TTX A;  2LMT A;  3D0Y B;  4MRX A;  4ZCV A;  3SG5 A;  2PMY A;  1FBV A;  1PVA A;  3SG7 A;  2M7L A;  1XK4 A;  3DD4 A;  2M3W A;  2KYF A;  1K93 D;  2D8N A;  2M7N A;  2GGZ A;  1KQM C;  3BOW A; 
#chains in the Genus database with same CATH topology
 4M2Q A;  4Q04 A;  5CSJ A;  3CZ1 A;  1QX2 A;  1OSA A;  2OS8 B;  2ZND A;  3CZT X;  1J7R A;  1S6C A;  1K9U A;  1WRL A;  1KSM A;  1IH0 A;  2HF5 A;  1PVB A;  1REC A;  3S0A A;  1XFV O;  1GGZ A;  1FW4 A;  1YVH A;  3VRQ A;  2WCJ A;  1OOH A;  2FJU B;  2ZN9 A;  1JUO A;  2KLE A;  1CMF A;  2BE6 A;  1SR6 C;  2L51 A;  1L7Z A;  1XFU O;  2LCP A;  2VRG A;  3DY9 A;  1D1O A;  1UHJ A;  3RZS A;  1KWO C;  2M1K B;  3NSL A;  4GPL B;  1RJV A;  1A75 B;  2L98 A;  1Y0V H;  5I2L A;  1A03 A;  4P2Y B;  4FTG A;  3M0W A;  4N1G A;  3PFV A;  2KFG A;  4HRG A;  4PE1 A;  5I94 A;  1F8H A;  3WXA A;  1ALW A;  1DJH A;  1ZOT B;  2L0P A;  1G4Y R;  1F4O A;  4E68 A;  1RRO A;  3ICB A;  5DIC A;  2LE9 B;  2K60 A;  4CID A;  1OMV A;  2B1U A;  2H61 A;  2L2E A;  1A2X A;  4FQT A;  2QPT A;  2KNE A;  3NSI A;  2KGB C;  3MSE B;  1NWD A;  3FS7 A;  1DJX A;  1ALV A;  1IG5 A;  3R1O A;  4MZL A;  3VB1 A;  1IWQ A;  2MJW B;  5AXI A;  3BUO B;  3IVT A;  4M2P A;  1XFY O;  2BCB A;  3A8R A;  3O78 A;  1JSA A;  2M29 A;  1OZO A;  1SNL A;  1W7J B;  2L2C A;  1AUI B;  1N2D A;  3L4A A;  4NDB A;  2G9B A;  2MHH A;  2NCP A;  3D76 A;  1CM4 A;  4C0L A;  1NCZ A;  1N65 A;  4ORA B;  1LA3 A;  1OOF A;  1QLS A;  1Y6W A;  2ZRT A;  1Z2C B;  3BUN B;  4UPG A;  1GGW A;  2K61 A;  1WDC B;  2WC6 A;  3S0E A;  1AHR A;  3JTD C;  1BMO A;  1YX7 A;  2LM5 A;  4WQ2 A;  2MAZ A;  5D69 A;  3S0F A;  2NZ0 A;  4KYN A;  2CT9 A;  3O2P A;  1M39 A;  3FE6 A;  1AP4 A;  2JU0 A;  3NXA A;  3OX5 A;  1B1G A;  2BNX A;  1B8L A;  5AEQ A;  1LVC D;  2QEV A;  1QAS A;  4DCK A;  2P70 A;  2JPT A;  1V1G A;  1UUR A;  1CTR A;  1SCM B;  4YGD B;  2LHL A;  1CMG A;  5JOL A;  2Q91 A;  3B6X A;  1SMG A;  2BL0 C;  5D7F A;  1SL8 A;  3BUW B;  2LVI A;  4ICB A;  1CDL A;  3I5I C;  5CSI A;  5BPJ A;  1S5G Y;  1ZFS A;  1CDM A;  2K8M B;  4YI8 A;  3AAJ A;  1IIO A;  1SY9 A;  3DVE A;  1RTP 1;  1J7P A;  1FF1 A;  3D73 A;  3CTN A;  1YX8 A;  2SCP A;  3CDN A;  1W9Z A;  2JNF A;  1G8I A;  2K7O A;  3TUY C;  1TCF A;  2WCH A;  3CLN A;  3K1E A;  1JWD A;  2LV7 A;  3FE9 A;  4XJK A;  2Y4Q A;  2JOJ A;  1JF0 A;  4GBA A;  5I8N A;  2QAC A;  1DJW A;  2KQ6 A;  1KQV A;  3D74 A;  1KFX S;  1M63 B;  2Q4U A;  1TUZ A;  3GK4 X;  4PHN A;  1LXF C;  3BQ3 A;  5F6T A;  1AJ4 A;  1JF2 A;  2LVV A;  1DJG A;  2O60 A;  1XK4 C;  3FIA A;  3PJI A;  5FI2 A;  2L4I A;  2WCF A;  2OS8 C;  3V2L A;  1CLM A;  3SS3 A;  4YGB B;  3NGV A;  1F70 A;  4AQJ A;  1QLK A;  2K7C A;  1YUU A;  3CWG A;  1KFX L;  3ZWH A;  2BKH B;  2QEH A;  1Q80 A;  2EC6 B;  4JPZ B;  1H4B A;  4OV2 A;  4OR9 B;  1AK8 A;  1C3Y A;  1K8U A;  2G2B A;  3OB1 B;  2WND A;  4PAL A;  5ER4 X;  3VRO A;  4QJ3 B;  2KI6 C;  2Y5I A;  3K21 A;  2EGD A;  3DVK A;  1J55 A;  1C7V A;  1SBJ A;  2K2A A;  1EG4 A;  4YGA A;  1MF8 B;  1Y1A A;  2KQY A;  3TDZ A;  4INX A;  2DOQ A;  4PHK A;  4F0Z B;  1RWY A;  1YR5 A;  3R1P A;  3KEV A;  1C7W A;  1XFX O;  2GTE A;  1PSR A;  1V1F A;  2M1U A;  1L2O B;  2SAS A;  3CGA A;  3DZT A;  1UWO A;  2JWW A;  1DF0 B;  1MQ1 A;  3AAK A;  1QXP A;  4I5K A;  3SG4 A;  2KI6 D;  1YRT B;  3TDI A;  3C1V A;  5CSN A;  2IS9 A;  1ZMZ A;  1KK8 B;  2LVJ A;  3LL8 B;  4MN0 A;  3D77 A;  1WY9 A;  4JKT A;  5GQQ C;  1AVS A;  2H61 C;  2BBN A;  2RGI A;  3KHE A;  3I5G C;  2AAO A;  1JC2 A;  1OW4 A;  2BE4 A;  4BY5 A;  2I18 A;  3SS4 A;  3UNW A;  3BYA A;  1TRF A;  3D75 A;  1W7I B;  4U8D A;  1NCX A;  1A75 A;  4N5X A;  1B7T Y;  3FWB A;  4MZK A;  1QX7 A;  1QAT A;  3D78 A;  5HKY A;  2I7A A;  1WLM A;  4N1F A;  1DMO A;  1H8B A;  1M46 A;  1S5G Z;  1MXL C;  3OP0 A;  1A4P A;  3BFA A;  2KPH A;  2WCL A;  5HYD A;  1DGU A;  1PK0 D;  1FI6 A;  3L4L A;  4MLW A;  4PT1 A;  4XYN A;  1WDC C;  5HLO A;  1PAL A;  1B8R A;  1DJZ A;  3PM8 A;  2OTG B;  1UHN A;  4C0K A;  2NLN A;  5I2Q A;  3IQQ A;  1OQP A;  1QJT A;  2L5X B;  2ZFD A;  1OE9 B;  3I5H B;  2L4H A;  4QJ4 B;  3EVU A;  5HKZ A;  1ZAC A;  2LLT A;  3CYZ A;  3B87 A;  1MHO A;  2PVB A;  3DXL A;  1SCM C;  1SCV A;  4A4B A;  1CDP A;  1RFJ A;  2K7B A;  1SW8 A;  2WC5 A;  1YTZ C;  2CCM A;  3I5F B;  1NX2 A;  3BUX B;  4OKH A;  3RLZ A;  1BLQ A;  2K2F A;  4C0J A;  5FYX A;  2MRD A;  3N7H A;  4JD9 A;  3PAL A;  1UP5 A;  2LNK A;  2O5G A;  3SS5 A;  1CM1 A;  1ODB A;  3TZ1 A;  2JT0 A;  4I5L B;  5JJG A;  1NPQ A;  1TNW A;  2F8P A;  3BXK A;  1K96 A;  1TNQ A;  3Q8I A;  1PUL A;  1G33 A;  2LMV A;  2L5Y A;  2KHN A;  3CR2 A;  3A4U B;  2KYC A;  2LVK A;  1MR8 A;  3LLE A;  2HQW A;  1QX5 B;  3VGO A;  3DF0 B;  2KLD A;  2R2I A;  3PAT A;  1OZS A;  4HRE E;  1KK7 Y;  2JQ6 A;  2BCX A;  2KAV A;  5B8I B;  2F3Z A;  1QIV A;  2ISD A;  3TDU A;  1TNX A;  1XVJ A;  2JT8 A;  5D3O A;  3PN7 C;  2WCM A;  1DTL A;  2M0R A;  2WOS A;  3EK4 A;  1QV0 A;  2LAN A;  3EG5 B;  3PM2 A;  3OB2 B;  3GOF A;  3WHU B;  1KWO B;  3S0D A;  2QDI A;  4TNC A;  1CKK A;  1B9A A;  3VRN A;  1BOD A;  2LUX A;  5HLV A;  1KFU L;  4GFT A;  4CFR A;  5EL2 A;  3JVT C;  2KAX A;  2QEO A;  2ZRS A;  1JFJ A;  1WRZ A;  3AKB A;  3BFB A;  2TN4 A;  4AQI A;  2E30 A;  1B7T Z;  4CFQ A;  3O6B A;  3QRX A;  1TCO B;  5AAN A;  2EHB A;  1J7Q A;  1C3Z A;  2PAL A;  4WQ3 A;  5DKN A;  1S1E A;  2GV5 A;  4DS7 A;  4DUQ A;  4BY4 A;  1B8C A;  3PSR A;  2FOT A;  1K90 D;  2NCO A;  3S0B A;  1YUR A;  5K89 A;  1QV1 A;  3SG6 A;  4DIR A;  2BBM A;  5AER A;  1EL4 A;  2M97 A;  2HQ8 A;  3HX4 A;  5DKR A;  1XFR A;  4MZJ A;  2BCA A;  4P5O E;  5KU1 A;  1XYD A;  2JZI A;  1OOG A;  1YVL A;  5J3X A;  2F2P A;  3EVR A;  2KFH A;  2WOR A;  2I94 A;  1M45 A;  2KBM A;  2KFF A;  2V53 A;  1DF0 A;  4R1E A;  3S0G A;  1KCY A;  1B47 A;  1J1E A;  1ORG A;  1CB1 A;  1DJY A;  3KPX A;  3R1V A;  4PDZ A;  1QS7 A;  2LP3 A;  3B88 A;  2FCD A;  2M49 B;  1F54 A;  1NSH A;  1XFW O;  1NIW A;  2KI4 B;  4ORC B;  1OOI X;  4HRH A;  1B4C A;  4GNK B;  4MSP A;  1AJ5 A;  1CFD A;  2KGR A;  1MUX A;  3OGN A;  1TOP A;  3EVV A;  1NP8 A;  1A29 A;  4USL A;  1SL9 A;  2BL0 B;  1OOJ A;  2YGU A;  1CLB A;  1NUB A;  5G08 A;  4QJ5 B;  4YRU A;  4GUK A;  3FE8 A;  4GGF A;  1LS8 A;  2FJY A;  1KK7 Z;  2COL B;  3DVJ A;  4I5J A;  3VRR A;  4AOM A;  1CFP A;  3LK0 A;  1YRU B;  4MVF A;  1YUS A;  3TUY B;  2K7D A;  1CFC A;  2ERB A;  2WCK A;  3CZ0 A;  4A4C A;  2H2K A;  1RK9 A;  1U5I B;  4PHJ A;  2FCE A;  4FQO A;  1XFZ O;  3NHT A;  1EH2 A;  1IJ6 A;  4YBH B;  2BAP A;  4PE0 A;  4D1E A;  4NDC A;  5CPV A;  4PE4 A;  2CNP A;  1WRK A;  3R72 A;  3WNX B;  1XO5 A;  5HKW A;  1R2U A;  1QVI Y;  1QIW A;  2PQL A;  1UHH A;  3BOW B;  5KTY A;  1TUJ A;  2LP2 A;  5AFP A;  2QEB A;  2LHI A;  3VRP A;  4OCI A;  1BU3 A;  1EJ3 A;  2LUC A;  2LLU A;  2P6B B;  3IQO A;  4I5N B;  3SJS A;  3UO9 A;  1JFK A;  5IBW A;  2JXC A;  1XA5 A;  2HET A;  1TNP A;  1IQ5 A;  3DVM A;  3DYE A;  3PLF B;  1MWN A;  1BF5 A;  3LCP C;  2KDH A;  4NQG A;  4DRW A;  2E6W A;  2LC5 A;  1DC1 A;  1QWV A;  3L47 A;  3LK1 A;  1DVI A;  4F7F A;  5ER5 A;  2M9G A;  1GM0 A;  4PE7 A;  1P28 A;  1UUS A;  2KSP A;  2CTN A;  3SG2 A;  3TS5 B;  1IKU A;  1DEK A;  2WCB A;  2OPO A;  1N0Y A;  1S26 D;  3DF0 A;  3IF7 A;  1SYM A;  1NX1 A;  2MLF C;  3NHI A;  1WLZ A;  3EK7 A;  1GQM A;  1KQM B;  3CS1 A;  1BR1 B;  3KO0 A;  2AUC A;  1IQ3 A;  3KF9 A;  4JWQ A;  1R6P A;  2WC8 A;  3F45 A;  1IGV A;  1DEL A;  5FI7 A;  3I5G B;  2GGM A;  1UHK A;  4PHM A;  2ZNE A;  1J7O A;  1NYA A;  1ZUZ A;  1LKJ A;  1SSE B;  2M8U A;  1KFU S;  1CNP A;  1K9K A;  2LMU A;  3O4Y A;  5TNC A;  4GGN A;  1C07 A;  1S3P A;  2CXJ A;  5PAL A;  5CSF A;  5FI6 A;  1SR6 B;  1DJI A;  1X02 A;  1FI5 A;  2EC6 C;  1K95 A;  2KAY A;  3GK2 A;  4IL1 A;  1BG1 A;  1F71 A;  2L50 A;  2PRU A;  1VRK A;  2JTZ A;  2JTT A;  3FWC A;  2CBL A;  4GAO A;  2JRF A;  1S6I A;  2BEC A;  1LA0 A;  1QTX A;  1T14 A;  2HPS A;  3NSO A;  4OVN F;  2MBX A;  4MEW A;  2A4J A;  1J1D A;  3GK1 A;  4M2O A;  3E3R A;  1YUT A;  2MLE C;  2PSR A;  1EG3 A;  1K9P A;  3OX6 A;  2F3Y A;  2KOT A;  1OMD A;  1BJF A;  4CPV A;  2Y1N A;  4ORB B;  2I2R E;  1BT6 A;  1L2O C;  1Y1X A;  2KI4 C;  2Y1M A;  3D10 A;  4MRY A;  4PCW A;  1NX0 A;  1PSB A;  2KBI A;  1KSO A;  4HSZ A;  2F33 A;  4OZD A;  1DGV A;  1MXE A;  1PRW A;  1KK8 C;  4WRI A;  1IJ5 A;  1OMR A;  1QVI Z;  1SPY A;  1BR4 B;  1F55 A;  4INW A;  2BKI B;  1K2H A;  4YGC B;  1SRA A;  3SG3 A;  1IRJ A;  3EKH A;  1CDN A;  1M31 A;  1HQV A;  1BOC A;  4GGF C;  1S36 A;  3B86 A;  3OBV A;  2PYQ A;  1K94 A;  3CZ2 A;  3SIB A;  2ZKM X;  3BUM B;  1HT9 A;  1SKT A;  2AMI A;  2JC2 A;  1GJY A;  2JT3 A;  3WHT B;  4XJK B;  1JBA A;  3JTD B;  2NXQ A;  5HL1 A;  3AKA A;  2JNX A;  3BJH A;  3BFH A;  2K0J A;  2LLS A;  3NSK A;  2MA2 A;  3OHM B;  3RM1 A;  2OTG C;  1SL7 A;  1EXR A;  3HCM A;  2WCE A;  3CR5 X;  2H8V A;  3H4S E;  3SIA A;  4CLN A;  3EKJ A;  3CR4 X;  4ETO A;  1CLL A;  3I5H C;  2F2O A;  3CAB A;  1NCY A;  1Y1U A;  1Z4H A;  3QME A;  1S6J A;  4MBE A;  4NDD A;  1UHI A;  1TN4 A;  3PN7 B;  2LAP A;  2ZN8 A;  4ZCU A;  2JUL A;  1CFF A;  5DKQ A;  1NX3 A;  4JQ0 D;  1SK6 D;  1DT7 B;  1FPW A;  3I5I B;  3O4X A;  1TWO A;  2PAS A;  3B7A A;  3D0Y A;  4L9M A;  1F4Q A;  1U5I A;  2JXL A;  5I2O A;  3EK8 A;  1TIZ A;  3I5F C;  3ZNI A;  3JVT B;  4YGE B;  1LIN A;  5KSZ A;  4YI9 A;  1E8A A;  1TTX A;  2LMT A;  3D0Y B;  4MRX A;  4ZCV A;  3SG5 A;  2PMY A;  1FBV A;  1PVA A;  3SG7 A;  2JPO A;  2M7L A;  1XK4 A;  3DD4 A;  2M3W A;  4IJ7 A;  2KYF A;  1K93 D;  2P71 A;  1DQE A;  2D8N A;  2M7N A;  2GGZ A;  1KQM C;  3TS5 C;  3BOW A; 
#chains in the Genus database with same CATH homology
 4M2Q A;  4Q04 A;  5CSJ A;  1QX2 A;  1OSA A;  2OS8 B;  2ZND A;  3CZT X;  1J7R A;  1S6C A;  1K9U A;  1WRL A;  1KSM A;  1IH0 A;  2HF5 A;  1PVB A;  1REC A;  1XFV O;  1GGZ A;  1FW4 A;  1YVH A;  3VRQ A;  2FJU B;  2ZN9 A;  1JUO A;  1CMF A;  2BE6 A;  1SR6 C;  2L51 A;  1L7Z A;  1XFU O;  2LCP A;  2VRG A;  1D1O A;  1UHJ A;  1KWO C;  2M1K B;  3NSL A;  4GPL B;  1RJV A;  1A75 B;  2L98 A;  1Y0V H;  5I2L A;  1A03 A;  4P2Y B;  4FTG A;  3M0W A;  4N1G A;  3PFV A;  2KFG A;  4HRG A;  4PE1 A;  1F8H A;  3WXA A;  1ALW A;  1DJH A;  1ZOT B;  2L0P A;  1G4Y R;  1F4O A;  4E68 A;  1RRO A;  3ICB A;  2LE9 B;  4CID A;  1OMV A;  2B1U A;  2H61 A;  2L2E A;  1A2X A;  2QPT A;  2KNE A;  3NSI A;  2KGB C;  3MSE B;  1NWD A;  3FS7 A;  1DJX A;  1ALV A;  1IG5 A;  4MZL A;  1IWQ A;  2MJW B;  5AXI A;  3BUO B;  4M2P A;  1XFY O;  2BCB A;  3A8R A;  3O78 A;  1JSA A;  2M29 A;  1OZO A;  1SNL A;  1W7J B;  1AUI B;  1N2D A;  4NDB A;  2G9B A;  2MHH A;  2NCP A;  1CM4 A;  4C0L A;  1NCZ A;  1N65 A;  4ORA B;  1LA3 A;  1QLS A;  1Y6W A;  2ZRT A;  3BUN B;  4UPG A;  1GGW A;  2K61 A;  1WDC B;  1AHR A;  3JTD C;  1BMO A;  1YX7 A;  2LM5 A;  4WQ2 A;  2MAZ A;  5D69 A;  2NZ0 A;  2CT9 A;  3O2P A;  1M39 A;  1AP4 A;  2JU0 A;  3NXA A;  3OX5 A;  1B1G A;  1B8L A;  5AEQ A;  1LVC D;  1QAS A;  4DCK A;  2JPT A;  1V1G A;  1UUR A;  1CTR A;  1SCM B;  4YGD B;  2LHL A;  1CMG A;  5JOL A;  2Q91 A;  1SMG A;  2BL0 C;  5D7F A;  1SL8 A;  3BUW B;  2LVI A;  4ICB A;  1CDL A;  3I5I C;  5CSI A;  5BPJ A;  1S5G Y;  1ZFS A;  1CDM A;  2K8M B;  4YI8 A;  3AAJ A;  1SY9 A;  3DVE A;  1RTP 1;  1J7P A;  1FF1 A;  3CTN A;  1YX8 A;  2SCP A;  2JNF A;  1G8I A;  2K7O A;  3TUY C;  1TCF A;  3CLN A;  1JWD A;  2LV7 A;  4XJK A;  2Y4Q A;  2JOJ A;  1JF0 A;  4GBA A;  5I8N A;  2QAC A;  1DJW A;  2KQ6 A;  1KQV A;  1KFX S;  1M63 B;  2Q4U A;  3GK4 X;  4PHN A;  1LXF C;  3BQ3 A;  5F6T A;  1AJ4 A;  1JF2 A;  2LVV A;  1DJG A;  2O60 A;  1XK4 C;  3FIA A;  2L4I A;  2WCF A;  2OS8 C;  1CLM A;  4YGB B;  1F70 A;  4AQJ A;  1QLK A;  2K7C A;  1YUU A;  3CWG A;  1KFX L;  3ZWH A;  2BKH B;  1Q80 A;  2EC6 B;  4JPZ B;  1H4B A;  4OV2 A;  4OR9 B;  1AK8 A;  1K8U A;  2G2B A;  3OB1 B;  2WND A;  4PAL A;  5ER4 X;  3VRO A;  4QJ3 B;  2KI6 C;  2Y5I A;  3K21 A;  2EGD A;  3DVK A;  1J55 A;  1C7V A;  1SBJ A;  2K2A A;  1EG4 A;  4YGA A;  1MF8 B;  1Y1A A;  2KQY A;  3TDZ A;  2DOQ A;  4F0Z B;  1RWY A;  1YR5 A;  3KEV A;  1C7W A;  1XFX O;  3TS5 C;  1PSR A;  1V1F A;  2M1U A;  1L2O B;  2SAS A;  3CGA A;  1UWO A;  2JWW A;  1DF0 B;  1MQ1 A;  3AAK A;  1QXP A;  4I5K A;  3SG4 A;  2KI6 D;  1YRT B;  3TDI A;  3C1V A;  5CSN A;  2IS9 A;  1ZMZ A;  1KK8 B;  2LVJ A;  3LL8 B;  4MN0 A;  1WY9 A;  5GQQ C;  1AVS A;  2H61 C;  2BBN A;  2RGI A;  3KHE A;  3I5G C;  2AAO A;  1JC2 A;  2BE4 A;  4BY5 A;  2I18 A;  3BYA A;  1TRF A;  1W7I B;  4U8D A;  1NCX A;  1A75 A;  4N5X A;  1B7T Y;  3FWB A;  4MZK A;  1QX7 A;  1QAT A;  5HKY A;  2I7A A;  1WLM A;  4N1F A;  1DMO A;  1H8B A;  1M46 A;  1S5G Z;  1MXL C;  3OP0 A;  1A4P A;  5HYD A;  1DGU A;  1PK0 D;  1FI6 A;  4MLW A;  4XYN A;  1WDC C;  5HLO A;  1PAL A;  1B8R A;  1DJZ A;  3PM8 A;  2OTG B;  1UHN A;  4C0K A;  2NLN A;  5I2Q A;  3IQQ A;  1OQP A;  1QJT A;  2L5X B;  2ZFD A;  1OE9 B;  3I5H B;  2L4H A;  4QJ4 B;  3EVU A;  5HKZ A;  1ZAC A;  2LLT A;  1MHO A;  2PVB A;  1SCM C;  1SCV A;  4A4B A;  1CDP A;  1RFJ A;  2K7B A;  1SW8 A;  1YTZ C;  2CCM A;  3I5F B;  1NX2 A;  3BUX B;  4OKH A;  3RLZ A;  1BLQ A;  2K2F A;  4C0J A;  5FYX A;  2MRD A;  3PAL A;  1UP5 A;  2LNK A;  2O5G A;  1CM1 A;  1ODB A;  3TZ1 A;  2JT0 A;  4I5L B;  5JJG A;  1NPQ A;  1TNW A;  2F8P A;  3BXK A;  1K96 A;  1TNQ A;  1PUL A;  1G33 A;  2LMV A;  2KHN A;  3CR2 A;  3A4U B;  2KYC A;  2LVK A;  1MR8 A;  3LLE A;  2HQW A;  1QX5 B;  3VGO A;  3DF0 B;  2R2I A;  3PAT A;  1OZS A;  4HRE E;  1KK7 Y;  2JQ6 A;  2BCX A;  2KAV A;  5B8I B;  2F3Z A;  1QIV A;  2ISD A;  3TDU A;  1TNX A;  1XVJ A;  2JT8 A;  3PN7 C;  1DTL A;  2M0R A;  2WOS A;  3EK4 A;  1QV0 A;  2LAN A;  3OB2 B;  3GOF A;  3WHU B;  1KWO B;  4TNC A;  1CKK A;  1B9A A;  3VRN A;  1BOD A;  2LUX A;  5HLV A;  1KFU L;  4GFT A;  4CFR A;  3JVT C;  2KAX A;  2ZRS A;  1JFJ A;  1WRZ A;  3AKB A;  2TN4 A;  4AQI A;  2E30 A;  1B7T Z;  4CFQ A;  3O6B A;  3QRX A;  1TCO B;  5AAN A;  2EHB A;  1J7Q A;  2PAL A;  4WQ3 A;  5DKN A;  1S1E A;  2GV5 A;  4DS7 A;  4DUQ A;  4BY4 A;  1B8C A;  3PSR A;  2FOT A;  1K90 D;  2NCO A;  5K89 A;  1YUR A;  1QV1 A;  3SG6 A;  4DIR A;  2BBM A;  5AER A;  1EL4 A;  2M97 A;  2HQ8 A;  3HX4 A;  5DKR A;  4MZJ A;  2BCA A;  4P5O E;  5KU1 A;  1XYD A;  2JZI A;  1YVL A;  5J3X A;  2F2P A;  3EVR A;  2KFH A;  2WOR A;  2I94 A;  1M45 A;  2KBM A;  2KFF A;  2V53 A;  1DF0 A;  4R1E A;  1KCY A;  1B47 A;  1J1E A;  1CB1 A;  1DJY A;  3KPX A;  4PDZ A;  1QS7 A;  2LP3 A;  2FCD A;  2M49 B;  1F54 A;  1NSH A;  1XFW O;  1NIW A;  2KI4 B;  4ORC B;  4HRH A;  1B4C A;  4GNK B;  4MSP A;  1AJ5 A;  1CFD A;  2KGR A;  1MUX A;  4USL A;  1TOP A;  3EVV A;  1NP8 A;  1A29 A;  1CLB A;  1SL9 A;  2BL0 B;  1OOJ A;  1NUB A;  5G08 A;  4QJ5 B;  4YRU A;  4GUK A;  4GGF A;  3DVJ A;  1KK7 Z;  2COL B;  4I5J A;  3VRR A;  4AOM A;  1CFP A;  3LK0 A;  1YRU B;  4MVF A;  1YUS A;  3TUY B;  2K7D A;  1CFC A;  4A4C A;  2H2K A;  1RK9 A;  1U5I B;  4PHJ A;  2FCE A;  4FQO A;  1XFZ O;  1EH2 A;  1IJ6 A;  4YBH B;  4PE0 A;  4D1E A;  4NDC A;  5CPV A;  4PE4 A;  2CNP A;  1WRK A;  3WNX B;  1XO5 A;  5HKW A;  1R2U A;  1QVI Y;  1QIW A;  1UHH A;  3BOW B;  5KTY A;  2LP2 A;  5AFP A;  2LHI A;  3VRP A;  4OCI A;  1BU3 A;  1EJ3 A;  2LUC A;  2LLU A;  2P6B B;  3IQO A;  4I5N B;  3SJS A;  1JFK A;  5IBW A;  2JXC A;  1XA5 A;  2HET A;  1TNP A;  1IQ5 A;  3DVM A;  3PLF B;  1MWN A;  1BF5 A;  3LCP C;  2KDH A;  4NQG A;  4DRW A;  2E6W A;  2LC5 A;  3LK1 A;  1DVI A;  5ER5 A;  2M9G A;  4PE7 A;  1UUS A;  3TS5 B;  2KSP A;  2CTN A;  3SG2 A;  1IKU A;  2WCB A;  2OPO A;  1N0Y A;  1S26 D;  3DF0 A;  3IF7 A;  1SYM A;  1NX1 A;  2MLF C;  1WLZ A;  3EK7 A;  1GQM A;  1KQM B;  3CS1 A;  1BR1 B;  3KO0 A;  2AUC A;  1IQ3 A;  3KF9 A;  4JWQ A;  1R6P A;  2WC8 A;  3F45 A;  1IGV A;  3I5G B;  2GGM A;  1UHK A;  4PHM A;  2ZNE A;  1J7O A;  1NYA A;  1ZUZ A;  1LKJ A;  2M8U A;  1KFU S;  1CNP A;  1K9K A;  2LMU A;  3O4Y A;  5TNC A;  4GGN A;  1C07 A;  1S3P A;  2CXJ A;  5PAL A;  5CSF A;  1SR6 B;  1DJI A;  1X02 A;  1FI5 A;  2EC6 C;  1K95 A;  2KAY A;  3GK2 A;  4IL1 A;  1BG1 A;  1F71 A;  2L50 A;  2PRU A;  1VRK A;  2JTZ A;  2JTT A;  3FWC A;  2CBL A;  4GAO A;  2JRF A;  1S6I A;  2BEC A;  1LA0 A;  1QTX A;  2HPS A;  4OVN F;  3NSO A;  2MBX A;  4MEW A;  2A4J A;  1J1D A;  3GK1 A;  4M2O A;  3E3R A;  1YUT A;  2MLE C;  2PSR A;  1EG3 A;  1K9P A;  3OX6 A;  2F3Y A;  2KOT A;  1OMD A;  1BJF A;  4CPV A;  2Y1N A;  4ORB B;  2I2R E;  1BT6 A;  1L2O C;  1Y1X A;  2KI4 C;  2Y1M A;  3D10 A;  4MRY A;  4PCW A;  1NX0 A;  1PSB A;  2KBI A;  1KSO A;  4HSZ A;  2F33 A;  1DGV A;  1MXE A;  1PRW A;  1KK8 C;  4WRI A;  1IJ5 A;  1OMR A;  1QVI Z;  1SPY A;  1BR4 B;  1F55 A;  2BKI B;  1K2H A;  4YGC B;  1SRA A;  3SG3 A;  1IRJ A;  3EKH A;  1CDN A;  1M31 A;  1HQV A;  1BOC A;  4GGF C;  1S36 A;  1K94 A;  3SIB A;  2ZKM X;  3BUM B;  1HT9 A;  1SKT A;  2AMI A;  2JC2 A;  1GJY A;  2JT3 A;  3WHT B;  4XJK B;  1JBA A;  3JTD B;  2NXQ A;  3AKA A;  2JNX A;  3NSK A;  3RM1 A;  2K0J A;  2LLS A;  2MA2 A;  3OHM B;  2OTG C;  1SL7 A;  1EXR A;  3HCM A;  2WCE A;  3CR5 X;  3H4S E;  3SIA A;  4CLN A;  3EKJ A;  3CR4 X;  4ETO A;  1CLL A;  3I5H C;  2F2O A;  4NDD A;  1NCY A;  1Y1U A;  4PHK A;  4MBE A;  1S6J A;  4ZCU A;  1UHI A;  1TN4 A;  3PN7 B;  2LAP A;  2ZN8 A;  1CFF A;  2JUL A;  5DKQ A;  1NX3 A;  4JQ0 D;  1SK6 D;  1DT7 B;  1FPW A;  3I5I B;  2PAS A;  3D0Y A;  4L9M A;  1F4Q A;  1U5I A;  2JXL A;  5I2O A;  3EK8 A;  1TIZ A;  3I5F C;  3ZNI A;  3JVT B;  4YGE B;  1LIN A;  5KSZ A;  4YI9 A;  1E8A A;  1TTX A;  2LMT A;  3D0Y B;  4MRX A;  4ZCV A;  3SG5 A;  2PMY A;  1FBV A;  1PVA A;  3SG7 A;  2M7L A;  1XK4 A;  3DD4 A;  2M3W A;  2KYF A;  1K93 D;  2D8N A;  2M7N A;  2GGZ A;  1KQM C;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...