2ZFDA

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
183
structure length
183
Chain Sequence
b'DPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein/transferase
total genus 69
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zfdA00
2ZKMX 4NDBA 1SL7A 2EGDA 1S1EA 1IJ5A 3WNXB 3A8RA 1B8CA 1NCZA 2KFGA 1S26D 3HCMA 4YI8A 1TNWA 3JVTB 4ORAB 1S5GZ 5CSIA 1XK4A 4C0JA 2Y4QA 1YVLA 1GGWA 2PSRA 2M0RA 1QS7A 1ZOTB 2LCPA 4A4CA 4AQIA 1QASA 2H61C 3BXKA 4GNKB 2H61A 4IL1A 1CNPA 2LANA 2M8UA 1SR6B 2PRUA 1LXFC 1KQVA 1BR4B 3BOWA 1KSOA 1YX8A 2KAYA 2KSPA 2LC5A 2GGMA 1NX3A 1WRLA 1KQMC 1WRZA 3I5IC 2BCAA 2QPTA 2Q91A 1LA0A 5HKZA 2M1KB 1MUXA 1DGUA 1F8HA 2KQ6A 1V1FA 2ZFDA 3CWGA 5DKQA 1PSRA 2R2IA 4GPLB 1AJ4A 1RFJA 1Y0VH 2K7OA 2BE6A 2M49B 4I5LB 1JUOA 1ZFSA 1NWDA 4YI9A 2AMIA 4ORBB 2V53A 2L5XB 2WNDA 5CSJA 1IQ3A 2JXCA 3OP0A 4QJ5B 2KAVA 3VRNA 1EH2A 1QTXA 3DVMA 1K90D 2F2PA 1BMOA 1OOJA 1PK0D 1PVAA 2AAOA 5KU1A 4GAOA 5CPVA 1YRUB 3WXAA 3IF7A 3OB1B 2K61A 1K95A 2FCDA 1XFUO 1LKJA 2ZNDA 1DTLA 3NSLA 1A2XA 1NIWA 1RECA 2KBIA 2LNKA 4MN0A 4CFRA 2CXJA 3SG7A 1XVJA 3SG6A 1R2UA 4PHJA 4Q04A 1CFDA 2M7LA 4CIDA 1FI6A 1UHJA 4YRUA 1QLKA 1K94A 1OZOA 1TNPA 1KK7Z 1UHIA 2PMYA 2NZ0A 3PN7C 1FPWA 5JJGA 2Y5IA 1SPYA 1JC2A 1OMDA 1QV1A 4HREE 3ZWHA 1F54A 2F3ZA 3JTDB 5AXIA 3KPXA 1EL4A 2G2BA 2BECA 3OX5A 1JFJA 2CTNA 1TCFA 3O78A 1QVIZ 1DJXA 3CGAA 2L4HA 5I2QA 3DVKA 1K96A 1UURA 2NCOA 3KHEA 1L2OC 4MRYA 5D69A 3PLFB 2BKIB 3VRPA 2BBMA 4MBEA 4C0LA 4PHKA 1CLLA 1DGVA 2JZIA 1NYAA 1Q80A 1WLZA 1EXRA 1YTZC 2K2AA 1RK9A 1KWOB 3NSKA 3PFVA 1C7WA 1ZACA 1G8IA 1V1GA 2OTGB 2KGBC 1S36A 2LLSA 5I8NA 3AAKA 2RGIA 1B7TY 5HLOA 1GJYA 2EC6C 3CS1A 3NSOA 3VRQA 1K9UA 5HYDA 1KSMA 1U5IA 2M97A 4ETOA 2KFHA 3LL8B 1SBJA 3AKBA 2LE9B 1BR1B 1K9KA 2LMUA 4ZCVA 4JPZB 5GQQC 2NCPA 1PULA 1XA5A 4MZJA 2ZN9A 1CM4A 1J7QA 5B8IB 1Y6WA 4MVFA 1MWNA 1EG4A 1K93D 5D7FA 3VRRA 2BL0C 1M45A 1WRKA 2E30A 4NDCA 1QXPA 4OV2A 2LMVA 1HT9A 5DKRA 1MHOA 3CR5X 2LUXA 4PE4A 1A75A 3GK2A 2KI4B 4XYNA 1S6CA 2KI6D 2WCFA 2K7CA 2OPOA 1YR5A 1QIWA 2ZNEA 2LHIA 3I5HC 3RLZA 2FOTA 3RM1A 1MXEA 5ER4X 5FYXA 1RROA 3CZTX 1H8BA 1FI5A 1A4PA 1BT6A 1SCMC 3OB2B 1XK4C 4DRWA 1SMGA 1S5GY 3FS7A 2BBNA 1EJ3A 1CLMA 5AANA 4XJKB 5KSZA 3PATA 5TNCA 1SL9A 3LLEA 1ODBA 3O2PA 4PE7A 1LA3A 1SRAA 1YUUA 3TS5B 3DF0B 1WY9A 1W7IB 4DIRA 2HPSA 2LUCA 1UHKA 4I5JA 1BOCA 3FWBA 2ZRTA 4I5KA 1WLMA 1CKKA 1ALVA 3PM8A 2JT8A 2OS8C 2L2EA 2MJWB 3DD4A 1B47A 4I5NB 3GK1A 1B4CA 1PALA 1SYMA 2AUCA 3DVJA 5HKWA 2M29A 2F3YA 2TN4A 3TDIA 4WRIA 4MLWA 4P2YB 2KNEA 4WQ3A 4MZKA 2I18A 3F45A 4F0ZB 2BKHB 1AUIB 4PE0A 3TUYC 3I5FB 4P5OE 1JSAA 2K2FA 1L7ZA 2JTZA 1CMFA 1DJYA 2O5GA 3TDUA 1PVBA 2NXQA 1IH0A 1XFWO 3NSIA 1LINA 3AKAA 1K9PA 3SG5A 1GGZA 4CFQA 1EG3A 3NXAA 2D8NA 2JNFA 1CFFA 1G33A 2LP2A 3JVTC 3KEVA 5AEQA 2KFFA 3EVVA 3BUXB 4DUQA 1XFXO 3GOFA 1DJIA 2H2KA 2M3WA 1M39A 1KK8C 1DT7B 1QIVA 1RWYA 2JQ6A 2EHBA 1SR6C 4R1EA 5I2OA 2MA2A 2WOSA 4A4BA 2CT9A 1CMGA 1SY9A 4BY4A 1RJVA 3LCPC 1F55A 2WCEA 1KK7Y 1OZSA 1AP4A 1TOPA 2LVIA 1Y1XA 1BODA 1RTP1 3AAJA 1TRFA 3E3RA 1QV0A 5CSFA 3K21A 1AJ5A 1J7PA 3MSEB 2LP3A 3D0YB 1CTRA 1XO5A 2L50A 1QVIY 3VGOA 5KTYA 1K2HA 1SL8A 1G4YR 5PALA 1K8UA 4D1EA 4DCKA 2LMTA 1CFCA 1C7VA 4HRGA 1DJWA 4CLNA 3D10A 4OR9B 4QJ4B 3SG4A 1F4OA 5J3XA 2GGZA 1VRKA 1OMRA 1SCVA 2BL0B 4OCIA 1NX1A 1OE9B 2MRDA 1MXLC 5DKNA 1F71A 1QATA 1NX0A 1N65A 1UUSA 1WDCB 2LVKA 2SCPA 1ALWA 4PALA 4PCWA 1DF0B 2CBLA 2JULA 4ICBA 4NDDA 4OKHA 3BYAA 4N1GA 1YRTB 4QJ3B 1IKUA 1QJTA 4M2QA 1KFUL 2K0JA 1MR8A 2SASA 3LK1A 2BCXA 2PALA 3TDZA 2GV5A 1IWQA 2LAPA 1TIZA 5HLVA 3KO0A 4GUKA 1IG5A 1SCMB 2Y1MA 5JOLA 2K7BA 1IRJA 2WCBA 3IQOA 2LVVA 1TTXA 2JWWA 4N1FA 3H4SE 1NP8A 1X02A 5AFPA 4CPVA 1M46A 3BOWB 3KF9A 2BCBA 2L4IA 2COLB 1NX2A 3EVRA 5BPJA 2K8MB 3JTDC 2PVBA 2L51A 4YGDB 1KQMB 1C07A 3I5IB 2IS9A 1SKTA 3EKJA 5F6TA 1NSHA 4ORCB 1BF5A 3SG2A 1DJGA 3CTNA 3VROA 4C0KA 2JNXA 2KOTA 1BU3A 2JPTA 2JXLA 2L98A 1KWOC 3GK4X 3DVEA 3I5GC 4BY5A 3TUYB 1XFYO 2OTGC 3EVUA 2BE4A 2O60A 3EK8A 1CDLA 1QLSA 3BUWB 5IBWA 1B8LA 1KFXL 1KFXS 1AHRA 4NQGA 5G08A 2KHNA 2HETA 1F70A 1QX7A 1SW8A 1TN4A 3EKHA 1KCYA 1IGVA 3SJSA 4HSZA 1IJ6A 2KYFA 1YURA 1XFVO 1QX2A 1PSBA 1CDNA 4USLA 4DS7A 1YUSA 2ISDA 1GQMA 4ZCUA 1KK8B 3LK0A 5HKYA 2A4JA 2MAZA 2I94A 1AVSA 3O4YA 4JQ0D 3WHTB 1A03A 2KYCA 3HX4A 3TZ1A 2MLFC 1CB1A 2P6BB 4FTGA 3OX6A 4UPGA 1CLBA 2KI4C 1SNLA 4GBAA 3BUOB 3ZNIA 1JFKA 1TCOB 3PN7B 4YGEB 4MSPA 2HQ8A 1JF0A 2HQWA 4U8DA 1IQ5A 1S6JA 2JC2A 3O6BA 1J7OA 4AOMA 4E68A 5K89A 3QRXA 4GFTA 1OMVA 2VRGA 2CNPA 1XFZO 1D1OA 2HF5A 1NPQA 4XJKA 4GGFC 4OVNF 5I2LA 1J55A 1YVHA 4GGFA 1L2OB 4MZLA 4PHNA 1UP5A 2JU0A 2Q4UA 3SIBA 2LLUA 3CR4X 1F4QA 4N5XA 1CDMA 3OHMB 2FCEA 2KQYA 4YGBB 3TS5C 1JF2A 3DF0A 1J1DA 2F2OA 3CR2A 1JBAA 2KI6C 1AK8A 2DOQA 3A4UB 1N2DA 1M31A 2LV7A 1B8RA 2M1UA 2LLTA 2WORA 4MEWA 3PSRA 3SG3A 1TNQA 1JWDA 2EC6B 1E8AA 1J7RA 1U5IB 1FW4A 2L0PA 3BUMB 4M2PA 1BJFA 1QX5B 3WHUB 2K7DA 1CDPA 3BUNB 4HRHA 1SK6D 2JTTA 2MHHA 1OQPA 4FQOA 4AQJA 1BLQA 2KBMA 1H4BA 1DVIA 3I5FC 2Y1NA 4PDZA 1ZMZA 2FJUB 1Y1AA 1S6IA 1LVCD 1A75B 1UHHA 4GGNA 1TNXA 5AERA 2E6WA 3BQ3A 2JT0A 4YBHB 1KFUS 3M0WA 3I5HB 2CCMA 3EK4A 3CLNA 2KGRA 4TNCA 1S3PA 1B1GA 1Y1UA 2PASA 2JRFA 3C1VA 1A29A 1FBVA 2JOJA 2LM5A 2I7AA 2WC8A 2ZRSA 3FWCA 1XYDA 2G9BA 5ER5A 3EK7A 1PRWA 2LVJA 3I5GB 2QACA 2ZN8A 1MQ1A 2LHLA 1ZUZA 3PALA 3FIAA 1DJHA 1YX7A 2F8PA 4PE1A 2F33A 1B7TZ 4PHMA 1CM1A 2M7NA 2MLEC 2NLNA 4MRXA 1FF1A 3D0YA 5CSNA 1B9AA 1NUBA 3SIAA 2OS8B 1HQVA 1BG1A 1MF8B 1R6PA 1UHNA 2JT3A 4JWQA 1UWOA 1OSAA 2KAXA 2I2RE 4WQ2A 2M9GA 2MBXA 1M63B 4YGAA 1DJZA 1DMOA 1CFPA 3ICBA 2B1UA 1NCXA 1NCYA 4YGCB 1WDCC 4L9MA 1N0YA 3IQQA 1J1EA 4M2OA 1W7JB 2KDHA 1DF0A 1YUTA
chains in the Genus database with same CATH superfamily
2ZKMX 4NDBA 1SL7A 2EGDA 2PYQA 1S1EA 1IJ5A 3WNXB 2P70A 1B8CA 1NCZA 2KFGA 3A8RA 1S26D 3HCMA 4YI8A 1TNWA 2GTEA 3JVTB 1S5GZ 3B86A 4ORAB 1XK4A 5CSIA 2Y4QA 3DXLA 1YVLA 4C0JA 1GGWA 2PSRA 2M0RA 1QS7A 1ZOTB 2LCPA 4A4CA 4AQIA 1QASA 2H61C 3BXKA 2H8VA 2H61A 4GNKB 4IL1A 1CNPA 2LANA 2M8UA 1SR6B 2PRUA 1LXFC 1KQVA 1BR4B 3BOWA 1KSOA 1YX8A 2KAYA 2KSPA 2LC5A 2GGMA 1NX3A 1WRLA 1KQMC 1T14A 1WRZA 3I5IC 2BCAA 2QPTA 2Q91A 1LA0A 5HKZA 2M1KB 1MUXA 1DGUA 1F8HA 2KQ6A 1V1FA 3VB1A 1OOIX 2ZFDA 3Q8IA 3CWGA 5DKQA 1PSRA 2R2IA 4GPLB 1AJ4A 1RFJA 1Y0VH 2K7OA 2BE6A 2M49B 4I5LB 5FI7A 3S0DA 1JUOA 1ZFSA 1NWDA 4YI9A 2AMIA 4ORBB 2V53A 2L5XB 2WNDA 5CSJA 1IQ3A 2JXCA 3OP0A 4QJ5B 2QEHA 2KAVA 3VRNA 2WCLA 1EH2A 1QTXA 3DVMA 1K90D 2F2PA 1BMOA 1OOJA 1PK0D 1PVAA 2AAOA 3SS4A 5KU1A 4GAOA 5CPVA 4F7FA 1YRUB 3WXAA 3IF7A 3OB1B 2K61A 1K95A 2FCDA 1XFUO 1LKJA 2ZNDA 1DTLA 3NSLA 1A2XA 1NIWA 1RECA 2KBIA 2LNKA 4MN0A 4CFRA 2CXJA 3SG7A 1XVJA 4KYNA 1R2UA 3SG6A 4PHJA 4Q04A 1CFDA 3S0GA 3D78A 2M7LA 4CIDA 1FI6A 1UHJA 4YRUA 1QLKA 2KPHA 5HL1A 1K94A 5I94A 1OZOA 1TNPA 1KK7Z 1UHIA 2PMYA 2NZ0A 3PN7C 1FPWA 5JJGA 2Y5IA 1SPYA 1JC2A 1OMDA 1QV1A 4HREE 3ZWHA 1F54A 2F3ZA 3JTDB 1QWVA 5AXIA 3KPXA 1EL4A 2G2BA 2BECA 3OX5A 1JFJA 3CZ0A 2CTNA 1TCFA 3O78A 1QVIZ 1Z2CB 1DJXA 3L4AA 3CGAA 2L4HA 5I2QA 3UNWA 3DVKA 1K96A 1UURA 2BAPA 2NCOA 3KHEA 1L2OC 4MRYA 5D69A 3PLFB 2BKIB 1OOGA 3VRPA 2WCHA 2BBMA 3QMEA 4MBEA 4PHKA 4C0LA 1CLLA 2WCJA 1DGVA 2JZIA 1NYAA 2BNXA 2PQLA 1Q80A 1WLZA 1EXRA 1YTZC 2K2AA 1RK9A 1KWOB 3NSKA 3PFVA 1C7WA 1ZACA 1TWOA 1G8IA 1V1GA 2OTGB 2YGUA 3D77A 3S0EA 2KGBC 1S36A 2LLSA 5I8NA 3AAKA 3FE6A 2RGIA 3DZTA 1B7TY 5HLOA 1W9ZA 1GJYA 2FJYA 2EC6C 3CS1A 3NSOA 3VRQA 1K9UA 5HYDA 1KSMA 1U5IA 2M97A 4ETOA 2KFHA 2L2CA 1SBJA 3LL8B 3AKBA 2LE9B 1BR1B 1K9KA 2LMUA 4ZCVA 3R1OA 1Z4HA 2NCPA 1PULA 1XA5A 4JPZB 4MZJA 3BFHA 5GQQC 2ZN9A 1CM4A 1J7QA 5B8IB 1Y6WA 4MVFA 1MWNA 1C3ZA 1EG4A 3CZ2A 3OBVA 1K93D 5D7FA 3VRRA 2BL0C 3B6XA 1M45A 1WRKA 2E30A 4NDCA 1QXPA 4OV2A 2LMVA 1HT9A 5DKRA 1MHOA 3CR5X 2LUXA 4PE4A 1A75A 5FI6A 3GK2A 2KI4B 3L4LA 4XYNA 1S6CA 2KI6D 2WCFA 2WC6A 2K7CA 2OPOA 1YR5A 1QIWA 2ZNEA 2KLDA 2LHIA 3I5HC 3RLZA 2QEBA 2FOTA 3RM1A 1MXEA 5ER4X 5FYXA 1RROA 3CZTX 1H8BA 1FI5A 1A4PA 1SCMC 1BT6A 3OB2B 1XK4C 4DRWA 1SMGA 1S5GY 3FS7A 2BBNA 1EJ3A 1CLMA 5AANA 4XJKB 5KSZA 3BFAA 3O4XA 3PATA 5TNCA 1SL9A 3OGNA 1TUJA 3LLEA 1ODBA 3O2PA 4PE7A 1LS8A 1LA3A 1SRAA 1YUUA 3CYZA 3TS5B 3DF0B 1WY9A 1W7IB 4DIRA 2HPSA 2LUCA 1UHKA 4I5JA 1BOCA 3FWBA 2ZRTA 4FQTA 1WLMA 4I5KA 1CKKA 1ALVA 3PM8A 2JT8A 2OS8C 2L2EA 2MJWB 3DD4A 1B47A 3NGVA 4I5NB 3GK1A 1B4CA 1PALA 1SYMA 2AUCA 3DVJA 5HKWA 2M29A 2F3YA 2QEOA 2TN4A 3TDIA 4WRIA 4MLWA 4P2YB 1P28A 2KNEA 4WQ3A 3RZSA 4MZKA 3DY9A 2I18A 3F45A 4F0ZB 2BKHB 1AUIB 4PE0A 3TUYC 3NHIA 3R72A 3I5FB 4P5OE 1JSAA 3D73A 2K2FA 1L7ZA 2JTZA 3R1VA 1CMFA 1DJYA 2O5GA 3TDUA 1PVBA 2NXQA 1IH0A 1XFWO 3NSIA 1LINA 3AKAA 1C3YA 1K9PA 3SG5A 1GGZA 4CFQA 1EG3A 3NXAA 2D8NA 2JNFA 1CFFA 1G33A 3FE9A 2LP2A 3JVTC 3KEVA 3D76A 5AEQA 1OOFA 2KFFA 3EVVA 3BUXB 4DUQA 1XFXO 3GOFA 1DJIA 2H2KA 2M3WA 1M39A 1KK8C 1DT7B 1QIVA 1RWYA 2JQ6A 2EHBA 1SR6C 4R1EA 5I2OA 3BFBA 2MA2A 2WOSA 4A4BA 2CT9A 1CMGA 4INWA 1SY9A 4BY4A 1RJVA 3LCPC 1F55A 2WCEA 1KK7Y 1OZSA 1AP4A 1TOPA 2LVIA 1Y1XA 1BODA 1RTP1 3AAJA 1TRFA 3E3RA 1QV0A 5CSFA 3K21A 1AJ5A 1J7PA 3MSEB 2LP3A 3D0YB 5DICA 1CTRA 1XO5A 2L50A 1QVIY 3VGOA 5KTYA 1XFRA 1SL8A 1SSEB 1G4YR 5PALA 1K2HA 1K8UA 4D1EA 4DCKA 2LMTA 3N7HA 1CFCA 1C7VA 4HRGA 1DJWA 4CLNA 3D10A 4OR9B 4QJ4B 3SG4A 3D75A 1F4OA 5J3XA 2GGZA 1VRKA 1OMRA 1SCVA 2BL0B 4OCIA 1NX1A 1OE9B 2MRDA 1MXLC 5DKNA 1F71A 1QATA 1NX0A 1N65A 1UUSA 1WDCB 2LVKA 2SCPA 1ALWA 3PJIA 4PALA 2K60A 3SS3A 4PCWA 1DF0B 2CBLA 2JULA 3B7AA 4ICBA 4NDDA 3BYAA 4N1GA 1YRTB 4OKHA 4QJ3B 1IKUA 1QJTA 4M2QA 1KFUL 2K0JA 1MR8A 2SASA 3LK1A 3S0BA 2BCXA 2PALA 1DQEA 3TDZA 2GV5A 1IWQA 2LAPA 1TIZA 5HLVA 3KO0A 1OW4A 4GUKA 1IG5A 1SCMB 2Y1MA 5JOLA 3B87A 2K7BA 1IRJA 3CABA 2WCBA 3IQOA 2LVVA 1TTXA 2JWWA 4N1FA 3H4SE 4OZDA 1NP8A 1X02A 5AFPA 4CPVA 1M46A 3BOWB 3KF9A 2BCBA 2L4IA 2COLB 1NX2A 3EVRA 5BPJA 2K8MB 3JTDC 2PVBA 2L51A 4YGDB 1KQMB 1C07A 3I5IB 2IS9A 3R1PA 1SKTA 3EKJA 5F6TA 1NSHA 4ORCB 1BF5A 3SG2A 1DJGA 3CTNA 3VROA 4C0KA 2JNXA 2KOTA 1BU3A 2JPTA 5D3OA 2JXLA 2L98A 4JKTA 1KWOC 2WC5A 3GK4X 3DVEA 3I5GC 4BY5A 3TUYB 1XFYO 2OTGC 3EVUA 2BE4A 2O60A 3EK8A 1CDLA 3UO9A 1QLSA 3BUWB 5IBWA 1B8LA 1KFXL 1KFXS 1AHRA 4NQGA 5G08A 2KHNA 2HETA 1F70A 1QX7A 1SW8A 1TN4A 3EKHA 1KCYA 3BJHA 1IGVA 3SJSA 4HSZA 1IJ6A 2KYFA 1YURA 1XFVO 1QX2A 1PSBA 1CDNA 4USLA 4DS7A 1YUSA 2ISDA 1GQMA 4ZCUA 1KK8B 3LK0A 5HKYA 2A4JA 2MAZA 2I94A 1AVSA 3O4YA 4JQ0D 2QEVA 3WHTB 1A03A 2KYCA 3HX4A 2KLEA 2MLFC 3PM2A 3TZ1A 1CB1A 2P6BB 4FTGA 3OX6A 4UPGA 1CLBA 2KI4C 1SNLA 3S0AA 4GBAA 3BUOB 3ZNIA 1JFKA 1TCOB 3PN7B 4YGEB 4MSPA 2HQ8A 1JF0A 2HQWA 4U8DA 1IQ5A 1S6JA 2JC2A 3O6BA 1J7OA 3DYEA 4AOMA 4E68A 5K89A 3QRXA 2ERBA 4GFTA 1OMVA 4IJ7A 2VRGA 2CNPA 1XFZO 1D1OA 2HF5A 1NPQA 4XJKA 4GGFC 4OVNF 5I2LA 1J55A 1ORGA 1YVHA 1L2OB 4GGFA 4MZLA 4PHNA 1UP5A 2JU0A 2L5YA 2Q4UA 4JD9A 3SIBA 2LLUA 3CR4X 1F4QA 4N5XA 1CDMA 3OHMB 2FCEA 2KQYA 5FI2A 2JPOA 4YGBB 1GM0A 3TS5C 1JF2A 2WCMA 3IVTA 3L47A 3DF0A 3NHTA 1J1DA 5EL2A 2F2OA 3CR2A 1JBAA 2KI6C 1IIOA 1AK8A 2DOQA 3A4UB 1N2DA 1M31A 2LV7A 1B8RA 2M1UA 2LLTA 1DC1A 2WORA 4MEWA 3PSRA 2QDIA 1TNQA 3SG3A 2EC6B 1JWDA 1E8AA 1J7RA 1U5IB 1FW4A 2L0PA 3BUMB 4M2PA 3SS5A 1OOHA 1BJFA 1QX5B 3WHUB 2K7DA 1CDPA 3BUNB 4HRHA 1SK6D 2P71A 2JTTA 2MHHA 1OQPA 4FQOA 4AQJA 1BLQA 2KBMA 1H4BA 1DVIA 3I5FC 2Y1NA 4PDZA 1ZMZA 2FJUB 1Y1AA 1S6IA 1LVCD 1A75B 1UHHA 4GGNA 1TNXA 5AERA 4INXA 2E6WA 3BQ3A 2JT0A 4YBHB 1KFUS 3M0WA 3I5HB 2CCMA 3EK4A 3CLNA 4PT1A 2KGRA 4TNCA 1S3PA 1B1GA 1Y1UA 2PASA 2JRFA 3EG5B 3C1VA 1A29A 3S0FA 1FBVA 2JOJA 2LM5A 2I7AA 2WC8A 2ZRSA 3FWCA 3B88A 1XYDA 2G9BA 5ER5A 3V2LA 3EK7A 1PRWA 1DELA 2LVJA 3I5GB 2QACA 2ZN8A 1MQ1A 2LHLA 3CDNA 1ZUZA 3PALA 3FIAA 1DJHA 1YX7A 2F8PA 4PE1A 2F33A 1B7TZ 4PHMA 1CM1A 2M7NA 2MLEC 3D74A 2NLNA 1TUZA 4MRXA 1FF1A 3D0YA 5CSNA 1B9AA 1NUBA 3SIAA 2OS8B 1HQVA 1BG1A 1MF8B 1R6PA 1UHNA 2JT3A 4JWQA 1UWOA 1OSAA 2KAXA 2WCKA 2I2RE 4WQ2A 2M9GA 2MBXA 3CZ1A 1M63B 4YGAA 1DJZA 1DMOA 1CFPA 3ICBA 3FE8A 2B1UA 1NCXA 1NCYA 4YGCB 1WDCC 4L9MA 1N0YA 3IQQA 1J1EA 4M2OA 1DEKA 1W7JB 2KDHA 1DF0A 3K1EA 1YUTA
chains in the Genus database with same CATH topology
2ZKMX 4NDBA 1SL7A 2EGDA 1S1EA 1IJ5A 3WNXB 3A8RA 1B8CA 1NCZA 2KFGA 1S26D 3HCMA 4YI8A 1TNWA 3JVTB 4ORAB 1S5GZ 5CSIA 1XK4A 4C0JA 2Y4QA 1YVLA 1GGWA 2PSRA 2M0RA 1QS7A 1ZOTB 2LCPA 4A4CA 4AQIA 1QASA 2H61C 3BXKA 4GNKB 2H61A 4IL1A 1CNPA 2LANA 2M8UA 1SR6B 2PRUA 1LXFC 1KQVA 1BR4B 3BOWA 1KSOA 1YX8A 2KAYA 2KSPA 2LC5A 2GGMA 1NX3A 1WRLA 1KQMC 1WRZA 3I5IC 2BCAA 2QPTA 2Q91A 1LA0A 5HKZA 2M1KB 1MUXA 1DGUA 1F8HA 2KQ6A 1V1FA 2ZFDA 3CWGA 5DKQA 1PSRA 2R2IA 4GPLB 1AJ4A 1RFJA 1Y0VH 2K7OA 2BE6A 2M49B 4I5LB 1JUOA 1ZFSA 1NWDA 4YI9A 2AMIA 4ORBB 2V53A 2L5XB 2WNDA 5CSJA 1IQ3A 2JXCA 3OP0A 4QJ5B 2KAVA 3VRNA 1EH2A 1QTXA 3DVMA 1K90D 2F2PA 1BMOA 1OOJA 1PK0D 1PVAA 2AAOA 5KU1A 4GAOA 5CPVA 1YRUB 3WXAA 3IF7A 3OB1B 2K61A 1K95A 2FCDA 1XFUO 1LKJA 2ZNDA 1DTLA 3NSLA 1A2XA 1NIWA 1RECA 2KBIA 2LNKA 4MN0A 4CFRA 2CXJA 3SG7A 1XVJA 3SG6A 1R2UA 4PHJA 4Q04A 1CFDA 2M7LA 4CIDA 1FI6A 1UHJA 4YRUA 1QLKA 1K94A 1OZOA 1TNPA 1KK7Z 1UHIA 2PMYA 2NZ0A 3PN7C 1FPWA 5JJGA 2Y5IA 1SPYA 1JC2A 1OMDA 1QV1A 4HREE 3ZWHA 1F54A 2F3ZA 3JTDB 5AXIA 3KPXA 1EL4A 2G2BA 2BECA 3OX5A 1JFJA 2CTNA 1TCFA 3O78A 1QVIZ 1DJXA 3CGAA 2L4HA 5I2QA 3DVKA 1K96A 1UURA 2NCOA 3KHEA 1L2OC 4MRYA 5D69A 3PLFB 2BKIB 3VRPA 2BBMA 4MBEA 4C0LA 4PHKA 1CLLA 1DGVA 2JZIA 1NYAA 1Q80A 1WLZA 1EXRA 1YTZC 2K2AA 1RK9A 1KWOB 3NSKA 3PFVA 1C7WA 1ZACA 1G8IA 1V1GA 2OTGB 2KGBC 1S36A 2LLSA 5I8NA 3AAKA 2RGIA 1B7TY 5HLOA 1GJYA 2EC6C 3CS1A 3NSOA 3VRQA 1K9UA 5HYDA 1KSMA 1U5IA 2M97A 4ETOA 2KFHA 3LL8B 1SBJA 3AKBA 2LE9B 1BR1B 1K9KA 2LMUA 4ZCVA 4JPZB 5GQQC 2NCPA 1PULA 1XA5A 4MZJA 2ZN9A 1CM4A 1J7QA 5B8IB 1Y6WA 4MVFA 1MWNA 1EG4A 1K93D 5D7FA 3VRRA 2BL0C 1M45A 1WRKA 2E30A 4NDCA 1QXPA 4OV2A 2LMVA 1HT9A 5DKRA 1MHOA 3CR5X 2LUXA 4PE4A 1A75A 3GK2A 2KI4B 4XYNA 1S6CA 2KI6D 2WCFA 2K7CA 2OPOA 1YR5A 1QIWA 2ZNEA 2LHIA 3I5HC 3RLZA 2FOTA 3RM1A 1MXEA 5ER4X 5FYXA 1RROA 3CZTX 1H8BA 1FI5A 1A4PA 1BT6A 1SCMC 3OB2B 1XK4C 4DRWA 1SMGA 1S5GY 3FS7A 2BBNA 1EJ3A 1CLMA 5AANA 4XJKB 5KSZA 3PATA 5TNCA 1SL9A 3LLEA 1ODBA 3O2PA 4PE7A 1LA3A 1SRAA 1YUUA 3TS5B 3DF0B 1WY9A 1W7IB 4DIRA 2HPSA 2LUCA 1UHKA 4I5JA 1BOCA 3FWBA 2ZRTA 4I5KA 1WLMA 1CKKA 1ALVA 3PM8A 2JT8A 2OS8C 2L2EA 2MJWB 3DD4A 1B47A 4I5NB 3GK1A 1B4CA 1PALA 1SYMA 2AUCA 3DVJA 5HKWA 2M29A 2F3YA 2TN4A 3TDIA 4WRIA 4MLWA 4P2YB 2KNEA 4WQ3A 4MZKA 2I18A 3F45A 4F0ZB 2BKHB 1AUIB 4PE0A 3TUYC 3I5FB 4P5OE 1JSAA 2K2FA 1L7ZA 2JTZA 1CMFA 1DJYA 2O5GA 3TDUA 1PVBA 2NXQA 1IH0A 1XFWO 3NSIA 1LINA 3AKAA 1K9PA 3SG5A 1GGZA 4CFQA 1EG3A 3NXAA 2D8NA 2JNFA 1CFFA 1G33A 2LP2A 3JVTC 3KEVA 5AEQA 2KFFA 3EVVA 3BUXB 4DUQA 1XFXO 3GOFA 1DJIA 2H2KA 2M3WA 1M39A 1KK8C 1DT7B 1QIVA 1RWYA 2JQ6A 2EHBA 1SR6C 4R1EA 5I2OA 2MA2A 2WOSA 4A4BA 2CT9A 1CMGA 1SY9A 4BY4A 1RJVA 3LCPC 1F55A 2WCEA 1KK7Y 1OZSA 1AP4A 1TOPA 2LVIA 1Y1XA 1BODA 1RTP1 3AAJA 1TRFA 3E3RA 1QV0A 5CSFA 3K21A 1AJ5A 1J7PA 3MSEB 2LP3A 3D0YB 1CTRA 1XO5A 2L50A 1QVIY 3VGOA 5KTYA 1K2HA 1SL8A 1G4YR 5PALA 1K8UA 4D1EA 4DCKA 2LMTA 1CFCA 1C7VA 4HRGA 1DJWA 4CLNA 3D10A 4OR9B 4QJ4B 3SG4A 1F4OA 5J3XA 2GGZA 1VRKA 1OMRA 1SCVA 2BL0B 4OCIA 1NX1A 1OE9B 2MRDA 1MXLC 5DKNA 1F71A 1QATA 1NX0A 1N65A 1UUSA 1WDCB 2LVKA 2SCPA 1ALWA 4PALA 4PCWA 1DF0B 2CBLA 2JULA 4ICBA 4NDDA 4OKHA 3BYAA 4N1GA 1YRTB 4QJ3B 1IKUA 1QJTA 4M2QA 1KFUL 2K0JA 1MR8A 2SASA 3LK1A 2BCXA 2PALA 3TDZA 2GV5A 1IWQA 2LAPA 1TIZA 5HLVA 3KO0A 4GUKA 1IG5A 1SCMB 2Y1MA 5JOLA 2K7BA 1IRJA 2WCBA 3IQOA 2LVVA 1TTXA 2JWWA 4N1FA 3H4SE 1NP8A 1X02A 5AFPA 4CPVA 1M46A 3BOWB 3KF9A 2BCBA 2L4IA 2COLB 1NX2A 3EVRA 5BPJA 2K8MB 3JTDC 2PVBA 2L51A 4YGDB 1KQMB 1C07A 3I5IB 2IS9A 1SKTA 3EKJA 5F6TA 1NSHA 4ORCB 1BF5A 3SG2A 1DJGA 3CTNA 3VROA 4C0KA 2JNXA 2KOTA 1BU3A 2JPTA 2JXLA 2L98A 1KWOC 3GK4X 3DVEA 3I5GC 4BY5A 3TUYB 1XFYO 2OTGC 3EVUA 2BE4A 2O60A 3EK8A 1CDLA 1QLSA 3BUWB 5IBWA 1B8LA 1KFXL 1KFXS 1AHRA 4NQGA 5G08A 2KHNA 2HETA 1F70A 1QX7A 1SW8A 1TN4A 3EKHA 1KCYA 1IGVA 3SJSA 4HSZA 1IJ6A 2KYFA 1YURA 1XFVO 1QX2A 1PSBA 1CDNA 4USLA 4DS7A 1YUSA 2ISDA 1GQMA 4ZCUA 1KK8B 3LK0A 5HKYA 2A4JA 2MAZA 2I94A 1AVSA 3O4YA 4JQ0D 3WHTB 1A03A 2KYCA 3HX4A 3TZ1A 2MLFC 1CB1A 2P6BB 4FTGA 3OX6A 4UPGA 1CLBA 2KI4C 1SNLA 4GBAA 3BUOB 3ZNIA 1JFKA 1TCOB 3PN7B 4YGEB 4MSPA 2HQ8A 1JF0A 2HQWA 4U8DA 1IQ5A 1S6JA 2JC2A 3O6BA 1J7OA 4AOMA 4E68A 5K89A 3QRXA 4GFTA 1OMVA 2VRGA 2CNPA 1XFZO 1D1OA 2HF5A 1NPQA 4XJKA 4GGFC 4OVNF 5I2LA 1J55A 1YVHA 4GGFA 1L2OB 4MZLA 4PHNA 1UP5A 2JU0A 2Q4UA 3SIBA 2LLUA 3CR4X 1F4QA 4N5XA 1CDMA 3OHMB 2FCEA 2KQYA 4YGBB 3TS5C 1JF2A 3DF0A 1J1DA 2F2OA 3CR2A 1JBAA 2KI6C 1AK8A 2DOQA 3A4UB 1N2DA 1M31A 2LV7A 1B8RA 2M1UA 2LLTA 2WORA 4MEWA 3PSRA 3SG3A 1TNQA 1JWDA 2EC6B 1E8AA 1J7RA 1U5IB 1FW4A 2L0PA 3BUMB 4M2PA 1BJFA 1QX5B 3WHUB 2K7DA 1CDPA 3BUNB 4HRHA 1SK6D 2JTTA 2MHHA 1OQPA 4FQOA 4AQJA 1BLQA 2KBMA 1H4BA 1DVIA 3I5FC 2Y1NA 4PDZA 1ZMZA 2FJUB 1Y1AA 1S6IA 1LVCD 1A75B 1UHHA 4GGNA 1TNXA 5AERA 2E6WA 3BQ3A 2JT0A 4YBHB 1KFUS 3M0WA 3I5HB 2CCMA 3EK4A 3CLNA 2KGRA 4TNCA 1S3PA 1B1GA 1Y1UA 2PASA 2JRFA 3C1VA 1A29A 1FBVA 2JOJA 2LM5A 2I7AA 2WC8A 2ZRSA 3FWCA 1XYDA 2G9BA 5ER5A 3EK7A 1PRWA 2LVJA 3I5GB 2QACA 2ZN8A 1MQ1A 2LHLA 1ZUZA 3PALA 3FIAA 1DJHA 1YX7A 2F8PA 4PE1A 2F33A 1B7TZ 4PHMA 1CM1A 2M7NA 2MLEC 2NLNA 4MRXA 1FF1A 3D0YA 5CSNA 1B9AA 1NUBA 3SIAA 2OS8B 1HQVA 1BG1A 1MF8B 1R6PA 1UHNA 2JT3A 4JWQA 1UWOA 1OSAA 2KAXA 2I2RE 4WQ2A 2M9GA 2MBXA 1M63B 4YGAA 1DJZA 1DMOA 1CFPA 3ICBA 2B1UA 1NCXA 1NCYA 4YGCB 1WDCC 4L9MA 1N0YA 3IQQA 1J1EA 4M2OA 1W7JB 2KDHA 1DF0A 1YUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZKM X;  4NDB A;  1SL7 A;  2EGD A;  1S1E A;  1IJ5 A;  3WNX B;  3A8R A;  1B8C A;  1NCZ A;  2KFG A;  1S26 D;  3HCM A;  4YI8 A;  1TNW A;  3JVT B;  4ORA B;  1S5G Z;  5CSI A;  1XK4 A;  4C0J A;  2Y4Q A;  1YVL A;  1GGW A;  2PSR A;  2M0R A;  1QS7 A;  1ZOT B;  2LCP A;  4A4C A;  4AQI A;  1QAS A;  2H61 C;  3BXK A;  4GNK B;  2H61 A;  4IL1 A;  1CNP A;  2LAN A;  2M8U A;  1SR6 B;  2PRU A;  1LXF C;  1KQV A;  1BR4 B;  3BOW A;  1KSO A;  1YX8 A;  2KAY A;  2KSP A;  2LC5 A;  2GGM A;  1NX3 A;  1WRL A;  1KQM C;  1WRZ A;  3I5I C;  2BCA A;  2QPT A;  2Q91 A;  1LA0 A;  5HKZ A;  2M1K B;  1MUX A;  1DGU A;  1F8H A;  2KQ6 A;  1V1F A;  2ZFD A;  3CWG A;  5DKQ A;  1PSR A;  2R2I A;  4GPL B;  1AJ4 A;  1RFJ A;  1Y0V H;  2K7O A;  2BE6 A;  2M49 B;  4I5L B;  1JUO A;  1ZFS A;  1NWD A;  4YI9 A;  2AMI A;  4ORB B;  2V53 A;  2L5X B;  2WND A;  5CSJ A;  1IQ3 A;  2JXC A;  3OP0 A;  4QJ5 B;  2KAV A;  3VRN A;  1EH2 A;  1QTX A;  3DVM A;  1K90 D;  2F2P A;  1BMO A;  1OOJ A;  1PK0 D;  1PVA A;  2AAO A;  5KU1 A;  4GAO A;  5CPV A;  1YRU B;  3WXA A;  3IF7 A;  3OB1 B;  2K61 A;  1K95 A;  2FCD A;  1XFU O;  1LKJ A;  2ZND A;  1DTL A;  3NSL A;  1A2X A;  1NIW A;  1REC A;  2KBI A;  2LNK A;  4MN0 A;  4CFR A;  2CXJ A;  3SG7 A;  1XVJ A;  3SG6 A;  1R2U A;  4PHJ A;  4Q04 A;  1CFD A;  2M7L A;  4CID A;  1FI6 A;  1UHJ A;  4YRU A;  1QLK A;  1K94 A;  1OZO A;  1TNP A;  1KK7 Z;  1UHI A;  2PMY A;  2NZ0 A;  3PN7 C;  1FPW A;  5JJG A;  2Y5I A;  1SPY A;  1JC2 A;  1OMD A;  1QV1 A;  4HRE E;  3ZWH A;  1F54 A;  2F3Z A;  3JTD B;  5AXI A;  3KPX A;  1EL4 A;  2G2B A;  2BEC A;  3OX5 A;  1JFJ A;  2CTN A;  1TCF A;  3O78 A;  1QVI Z;  1DJX A;  3CGA A;  2L4H A;  5I2Q A;  3DVK A;  1K96 A;  1UUR A;  2NCO A;  3KHE A;  1L2O C;  4MRY A;  5D69 A;  3PLF B;  2BKI B;  3VRP A;  2BBM A;  4MBE A;  4C0L A;  4PHK A;  1CLL A;  1DGV A;  2JZI A;  1NYA A;  1Q80 A;  1WLZ A;  1EXR A;  1YTZ C;  2K2A A;  1RK9 A;  1KWO B;  3NSK A;  3PFV A;  1C7W A;  1ZAC A;  1G8I A;  1V1G A;  2OTG B;  2KGB C;  1S36 A;  2LLS A;  5I8N A;  3AAK A;  2RGI A;  1B7T Y;  5HLO A;  1GJY A;  2EC6 C;  3CS1 A;  3NSO A;  3VRQ A;  1K9U A;  5HYD A;  1KSM A;  1U5I A;  2M97 A;  4ETO A;  2KFH A;  3LL8 B;  1SBJ A;  3AKB A;  2LE9 B;  1BR1 B;  1K9K A;  2LMU A;  4ZCV A;  4JPZ B;  5GQQ C;  2NCP A;  1PUL A;  1XA5 A;  4MZJ A;  2ZN9 A;  1CM4 A;  1J7Q A;  5B8I B;  1Y6W A;  4MVF A;  1MWN A;  1EG4 A;  1K93 D;  5D7F A;  3VRR A;  2BL0 C;  1M45 A;  1WRK A;  2E30 A;  4NDC A;  1QXP A;  4OV2 A;  2LMV A;  1HT9 A;  5DKR A;  1MHO A;  3CR5 X;  2LUX A;  4PE4 A;  1A75 A;  3GK2 A;  2KI4 B;  4XYN A;  1S6C A;  2KI6 D;  2WCF A;  2K7C A;  2OPO A;  1YR5 A;  1QIW A;  2ZNE A;  2LHI A;  3I5H C;  3RLZ A;  2FOT A;  3RM1 A;  1MXE A;  5ER4 X;  5FYX A;  1RRO A;  3CZT X;  1H8B A;  1FI5 A;  1A4P A;  1BT6 A;  1SCM C;  3OB2 B;  1XK4 C;  4DRW A;  1SMG A;  1S5G Y;  3FS7 A;  2BBN A;  1EJ3 A;  1CLM A;  5AAN A;  4XJK B;  5KSZ A;  3PAT A;  5TNC A;  1SL9 A;  3LLE A;  1ODB A;  3O2P A;  4PE7 A;  1LA3 A;  1SRA A;  1YUU A;  3TS5 B;  3DF0 B;  1WY9 A;  1W7I B;  4DIR A;  2HPS A;  2LUC A;  1UHK A;  4I5J A;  1BOC A;  3FWB A;  2ZRT A;  4I5K A;  1WLM A;  1CKK A;  1ALV A;  3PM8 A;  2JT8 A;  2OS8 C;  2L2E A;  2MJW B;  3DD4 A;  1B47 A;  4I5N B;  3GK1 A;  1B4C A;  1PAL A;  1SYM A;  2AUC A;  3DVJ A;  5HKW A;  2M29 A;  2F3Y A;  2TN4 A;  3TDI A;  4WRI A;  4MLW A;  4P2Y B;  2KNE A;  4WQ3 A;  4MZK A;  2I18 A;  3F45 A;  4F0Z B;  2BKH B;  1AUI B;  4PE0 A;  3TUY C;  3I5F B;  4P5O E;  1JSA A;  2K2F A;  1L7Z A;  2JTZ A;  1CMF A;  1DJY A;  2O5G A;  3TDU A;  1PVB A;  2NXQ A;  1IH0 A;  1XFW O;  3NSI A;  1LIN A;  3AKA A;  1K9P A;  3SG5 A;  1GGZ A;  4CFQ A;  1EG3 A;  3NXA A;  2D8N A;  2JNF A;  1CFF A;  1G33 A;  2LP2 A;  3JVT C;  3KEV A;  5AEQ A;  2KFF A;  3EVV A;  3BUX B;  4DUQ A;  1XFX O;  3GOF A;  1DJI A;  2H2K A;  2M3W A;  1M39 A;  1KK8 C;  1DT7 B;  1QIV A;  1RWY A;  2JQ6 A;  2EHB A;  1SR6 C;  4R1E A;  5I2O A;  2MA2 A;  2WOS A;  4A4B A;  2CT9 A;  1CMG A;  1SY9 A;  4BY4 A;  1RJV A;  3LCP C;  1F55 A;  2WCE A;  1KK7 Y;  1OZS A;  1AP4 A;  1TOP A;  2LVI A;  1Y1X A;  1BOD A;  1RTP 1;  3AAJ A;  1TRF A;  3E3R A;  1QV0 A;  5CSF A;  3K21 A;  1AJ5 A;  1J7P A;  3MSE B;  2LP3 A;  3D0Y B;  1CTR A;  1XO5 A;  2L50 A;  1QVI Y;  3VGO A;  5KTY A;  1K2H A;  1SL8 A;  1G4Y R;  5PAL A;  1K8U A;  4D1E A;  4DCK A;  2LMT A;  1CFC A;  1C7V A;  4HRG A;  1DJW A;  4CLN A;  3D10 A;  4OR9 B;  4QJ4 B;  3SG4 A;  1F4O A;  5J3X A;  2GGZ A;  1VRK A;  1OMR A;  1SCV A;  2BL0 B;  4OCI A;  1NX1 A;  1OE9 B;  2MRD A;  1MXL C;  5DKN A;  1F71 A;  1QAT A;  1NX0 A;  1N65 A;  1UUS A;  1WDC B;  2LVK A;  2SCP A;  1ALW A;  4PAL A;  4PCW A;  1DF0 B;  2CBL A;  2JUL A;  4ICB A;  4NDD A;  4OKH A;  3BYA A;  4N1G A;  1YRT B;  4QJ3 B;  1IKU A;  1QJT A;  4M2Q A;  1KFU L;  2K0J A;  1MR8 A;  2SAS A;  3LK1 A;  2BCX A;  2PAL A;  3TDZ A;  2GV5 A;  1IWQ A;  2LAP A;  1TIZ A;  5HLV A;  3KO0 A;  4GUK A;  1IG5 A;  1SCM B;  2Y1M A;  5JOL A;  2K7B A;  1IRJ A;  2WCB A;  3IQO A;  2LVV A;  1TTX A;  2JWW A;  4N1F A;  3H4S E;  1NP8 A;  1X02 A;  5AFP A;  4CPV A;  1M46 A;  3BOW B;  3KF9 A;  2BCB A;  2L4I A;  2COL B;  1NX2 A;  3EVR A;  5BPJ A;  2K8M B;  3JTD C;  2PVB A;  2L51 A;  4YGD B;  1KQM B;  1C07 A;  3I5I B;  2IS9 A;  1SKT A;  3EKJ A;  5F6T A;  1NSH A;  4ORC B;  1BF5 A;  3SG2 A;  1DJG A;  3CTN A;  3VRO A;  4C0K A;  2JNX A;  2KOT A;  1BU3 A;  2JPT A;  2JXL A;  2L98 A;  1KWO C;  3GK4 X;  3DVE A;  3I5G C;  4BY5 A;  3TUY B;  1XFY O;  2OTG C;  3EVU A;  2BE4 A;  2O60 A;  3EK8 A;  1CDL A;  1QLS A;  3BUW B;  5IBW A;  1B8L A;  1KFX L;  1KFX S;  1AHR A;  4NQG A;  5G08 A;  2KHN A;  2HET A;  1F70 A;  1QX7 A;  1SW8 A;  1TN4 A;  3EKH A;  1KCY A;  1IGV A;  3SJS A;  4HSZ A;  1IJ6 A;  2KYF A;  1YUR A;  1XFV O;  1QX2 A;  1PSB A;  1CDN A;  4USL A;  4DS7 A;  1YUS A;  2ISD A;  1GQM A;  4ZCU A;  1KK8 B;  3LK0 A;  5HKY A;  2A4J A;  2MAZ A;  2I94 A;  1AVS A;  3O4Y A;  4JQ0 D;  3WHT B;  1A03 A;  2KYC A;  3HX4 A;  3TZ1 A;  2MLF C;  1CB1 A;  2P6B B;  4FTG A;  3OX6 A;  4UPG A;  1CLB A;  2KI4 C;  1SNL A;  4GBA A;  3BUO B;  3ZNI A;  1JFK A;  1TCO B;  3PN7 B;  4YGE B;  4MSP A;  2HQ8 A;  1JF0 A;  2HQW A;  4U8D A;  1IQ5 A;  1S6J A;  2JC2 A;  3O6B A;  1J7O A;  4AOM A;  4E68 A;  5K89 A;  3QRX A;  4GFT A;  1OMV A;  2VRG A;  2CNP A;  1XFZ O;  1D1O A;  2HF5 A;  1NPQ A;  4XJK A;  4GGF C;  4OVN F;  5I2L A;  1J55 A;  1YVH A;  4GGF A;  1L2O B;  4MZL A;  4PHN A;  1UP5 A;  2JU0 A;  2Q4U A;  3SIB A;  2LLU A;  3CR4 X;  1F4Q A;  4N5X A;  1CDM A;  3OHM B;  2FCE A;  2KQY A;  4YGB B;  3TS5 C;  1JF2 A;  3DF0 A;  1J1D A;  2F2O A;  3CR2 A;  1JBA A;  2KI6 C;  1AK8 A;  2DOQ A;  3A4U B;  1N2D A;  1M31 A;  2LV7 A;  1B8R A;  2M1U A;  2LLT A;  2WOR A;  4MEW A;  3PSR A;  3SG3 A;  1TNQ A;  1JWD A;  2EC6 B;  1E8A A;  1J7R A;  1U5I B;  1FW4 A;  2L0P A;  3BUM B;  4M2P A;  1BJF A;  1QX5 B;  3WHU B;  2K7D A;  1CDP A;  3BUN B;  4HRH A;  1SK6 D;  2JTT A;  2MHH A;  1OQP A;  4FQO A;  4AQJ A;  1BLQ A;  2KBM A;  1H4B A;  1DVI A;  3I5F C;  2Y1N A;  4PDZ A;  1ZMZ A;  2FJU B;  1Y1A A;  1S6I A;  1LVC D;  1A75 B;  1UHH A;  4GGN A;  1TNX A;  5AER A;  2E6W A;  3BQ3 A;  2JT0 A;  4YBH B;  1KFU S;  3M0W A;  3I5H B;  2CCM A;  3EK4 A;  3CLN A;  2KGR A;  4TNC A;  1S3P A;  1B1G A;  1Y1U A;  2PAS A;  2JRF A;  3C1V A;  1A29 A;  1FBV A;  2JOJ A;  2LM5 A;  2I7A A;  2WC8 A;  2ZRS A;  3FWC A;  1XYD A;  2G9B A;  5ER5 A;  3EK7 A;  1PRW A;  2LVJ A;  3I5G B;  2QAC A;  2ZN8 A;  1MQ1 A;  2LHL A;  1ZUZ A;  3PAL A;  3FIA A;  1DJH A;  1YX7 A;  2F8P A;  4PE1 A;  2F33 A;  1B7T Z;  4PHM A;  1CM1 A;  2M7N A;  2MLE C;  2NLN A;  4MRX A;  1FF1 A;  3D0Y A;  5CSN A;  1B9A A;  1NUB A;  3SIA A;  2OS8 B;  1HQV A;  1BG1 A;  1MF8 B;  1R6P A;  1UHN A;  2JT3 A;  4JWQ A;  1UWO A;  1OSA A;  2KAX A;  2I2R E;  4WQ2 A;  2M9G A;  2MBX A;  1M63 B;  4YGA A;  1DJZ A;  1DMO A;  1CFP A;  3ICB A;  2B1U A;  1NCX A;  1NCY A;  4YGC B;  1WDC C;  4L9M A;  1N0Y A;  3IQQ A;  1J1E A;  4M2O A;  1W7J B;  2KDH A;  1DF0 A;  1YUT A; 
#chains in the Genus database with same CATH topology
 2ZKM X;  4NDB A;  1SL7 A;  2EGD A;  2PYQ A;  1S1E A;  1IJ5 A;  3WNX B;  2P70 A;  1B8C A;  1NCZ A;  2KFG A;  3A8R A;  1S26 D;  3HCM A;  4YI8 A;  1TNW A;  2GTE A;  3JVT B;  1S5G Z;  3B86 A;  4ORA B;  1XK4 A;  5CSI A;  2Y4Q A;  3DXL A;  1YVL A;  4C0J A;  1GGW A;  2PSR A;  2M0R A;  1QS7 A;  1ZOT B;  2LCP A;  4A4C A;  4AQI A;  1QAS A;  2H61 C;  3BXK A;  2H8V A;  2H61 A;  4GNK B;  4IL1 A;  1CNP A;  2LAN A;  2M8U A;  1SR6 B;  2PRU A;  1LXF C;  1KQV A;  1BR4 B;  3BOW A;  1KSO A;  1YX8 A;  2KAY A;  2KSP A;  2LC5 A;  2GGM A;  1NX3 A;  1WRL A;  1KQM C;  1T14 A;  1WRZ A;  3I5I C;  2BCA A;  2QPT A;  2Q91 A;  1LA0 A;  5HKZ A;  2M1K B;  1MUX A;  1DGU A;  1F8H A;  2KQ6 A;  1V1F A;  3VB1 A;  1OOI X;  2ZFD A;  3Q8I A;  3CWG A;  5DKQ A;  1PSR A;  2R2I A;  4GPL B;  1AJ4 A;  1RFJ A;  1Y0V H;  2K7O A;  2BE6 A;  2M49 B;  4I5L B;  5FI7 A;  3S0D A;  1JUO A;  1ZFS A;  1NWD A;  4YI9 A;  2AMI A;  4ORB B;  2V53 A;  2L5X B;  2WND A;  5CSJ A;  1IQ3 A;  2JXC A;  3OP0 A;  4QJ5 B;  2QEH A;  2KAV A;  3VRN A;  2WCL A;  1EH2 A;  1QTX A;  3DVM A;  1K90 D;  2F2P A;  1BMO A;  1OOJ A;  1PK0 D;  1PVA A;  2AAO A;  3SS4 A;  5KU1 A;  4GAO A;  5CPV A;  4F7F A;  1YRU B;  3WXA A;  3IF7 A;  3OB1 B;  2K61 A;  1K95 A;  2FCD A;  1XFU O;  1LKJ A;  2ZND A;  1DTL A;  3NSL A;  1A2X A;  1NIW A;  1REC A;  2KBI A;  2LNK A;  4MN0 A;  4CFR A;  2CXJ A;  3SG7 A;  1XVJ A;  4KYN A;  1R2U A;  3SG6 A;  4PHJ A;  4Q04 A;  1CFD A;  3S0G A;  3D78 A;  2M7L A;  4CID A;  1FI6 A;  1UHJ A;  4YRU A;  1QLK A;  2KPH A;  5HL1 A;  1K94 A;  5I94 A;  1OZO A;  1TNP A;  1KK7 Z;  1UHI A;  2PMY A;  2NZ0 A;  3PN7 C;  1FPW A;  5JJG A;  2Y5I A;  1SPY A;  1JC2 A;  1OMD A;  1QV1 A;  4HRE E;  3ZWH A;  1F54 A;  2F3Z A;  3JTD B;  1QWV A;  5AXI A;  3KPX A;  1EL4 A;  2G2B A;  2BEC A;  3OX5 A;  1JFJ A;  3CZ0 A;  2CTN A;  1TCF A;  3O78 A;  1QVI Z;  1Z2C B;  1DJX A;  3L4A A;  3CGA A;  2L4H A;  5I2Q A;  3UNW A;  3DVK A;  1K96 A;  1UUR A;  2BAP A;  2NCO A;  3KHE A;  1L2O C;  4MRY A;  5D69 A;  3PLF B;  2BKI B;  1OOG A;  3VRP A;  2WCH A;  2BBM A;  3QME A;  4MBE A;  4PHK A;  4C0L A;  1CLL A;  2WCJ A;  1DGV A;  2JZI A;  1NYA A;  2BNX A;  2PQL A;  1Q80 A;  1WLZ A;  1EXR A;  1YTZ C;  2K2A A;  1RK9 A;  1KWO B;  3NSK A;  3PFV A;  1C7W A;  1ZAC A;  1TWO A;  1G8I A;  1V1G A;  2OTG B;  2YGU A;  3D77 A;  3S0E A;  2KGB C;  1S36 A;  2LLS A;  5I8N A;  3AAK A;  3FE6 A;  2RGI A;  3DZT A;  1B7T Y;  5HLO A;  1W9Z A;  1GJY A;  2FJY A;  2EC6 C;  3CS1 A;  3NSO A;  3VRQ A;  1K9U A;  5HYD A;  1KSM A;  1U5I A;  2M97 A;  4ETO A;  2KFH A;  2L2C A;  1SBJ A;  3LL8 B;  3AKB A;  2LE9 B;  1BR1 B;  1K9K A;  2LMU A;  4ZCV A;  3R1O A;  1Z4H A;  2NCP A;  1PUL A;  1XA5 A;  4JPZ B;  4MZJ A;  3BFH A;  5GQQ C;  2ZN9 A;  1CM4 A;  1J7Q A;  5B8I B;  1Y6W A;  4MVF A;  1MWN A;  1C3Z A;  1EG4 A;  3CZ2 A;  3OBV A;  1K93 D;  5D7F A;  3VRR A;  2BL0 C;  3B6X A;  1M45 A;  1WRK A;  2E30 A;  4NDC A;  1QXP A;  4OV2 A;  2LMV A;  1HT9 A;  5DKR A;  1MHO A;  3CR5 X;  2LUX A;  4PE4 A;  1A75 A;  5FI6 A;  3GK2 A;  2KI4 B;  3L4L A;  4XYN A;  1S6C A;  2KI6 D;  2WCF A;  2WC6 A;  2K7C A;  2OPO A;  1YR5 A;  1QIW A;  2ZNE A;  2KLD A;  2LHI A;  3I5H C;  3RLZ A;  2QEB A;  2FOT A;  3RM1 A;  1MXE A;  5ER4 X;  5FYX A;  1RRO A;  3CZT X;  1H8B A;  1FI5 A;  1A4P A;  1SCM C;  1BT6 A;  3OB2 B;  1XK4 C;  4DRW A;  1SMG A;  1S5G Y;  3FS7 A;  2BBN A;  1EJ3 A;  1CLM A;  5AAN A;  4XJK B;  5KSZ A;  3BFA A;  3O4X A;  3PAT A;  5TNC A;  1SL9 A;  3OGN A;  1TUJ A;  3LLE A;  1ODB A;  3O2P A;  4PE7 A;  1LS8 A;  1LA3 A;  1SRA A;  1YUU A;  3CYZ A;  3TS5 B;  3DF0 B;  1WY9 A;  1W7I B;  4DIR A;  2HPS A;  2LUC A;  1UHK A;  4I5J A;  1BOC A;  3FWB A;  2ZRT A;  4FQT A;  1WLM A;  4I5K A;  1CKK A;  1ALV A;  3PM8 A;  2JT8 A;  2OS8 C;  2L2E A;  2MJW B;  3DD4 A;  1B47 A;  3NGV A;  4I5N B;  3GK1 A;  1B4C A;  1PAL A;  1SYM A;  2AUC A;  3DVJ A;  5HKW A;  2M29 A;  2F3Y A;  2QEO A;  2TN4 A;  3TDI A;  4WRI A;  4MLW A;  4P2Y B;  1P28 A;  2KNE A;  4WQ3 A;  3RZS A;  4MZK A;  3DY9 A;  2I18 A;  3F45 A;  4F0Z B;  2BKH B;  1AUI B;  4PE0 A;  3TUY C;  3NHI A;  3R72 A;  3I5F B;  4P5O E;  1JSA A;  3D73 A;  2K2F A;  1L7Z A;  2JTZ A;  3R1V A;  1CMF A;  1DJY A;  2O5G A;  3TDU A;  1PVB A;  2NXQ A;  1IH0 A;  1XFW O;  3NSI A;  1LIN A;  3AKA A;  1C3Y A;  1K9P A;  3SG5 A;  1GGZ A;  4CFQ A;  1EG3 A;  3NXA A;  2D8N A;  2JNF A;  1CFF A;  1G33 A;  3FE9 A;  2LP2 A;  3JVT C;  3KEV A;  3D76 A;  5AEQ A;  1OOF A;  2KFF A;  3EVV A;  3BUX B;  4DUQ A;  1XFX O;  3GOF A;  1DJI A;  2H2K A;  2M3W A;  1M39 A;  1KK8 C;  1DT7 B;  1QIV A;  1RWY A;  2JQ6 A;  2EHB A;  1SR6 C;  4R1E A;  5I2O A;  3BFB A;  2MA2 A;  2WOS A;  4A4B A;  2CT9 A;  1CMG A;  4INW A;  1SY9 A;  4BY4 A;  1RJV A;  3LCP C;  1F55 A;  2WCE A;  1KK7 Y;  1OZS A;  1AP4 A;  1TOP A;  2LVI A;  1Y1X A;  1BOD A;  1RTP 1;  3AAJ A;  1TRF A;  3E3R A;  1QV0 A;  5CSF A;  3K21 A;  1AJ5 A;  1J7P A;  3MSE B;  2LP3 A;  3D0Y B;  5DIC A;  1CTR A;  1XO5 A;  2L50 A;  1QVI Y;  3VGO A;  5KTY A;  1XFR A;  1SL8 A;  1SSE B;  1G4Y R;  5PAL A;  1K2H A;  1K8U A;  4D1E A;  4DCK A;  2LMT A;  3N7H A;  1CFC A;  1C7V A;  4HRG A;  1DJW A;  4CLN A;  3D10 A;  4OR9 B;  4QJ4 B;  3SG4 A;  3D75 A;  1F4O A;  5J3X A;  2GGZ A;  1VRK A;  1OMR A;  1SCV A;  2BL0 B;  4OCI A;  1NX1 A;  1OE9 B;  2MRD A;  1MXL C;  5DKN A;  1F71 A;  1QAT A;  1NX0 A;  1N65 A;  1UUS A;  1WDC B;  2LVK A;  2SCP A;  1ALW A;  3PJI A;  4PAL A;  2K60 A;  3SS3 A;  4PCW A;  1DF0 B;  2CBL A;  2JUL A;  3B7A A;  4ICB A;  4NDD A;  3BYA A;  4N1G A;  1YRT B;  4OKH A;  4QJ3 B;  1IKU A;  1QJT A;  4M2Q A;  1KFU L;  2K0J A;  1MR8 A;  2SAS A;  3LK1 A;  3S0B A;  2BCX A;  2PAL A;  1DQE A;  3TDZ A;  2GV5 A;  1IWQ A;  2LAP A;  1TIZ A;  5HLV A;  3KO0 A;  1OW4 A;  4GUK A;  1IG5 A;  1SCM B;  2Y1M A;  5JOL A;  3B87 A;  2K7B A;  1IRJ A;  3CAB A;  2WCB A;  3IQO A;  2LVV A;  1TTX A;  2JWW A;  4N1F A;  3H4S E;  4OZD A;  1NP8 A;  1X02 A;  5AFP A;  4CPV A;  1M46 A;  3BOW B;  3KF9 A;  2BCB A;  2L4I A;  2COL B;  1NX2 A;  3EVR A;  5BPJ A;  2K8M B;  3JTD C;  2PVB A;  2L51 A;  4YGD B;  1KQM B;  1C07 A;  3I5I B;  2IS9 A;  3R1P A;  1SKT A;  3EKJ A;  5F6T A;  1NSH A;  4ORC B;  1BF5 A;  3SG2 A;  1DJG A;  3CTN A;  3VRO A;  4C0K A;  2JNX A;  2KOT A;  1BU3 A;  2JPT A;  5D3O A;  2JXL A;  2L98 A;  4JKT A;  1KWO C;  2WC5 A;  3GK4 X;  3DVE A;  3I5G C;  4BY5 A;  3TUY B;  1XFY O;  2OTG C;  3EVU A;  2BE4 A;  2O60 A;  3EK8 A;  1CDL A;  3UO9 A;  1QLS A;  3BUW B;  5IBW A;  1B8L A;  1KFX L;  1KFX S;  1AHR A;  4NQG A;  5G08 A;  2KHN A;  2HET A;  1F70 A;  1QX7 A;  1SW8 A;  1TN4 A;  3EKH A;  1KCY A;  3BJH A;  1IGV A;  3SJS A;  4HSZ A;  1IJ6 A;  2KYF A;  1YUR A;  1XFV O;  1QX2 A;  1PSB A;  1CDN A;  4USL A;  4DS7 A;  1YUS A;  2ISD A;  1GQM A;  4ZCU A;  1KK8 B;  3LK0 A;  5HKY A;  2A4J A;  2MAZ A;  2I94 A;  1AVS A;  3O4Y A;  4JQ0 D;  2QEV A;  3WHT B;  1A03 A;  2KYC A;  3HX4 A;  2KLE A;  2MLF C;  3PM2 A;  3TZ1 A;  1CB1 A;  2P6B B;  4FTG A;  3OX6 A;  4UPG A;  1CLB A;  2KI4 C;  1SNL A;  3S0A A;  4GBA A;  3BUO B;  3ZNI A;  1JFK A;  1TCO B;  3PN7 B;  4YGE B;  4MSP A;  2HQ8 A;  1JF0 A;  2HQW A;  4U8D A;  1IQ5 A;  1S6J A;  2JC2 A;  3O6B A;  1J7O A;  3DYE A;  4AOM A;  4E68 A;  5K89 A;  3QRX A;  2ERB A;  4GFT A;  1OMV A;  4IJ7 A;  2VRG A;  2CNP A;  1XFZ O;  1D1O A;  2HF5 A;  1NPQ A;  4XJK A;  4GGF C;  4OVN F;  5I2L A;  1J55 A;  1ORG A;  1YVH A;  1L2O B;  4GGF A;  4MZL A;  4PHN A;  1UP5 A;  2JU0 A;  2L5Y A;  2Q4U A;  4JD9 A;  3SIB A;  2LLU A;  3CR4 X;  1F4Q A;  4N5X A;  1CDM A;  3OHM B;  2FCE A;  2KQY A;  5FI2 A;  2JPO A;  4YGB B;  1GM0 A;  3TS5 C;  1JF2 A;  2WCM A;  3IVT A;  3L47 A;  3DF0 A;  3NHT A;  1J1D A;  5EL2 A;  2F2O A;  3CR2 A;  1JBA A;  2KI6 C;  1IIO A;  1AK8 A;  2DOQ A;  3A4U B;  1N2D A;  1M31 A;  2LV7 A;  1B8R A;  2M1U A;  2LLT A;  1DC1 A;  2WOR A;  4MEW A;  3PSR A;  2QDI A;  1TNQ A;  3SG3 A;  2EC6 B;  1JWD A;  1E8A A;  1J7R A;  1U5I B;  1FW4 A;  2L0P A;  3BUM B;  4M2P A;  3SS5 A;  1OOH A;  1BJF A;  1QX5 B;  3WHU B;  2K7D A;  1CDP A;  3BUN B;  4HRH A;  1SK6 D;  2P71 A;  2JTT A;  2MHH A;  1OQP A;  4FQO A;  4AQJ A;  1BLQ A;  2KBM A;  1H4B A;  1DVI A;  3I5F C;  2Y1N A;  4PDZ A;  1ZMZ A;  2FJU B;  1Y1A A;  1S6I A;  1LVC D;  1A75 B;  1UHH A;  4GGN A;  1TNX A;  5AER A;  4INX A;  2E6W A;  3BQ3 A;  2JT0 A;  4YBH B;  1KFU S;  3M0W A;  3I5H B;  2CCM A;  3EK4 A;  3CLN A;  4PT1 A;  2KGR A;  4TNC A;  1S3P A;  1B1G A;  1Y1U A;  2PAS A;  2JRF A;  3EG5 B;  3C1V A;  1A29 A;  3S0F A;  1FBV A;  2JOJ A;  2LM5 A;  2I7A A;  2WC8 A;  2ZRS A;  3FWC A;  3B88 A;  1XYD A;  2G9B A;  5ER5 A;  3V2L A;  3EK7 A;  1PRW A;  1DEL A;  2LVJ A;  3I5G B;  2QAC A;  2ZN8 A;  1MQ1 A;  2LHL A;  3CDN A;  1ZUZ A;  3PAL A;  3FIA A;  1DJH A;  1YX7 A;  2F8P A;  4PE1 A;  2F33 A;  1B7T Z;  4PHM A;  1CM1 A;  2M7N A;  2MLE C;  3D74 A;  2NLN A;  1TUZ A;  4MRX A;  1FF1 A;  3D0Y A;  5CSN A;  1B9A A;  1NUB A;  3SIA A;  2OS8 B;  1HQV A;  1BG1 A;  1MF8 B;  1R6P A;  1UHN A;  2JT3 A;  4JWQ A;  1UWO A;  1OSA A;  2KAX A;  2WCK A;  2I2R E;  4WQ2 A;  2M9G A;  2MBX A;  3CZ1 A;  1M63 B;  4YGA A;  1DJZ A;  1DMO A;  1CFP A;  3ICB A;  3FE8 A;  2B1U A;  1NCX A;  1NCY A;  4YGC B;  1WDC C;  4L9M A;  1N0Y A;  3IQQ A;  1J1E A;  4M2O A;  1DEK A;  1W7J B;  2KDH A;  1DF0 A;  3K1E A;  1YUT A; 
#chains in the Genus database with same CATH homology
 2ZKM X;  4NDB A;  1SL7 A;  2EGD A;  1S1E A;  1IJ5 A;  3WNX B;  3A8R A;  1B8C A;  1NCZ A;  2KFG A;  1S26 D;  3HCM A;  4YI8 A;  1TNW A;  3JVT B;  4ORA B;  1S5G Z;  5CSI A;  1XK4 A;  4C0J A;  2Y4Q A;  1YVL A;  1GGW A;  2PSR A;  2M0R A;  1QS7 A;  1ZOT B;  2LCP A;  4A4C A;  4AQI A;  1QAS A;  2H61 C;  3BXK A;  4GNK B;  2H61 A;  4IL1 A;  1CNP A;  2LAN A;  2M8U A;  1SR6 B;  2PRU A;  1LXF C;  1KQV A;  1BR4 B;  3BOW A;  1KSO A;  1YX8 A;  2KAY A;  2KSP A;  2LC5 A;  2GGM A;  1NX3 A;  1WRL A;  1KQM C;  1WRZ A;  3I5I C;  2BCA A;  2QPT A;  2Q91 A;  1LA0 A;  5HKZ A;  2M1K B;  1MUX A;  1DGU A;  1F8H A;  2KQ6 A;  1V1F A;  2ZFD A;  3CWG A;  5DKQ A;  1PSR A;  2R2I A;  4GPL B;  1AJ4 A;  1RFJ A;  1Y0V H;  2K7O A;  2BE6 A;  2M49 B;  4I5L B;  1JUO A;  1ZFS A;  1NWD A;  4YI9 A;  2AMI A;  4ORB B;  2V53 A;  2L5X B;  2WND A;  5CSJ A;  1IQ3 A;  2JXC A;  3OP0 A;  4QJ5 B;  2KAV A;  3VRN A;  1EH2 A;  1QTX A;  3DVM A;  1K90 D;  2F2P A;  1BMO A;  1OOJ A;  1PK0 D;  1PVA A;  2AAO A;  5KU1 A;  4GAO A;  5CPV A;  1YRU B;  3WXA A;  3IF7 A;  3OB1 B;  2K61 A;  1K95 A;  2FCD A;  1XFU O;  1LKJ A;  2ZND A;  1DTL A;  3NSL A;  1A2X A;  1NIW A;  1REC A;  2KBI A;  2LNK A;  4MN0 A;  4CFR A;  2CXJ A;  3SG7 A;  1XVJ A;  3SG6 A;  1R2U A;  4PHJ A;  4Q04 A;  1CFD A;  2M7L A;  4CID A;  1FI6 A;  1UHJ A;  4YRU A;  1QLK A;  1K94 A;  1OZO A;  1TNP A;  1KK7 Z;  1UHI A;  2PMY A;  2NZ0 A;  3PN7 C;  1FPW A;  5JJG A;  2Y5I A;  1SPY A;  1JC2 A;  1OMD A;  1QV1 A;  4HRE E;  3ZWH A;  1F54 A;  2F3Z A;  3JTD B;  5AXI A;  3KPX A;  1EL4 A;  2G2B A;  2BEC A;  3OX5 A;  1JFJ A;  2CTN A;  1TCF A;  3O78 A;  1QVI Z;  1DJX A;  3CGA A;  2L4H A;  5I2Q A;  3DVK A;  1K96 A;  1UUR A;  2NCO A;  3KHE A;  1L2O C;  4MRY A;  5D69 A;  3PLF B;  2BKI B;  3VRP A;  2BBM A;  4MBE A;  4C0L A;  4PHK A;  1CLL A;  1DGV A;  2JZI A;  1NYA A;  1Q80 A;  1WLZ A;  1EXR A;  1YTZ C;  2K2A A;  1RK9 A;  1KWO B;  3NSK A;  3PFV A;  1C7W A;  1ZAC A;  1G8I A;  1V1G A;  2OTG B;  2KGB C;  1S36 A;  2LLS A;  5I8N A;  3AAK A;  2RGI A;  1B7T Y;  5HLO A;  1GJY A;  2EC6 C;  3CS1 A;  3NSO A;  3VRQ A;  1K9U A;  5HYD A;  1KSM A;  1U5I A;  2M97 A;  4ETO A;  2KFH A;  3LL8 B;  1SBJ A;  3AKB A;  2LE9 B;  1BR1 B;  1K9K A;  2LMU A;  4ZCV A;  4JPZ B;  5GQQ C;  2NCP A;  1PUL A;  1XA5 A;  4MZJ A;  2ZN9 A;  1CM4 A;  1J7Q A;  5B8I B;  1Y6W A;  4MVF A;  1MWN A;  1EG4 A;  1K93 D;  5D7F A;  3VRR A;  2BL0 C;  1M45 A;  1WRK A;  2E30 A;  4NDC A;  1QXP A;  4OV2 A;  2LMV A;  1HT9 A;  5DKR A;  1MHO A;  3CR5 X;  2LUX A;  4PE4 A;  1A75 A;  3GK2 A;  2KI4 B;  4XYN A;  1S6C A;  2KI6 D;  2WCF A;  2K7C A;  2OPO A;  1YR5 A;  1QIW A;  2ZNE A;  2LHI A;  3I5H C;  3RLZ A;  2FOT A;  3RM1 A;  1MXE A;  5ER4 X;  5FYX A;  1RRO A;  3CZT X;  1H8B A;  1FI5 A;  1A4P A;  1BT6 A;  1SCM C;  3OB2 B;  1XK4 C;  4DRW A;  1SMG A;  1S5G Y;  3FS7 A;  2BBN A;  1EJ3 A;  1CLM A;  5AAN A;  4XJK B;  5KSZ A;  3PAT A;  5TNC A;  1SL9 A;  3LLE A;  1ODB A;  3O2P A;  4PE7 A;  1LA3 A;  1SRA A;  1YUU A;  3TS5 B;  3DF0 B;  1WY9 A;  1W7I B;  4DIR A;  2HPS A;  2LUC A;  1UHK A;  4I5J A;  1BOC A;  3FWB A;  2ZRT A;  4I5K A;  1WLM A;  1CKK A;  1ALV A;  3PM8 A;  2JT8 A;  2OS8 C;  2L2E A;  2MJW B;  3DD4 A;  1B47 A;  4I5N B;  3GK1 A;  1B4C A;  1PAL A;  1SYM A;  2AUC A;  3DVJ A;  5HKW A;  2M29 A;  2F3Y A;  2TN4 A;  3TDI A;  4WRI A;  4MLW A;  4P2Y B;  2KNE A;  4WQ3 A;  4MZK A;  2I18 A;  3F45 A;  4F0Z B;  2BKH B;  1AUI B;  4PE0 A;  3TUY C;  3I5F B;  4P5O E;  1JSA A;  2K2F A;  1L7Z A;  2JTZ A;  1CMF A;  1DJY A;  2O5G A;  3TDU A;  1PVB A;  2NXQ A;  1IH0 A;  1XFW O;  3NSI A;  1LIN A;  3AKA A;  1K9P A;  3SG5 A;  1GGZ A;  4CFQ A;  1EG3 A;  3NXA A;  2D8N A;  2JNF A;  1CFF A;  1G33 A;  2LP2 A;  3JVT C;  3KEV A;  5AEQ A;  2KFF A;  3EVV A;  3BUX B;  4DUQ A;  1XFX O;  3GOF A;  1DJI A;  2H2K A;  2M3W A;  1M39 A;  1KK8 C;  1DT7 B;  1QIV A;  1RWY A;  2JQ6 A;  2EHB A;  1SR6 C;  4R1E A;  5I2O A;  2MA2 A;  2WOS A;  4A4B A;  2CT9 A;  1CMG A;  1SY9 A;  4BY4 A;  1RJV A;  3LCP C;  1F55 A;  2WCE A;  1KK7 Y;  1OZS A;  1AP4 A;  1TOP A;  2LVI A;  1Y1X A;  1BOD A;  1RTP 1;  3AAJ A;  1TRF A;  3E3R A;  1QV0 A;  5CSF A;  3K21 A;  1AJ5 A;  1J7P A;  3MSE B;  2LP3 A;  3D0Y B;  1CTR A;  1XO5 A;  2L50 A;  1QVI Y;  3VGO A;  5KTY A;  1K2H A;  1SL8 A;  1G4Y R;  5PAL A;  1K8U A;  4D1E A;  4DCK A;  2LMT A;  1CFC A;  1C7V A;  4HRG A;  1DJW A;  4CLN A;  3D10 A;  4OR9 B;  4QJ4 B;  3SG4 A;  1F4O A;  5J3X A;  2GGZ A;  1VRK A;  1OMR A;  1SCV A;  2BL0 B;  4OCI A;  1NX1 A;  1OE9 B;  2MRD A;  1MXL C;  5DKN A;  1F71 A;  1QAT A;  1NX0 A;  1N65 A;  1UUS A;  1WDC B;  2LVK A;  2SCP A;  1ALW A;  4PAL A;  4PCW A;  1DF0 B;  2CBL A;  2JUL A;  4ICB A;  4NDD A;  4OKH A;  3BYA A;  4N1G A;  1YRT B;  4QJ3 B;  1IKU A;  1QJT A;  4M2Q A;  1KFU L;  2K0J A;  1MR8 A;  2SAS A;  3LK1 A;  2BCX A;  2PAL A;  3TDZ A;  2GV5 A;  1IWQ A;  2LAP A;  1TIZ A;  5HLV A;  3KO0 A;  4GUK A;  1IG5 A;  1SCM B;  2Y1M A;  5JOL A;  2K7B A;  1IRJ A;  2WCB A;  3IQO A;  2LVV A;  1TTX A;  2JWW A;  4N1F A;  3H4S E;  1NP8 A;  1X02 A;  5AFP A;  4CPV A;  1M46 A;  3BOW B;  3KF9 A;  2BCB A;  2L4I A;  2COL B;  1NX2 A;  3EVR A;  5BPJ A;  2K8M B;  3JTD C;  2PVB A;  2L51 A;  4YGD B;  1KQM B;  1C07 A;  3I5I B;  2IS9 A;  1SKT A;  3EKJ A;  5F6T A;  1NSH A;  4ORC B;  1BF5 A;  3SG2 A;  1DJG A;  3CTN A;  3VRO A;  4C0K A;  2JNX A;  2KOT A;  1BU3 A;  2JPT A;  2JXL A;  2L98 A;  1KWO C;  3GK4 X;  3DVE A;  3I5G C;  4BY5 A;  3TUY B;  1XFY O;  2OTG C;  3EVU A;  2BE4 A;  2O60 A;  3EK8 A;  1CDL A;  1QLS A;  3BUW B;  5IBW A;  1B8L A;  1KFX L;  1KFX S;  1AHR A;  4NQG A;  5G08 A;  2KHN A;  2HET A;  1F70 A;  1QX7 A;  1SW8 A;  1TN4 A;  3EKH A;  1KCY A;  1IGV A;  3SJS A;  4HSZ A;  1IJ6 A;  2KYF A;  1YUR A;  1XFV O;  1QX2 A;  1PSB A;  1CDN A;  4USL A;  4DS7 A;  1YUS A;  2ISD A;  1GQM A;  4ZCU A;  1KK8 B;  3LK0 A;  5HKY A;  2A4J A;  2MAZ A;  2I94 A;  1AVS A;  3O4Y A;  4JQ0 D;  3WHT B;  1A03 A;  2KYC A;  3HX4 A;  3TZ1 A;  2MLF C;  1CB1 A;  2P6B B;  4FTG A;  3OX6 A;  4UPG A;  1CLB A;  2KI4 C;  1SNL A;  4GBA A;  3BUO B;  3ZNI A;  1JFK A;  1TCO B;  3PN7 B;  4YGE B;  4MSP A;  2HQ8 A;  1JF0 A;  2HQW A;  4U8D A;  1IQ5 A;  1S6J A;  2JC2 A;  3O6B A;  1J7O A;  4AOM A;  4E68 A;  5K89 A;  3QRX A;  4GFT A;  1OMV A;  2VRG A;  2CNP A;  1XFZ O;  1D1O A;  2HF5 A;  1NPQ A;  4XJK A;  4GGF C;  4OVN F;  5I2L A;  1J55 A;  1YVH A;  4GGF A;  1L2O B;  4MZL A;  4PHN A;  1UP5 A;  2JU0 A;  2Q4U A;  3SIB A;  2LLU A;  3CR4 X;  1F4Q A;  4N5X A;  1CDM A;  3OHM B;  2FCE A;  2KQY A;  4YGB B;  3TS5 C;  1JF2 A;  3DF0 A;  1J1D A;  2F2O A;  3CR2 A;  1JBA A;  2KI6 C;  1AK8 A;  2DOQ A;  3A4U B;  1N2D A;  1M31 A;  2LV7 A;  1B8R A;  2M1U A;  2LLT A;  2WOR A;  4MEW A;  3PSR A;  3SG3 A;  1TNQ A;  1JWD A;  2EC6 B;  1E8A A;  1J7R A;  1U5I B;  1FW4 A;  2L0P A;  3BUM B;  4M2P A;  1BJF A;  1QX5 B;  3WHU B;  2K7D A;  1CDP A;  3BUN B;  4HRH A;  1SK6 D;  2JTT A;  2MHH A;  1OQP A;  4FQO A;  4AQJ A;  1BLQ A;  2KBM A;  1H4B A;  1DVI A;  3I5F C;  2Y1N A;  4PDZ A;  1ZMZ A;  2FJU B;  1Y1A A;  1S6I A;  1LVC D;  1A75 B;  1UHH A;  4GGN A;  1TNX A;  5AER A;  2E6W A;  3BQ3 A;  2JT0 A;  4YBH B;  1KFU S;  3M0W A;  3I5H B;  2CCM A;  3EK4 A;  3CLN A;  2KGR A;  4TNC A;  1S3P A;  1B1G A;  1Y1U A;  2PAS A;  2JRF A;  3C1V A;  1A29 A;  1FBV A;  2JOJ A;  2LM5 A;  2I7A A;  2WC8 A;  2ZRS A;  3FWC A;  1XYD A;  2G9B A;  5ER5 A;  3EK7 A;  1PRW A;  2LVJ A;  3I5G B;  2QAC A;  2ZN8 A;  1MQ1 A;  2LHL A;  1ZUZ A;  3PAL A;  3FIA A;  1DJH A;  1YX7 A;  2F8P A;  4PE1 A;  2F33 A;  1B7T Z;  4PHM A;  1CM1 A;  2M7N A;  2MLE C;  2NLN A;  4MRX A;  1FF1 A;  3D0Y A;  5CSN A;  1B9A A;  1NUB A;  3SIA A;  2OS8 B;  1HQV A;  1BG1 A;  1MF8 B;  1R6P A;  1UHN A;  2JT3 A;  4JWQ A;  1UWO A;  1OSA A;  2KAX A;  2I2R E;  4WQ2 A;  2M9G A;  2MBX A;  1M63 B;  4YGA A;  1DJZ A;  1DMO A;  1CFP A;  3ICB A;  2B1U A;  1NCX A;  1NCY A;  4YGC B;  1WDC C;  4L9M A;  1N0Y A;  3IQQ A;  1J1E A;  4M2O A;  1W7J B;  2KDH A;  1DF0 A;  1YUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...