4U8DA

X-ray structure of mg-bound human sorcin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
172
structure length
172
Chain Sequence
FPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title INVESTIGATING THE CONFORMATIONAL CHANGES of SORCIN TO SHED LIGHT ON SIGNAL TRANSDUCTION IN THE APOPTOTIC PROCESS
rcsb
molecule keywords Sorcin
molecule tags Calcium binding protein
source organism Homo sapiens
total genus 61
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13405 EF-hand_6 EF-hand domain
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4u8dA00
1S1EA 1GGWA 2Y5IA 1L2OB 1XVJA 3CWGA 1LXFC 3I5FB 1KFXS 1TIZA 4MSPA 1IG5A 4FTGA 5D69A 1J7QA 1AJ5A 1WDCB 2MAZA 2ZNDA 1SR6B 4C0KA 1B9AA 1N2DA 1ZMZA 1XFXO 2JT0A 4U8DA 1CMGA 1BOCA 1BT6A 2LMTA 4PALA 2G2BA 2JNXA 1XO5A 4IL1A 4DRWA 1NX1A 4CFRA 1JUOA 2P6BB 1K8UA 1ZACA 5JJGA 2K61A 1KWOB 4MVFA 1DJIA 2CBLA 4ZCUA 1K9KA 2B1UA 2FOTA 2HQ8A 3OX5A 1NX3A 1MXEA 1QV0A 2OTGC 3VROA 5I2QA 1QX7A 3DD4A 1XFUO 1PRWA 1QASA 4YGBB 4YI8A 1KWOC 1IQ5A 3KPXA 3TS5B 3LL8B 4C0JA 4I5NB 1TN4A 2JTTA 3EK8A 4JQ0D 3OX6A 2M49B 2K2AA 3LK0A 2NXQA 1HT9A 1ALVA 2MBXA 2MLFC 1LA0A 4OKHA 3TUYC 2V53A 2LLUA 2M1KB 2LLSA 3AKAA 2LUCA 3KO0A 2BKIB 1DJWA 3PSRA 3BUNB 5GQQC 5I8NA 2GGMA 3I5HB 3I5GB 1CFDA 1MF8B 4UPGA 2O60A 3F45A 5AERA 4AQIA 1A03A 1YRTB 2OS8C 1F55A 2HF5A 3EVUA 1DJYA 4R1EA 1DVIA 2Y1NA 1DJXA 2K7DA 1CLLA 5J3XA 3VRRA 1AHRA 1UHKA 2LP3A 1TRFA 1X02A 1XA5A 2ZFDA 1OZSA 1D1OA 2COLB 2CT9A 4MBEA 1SRAA 1WRLA 3DVJA 1XFWO 4MRXA 4AOMA 3AAKA 2HQWA 2K7CA 2KHNA 2L0PA 2LHLA 2A4JA 3O2PA 1SMGA 3NXAA 1DGVA 2LVIA 1K90D 3WHTB 3WXAA 3DVEA 5KSZA 3PLFB 2LM5A 1LINA 1CDNA 4HREE 1OOJA 1H8BA 4PHNA 3AAJA 1YX8A 4BY5A 2L5XB 2HPSA 4GGNA 4XJKA 3TDIA 1B8CA 4MRYA 2LMUA 3C1VA 3CR2A 3PN7B 4YRUA 1CNPA 2LUXA 2PSRA 1M31A 2KGRA 2BKHB 2KI6D 1KCYA 1K96A 1MWNA 2Y4QA 4ZCVA 3SG2A 2K2FA 2G9BA 2WORA 2LVJA 2JPTA 1RFJA 3ZWHA 2WCFA 4PE0A 2EGDA 4QJ4B 1J55A 3H4SE 1EL4A 1ZUZA 3VRNA 4AQJA 1FPWA 1NPQA 4I5KA 4OV2A 1Q80A 1TNXA 1CDPA 1B7TZ 1KK8B 1WLMA 2Y1MA 4NDDA 1U5IA 4MZLA 1QVIZ 2L4HA 4I5LB 2I18A 5HLOA 1OE9B 3IQOA 4N1GA 3OP0A 1WRKA 4GGFC 4L9MA 2MA2A 1KSMA 2F2PA 1IKUA 5CSJA 2KFGA 4XJKB 1WY9A 1K94A 1F54A 5I2OA 4HRGA 3CR4X 1DJGA 1KK8C 3PALA 1NCXA 4PHJA 4YGCB 1EG3A 1NYAA 2KDHA 1PVBA 1RROA 1WRZA 1ALWA 1JF2A 2LVVA 2M3WA 1OMDA 1UHHA 1UURA 1QJTA 2BCXA 1Y6WA 3PATA 1AK8A 1IGVA 1A75B 3EVVA 4GUKA 4JWQA 2JU0A 1F71A 1U5IB 1Y1AA 3BUWB 1B8LA 1C7WA 1MQ1A 1GGZA 5BPJA 1XYDA 1IH0A 2M7NA 2ZN9A 2KFFA 5FYXA 1DJZA 1SK6D 1NSHA 4GPLB 3JTDC 4JPZB 1SCMC 1Y1XA 2KBIA 4CIDA 1N0YA 2R2IA 1NCYA 2KSPA 1KFUS 3PM8A 1SL8A 5JOLA 5IBWA 1IQ3A 4M2QA 1XFYO 2BBNA 1QLKA 2LLTA 3KHEA 4GAOA 1YUUA 1FBVA 2NLNA 1L2OC 4TNCA 2K7OA 2KBMA 1OMVA 3I5FC 2JOJA 1AP4A 1FI5A 1M63B 2OPOA 1KSOA 1WDCC 1B4CA 1SR6C 2LHIA 2JXLA 2O5GA 4A4CA 5AEQA 4P5OE 4PDZA 1DMOA 1JBAA 1N65A 3DVKA 2BCAA 3NSKA 1JWDA 4BY4A 1UUSA 1C7VA 1XK4C 3KF9A 1J1EA 1DT7B 1A2XA 1BR4B 3LCPC 1QVIY 1R6PA 2AUCA 3D0YA 1K9PA 3FWBA 3CR5X 4D1EA 1CLBA 2SASA 4Q04A 1KFXL 1PSRA 1PALA 2LE9B 4YBHB 2ZRTA 1CDMA 3BUXB 4YGAA 2FJUB 1QX5B 1TCFA 1BMOA 1S5GY 3RLZA 1MUXA 2M29A 2ISDA 3TS5C 1S3PA 1CB1A 1KK7Z 1G8IA 1TNQA 2L98A 1SL9A 1PSBA 5AXIA 1NX2A 5D7FA 3A4UB 3ZNIA 1QS7A 1CKKA 1K2HA 1LVCD 2JQ6A 2KI4B 5ER5A 1B8RA 3BOWA 2I2RE 2KQYA 4ICBA 1RWYA 1ODBA 2WC8A 3D0YB 5HKZA 1CFFA 1UWOA 2CCMA 2ZNEA 4CLNA 1ZFSA 2QPTA 1UP5A 3RM1A 2PALA 3I5HC 1TOPA 2L2EA 3I5GC 4GFTA 1KQMB 1J7PA 4N1FA 2RGIA 1NUBA 2Q4UA 4MN0A 5DKNA 1NX0A 2BCBA 5K89A 2AMIA 3NSIA 2H61A 2F33A 2HETA 2CXJA 2VRGA 2LANA 3K21A 3BUMB 1JFKA 1GQMA 2BBMA 2LP2A 1KQMC 2GV5A 2QACA 3SG6A 1J7RA 4HSZA 2JULA 1J7OA 4A4BA 4DUQA 2H2KA 1EJ3A 2WNDA 3BOWB 5TNCA 1J1DA 1SY9A 1AUIB 1M39A 1KQVA 2ZRSA 3SG4A 2KQ6A 2BL0B 1YTZC 3SJSA 1CM4A 1CDLA 3CGAA 3PN7C 3BXKA 1HQVA 1PVAA 1RK9A 1EG4A 4NDCA 1GJYA 3O4YA 2LC5A 2L4IA 2MHHA 1WLZA 2ZKMX 1CFPA 1MHOA 2I7AA 3FIAA 3TZ1A 1G33A 1SCVA 2D8NA 1W7IB 3WHUB 2M97A 3E3RA 3I5IB 2L51A 4MZKA 2F3ZA 4WRIA 1OSAA 4YGEB 1G4YR 2F3YA 5G08A 2DOQA 2KI6C 2K8MB 1K95A 2Q91A 4OR9B 4DCKA 2WCBA 1R2UA 1B47A 1NP8A 1PK0D 1V1GA 3HX4A 1F8HA 1IJ6A 1DJHA 2BECA 3IQQA 4PHKA 2BE4A 2MLEC 3VRPA 2NZ0A 5CSFA 1FF1A 1UHJA 4ETOA 1Y0VH 2LAPA 1JC2A 1EXRA 4E68A 4QJ5B 1A29A 1IRJA 1UHIA 1YRUB 5DKRA 1OQPA 3SG5A 2KAVA 1S6IA 3DVMA 3CLNA 1YUTA 4MEWA 1DGUA 2BE6A 3M0WA 2F8PA 2JT8A 1AJ4A 4OVNF 4N5XA 2JT3A 3ICBA 4WQ2A 5KTYA 1CFCA 2KYCA 3GK2A 2KFHA 2F2OA 4MZJA 1SNLA 5CSNA 1W7JB 1CLMA 1MXLC 3PFVA 2I94A 2LVKA 2NCOA 4MLWA 1RJVA 4NDBA 4C0LA 4PE1A 1SYMA 1QLSA 4WQ3A 3SIBA 1B7TY 4F0ZB 4QJ3B 3VRQA 3BUOB 2IS9A 2NCPA 2E30A 3IF7A 3SG7A 1OZOA 2M9GA 3NSLA 5I2LA 1BJFA 1UHNA 3MSEB 3HCMA 3OHMB 2OTGB 4CPVA 1M46A 3VGOA 4DS7A 2KAXA 4M2OA 1BODA 1OMRA 2FCDA 2WCEA 1KFUL 1RTP1 4NQGA 1YR5A 5CSIA 2L50A 3EK7A 2WOSA 2JXCA 3SIAA 1DTLA 2JWWA 2JNFA 3TUYB 3GK1A 2ZN8A 3AKBA 5CPVA 1JF0A 3NSOA 3GK4X 2MRDA 1BR1B 1RECA 3O78A 1YVHA 2OS8B 5ER4X 2LNKA 3A8RA 1QATA 1K9UA 3EKJA 3CTNA 3QRXA 4PE7A 2M7LA 1SPYA 3CS1A 1S6JA 2PASA 1YURA 3EVRA 1XFVO 2FCEA 2CNPA 1YX7A 3DF0A 1IJ5A 2M1UA 5HKYA 4PHMA 2AAOA 1BG1A 2KAYA 2KI4C 4FQOA 1QIWA 2JTZA 1TTXA 2TN4A 3D10A 3LK1A 4PCWA 1CMFA 3BQ3A 1YVLA 3GOFA 2K0JA 3EK4A 4DIRA 1Y1UA 2PMYA 3KEVA 1M45A 5AFPA 2KYFA 1XFZO 4GGFA 1DF0A 3FS7A 1YUSA 3CZTX 5KU1A 4ORBB 4YGDB 1CTRA 2LMVA 1NCZA 4ORAB 1FW4A 2JZIA 4HRHA 1F70A 1L7ZA 5HLVA 3DF0B 1NWDA 1FI6A 1AVSA 5B8IB 1S6CA 1S36A 2M8UA 4P2YB 2MJWB 5HYDA 4GBAA 1PULA 1F4QA 1F4OA 1JSAA 1MR8A 2BL0C 2KNEA 2CTNA 4USLA 1SKTA 1A4PA 2JC2A 5HKWA 3TDUA 3TDZA 1SW8A 1H4BA 3FWCA 1KK7Y 2GGZA 1QTXA 1DF0B 1ZOTB 1TNWA 2EHBA 1NIWA 1LA3A 5DKQA 1V1FA 3O6BA 5AANA 2H61C 1B1GA 1A75A 4GNKB 1EH2A 1TNPA 2PRUA 2SCPA 2E6WA 1BU3A 2PVBA 1BF5A 2EC6B 5F6TA 3I5IC 3WNXB 4ORCB 1TCOB 1SBJA 2M0RA 1IWQA 2KGBC 3LLEA 1SL7A 4M2PA 3JVTB 2K7BA 1JFJA 1QV1A 1S26D 1XK4A 1S5GZ 2JRFA 1C07A 5PALA 1LKJA 4OCIA 4CFQA 1E8AA 1K93D 2EC6C 2LV7A 4PE4A 4XYNA 3OB1B 1QIVA 4YI9A 3SG3A 1CM1A 2KOTA 3EKHA 1VRKA 3JTDB 1SCMB 2LCPA 4I5JA 3OB2B 1QX2A 1BLQA 3JVTC 3BYAA 1QXPA
chains in the Genus database with same CATH superfamily
1S1EA 3L4LA 2Y5IA 1GGWA 1L2OB 1XVJA 3IVTA 3CWGA 1LXFC 3I5FB 1KFXS 1TIZA 4MSPA 1IG5A 4FTGA 5D69A 1J7QA 1AJ5A 1WDCB 2MAZA 2ZNDA 1SR6B 4C0KA 1B9AA 1N2DA 1ZMZA 1OW4A 1XFXO 2JT0A 4U8DA 1CMGA 1BOCA 3DZTA 1BT6A 2LMTA 4PALA 2G2BA 2JNXA 1XO5A 4IL1A 4DRWA 1NX1A 4CFRA 1JUOA 2P6BB 1Z4HA 1K8UA 1ZACA 5JJGA 2K61A 1KWOB 4MVFA 1TWOA 1DJIA 2CBLA 4ZCUA 1C3YA 1K9KA 2B1UA 2FOTA 2HQ8A 3OX5A 1NX3A 3PJIA 1MXEA 1QV0A 2OTGC 3VROA 5I2QA 3L4AA 1QX7A 3DD4A 1XFUO 3OGNA 4IJ7A 4INWA 1PRWA 1QASA 3O4XA 4PT1A 4YI8A 1KWOC 1IQ5A 3KPXA 4YGBB 3TS5B 3FE9A 1T14A 3LL8B 4C0JA 4I5NB 1TN4A 2JTTA 3EK8A 4JQ0D 3OX6A 2M49B 2K2AA 3LK0A 2NXQA 1HT9A 1ALVA 2MBXA 2MLFC 3SS4A 1LA0A 4JD9A 4OKHA 3TUYC 2V53A 2LLUA 2M1KB 2LLSA 3AKAA 2LUCA 3KO0A 2BKIB 2PQLA 1DJWA 3PSRA 3BUNB 5GQQC 5I8NA 3FE8A 2GGMA 3I5HB 3I5GB 1CFDA 1MF8B 4UPGA 2O60A 3DXLA 3F45A 5AERA 3D76A 4AQIA 1A03A 1YRTB 2OS8C 1F55A 2HF5A 3EVUA 1DJYA 4R1EA 1DVIA 3SS5A 2Y1NA 1DJXA 2K7DA 1CLLA 5J3XA 3VRRA 1AHRA 1UHKA 2LP3A 1TRFA 1X02A 1XA5A 2ZFDA 1OZSA 1D1OA 2COLB 2CT9A 4MBEA 1SRAA 1WRLA 3DVJA 1XFWO 4MRXA 4AOMA 3AAKA 3B7AA 2HQWA 2K7CA 2KHNA 2L0PA 2LHLA 3NHTA 2A4JA 3O2PA 1SMGA 3NXAA 1DGVA 2LVIA 1K90D 1DQEA 1OOGA 3WHTB 3WXAA 3DVEA 5KSZA 3PLFB 2LM5A 1LINA 1CDNA 4HREE 1OOJA 1H8BA 4PHNA 3AAJA 1YX8A 4BY5A 2L5XB 2HPSA 4GGNA 4XJKA 3FE6A 3TDIA 1B8CA 4MRYA 2LMUA 3C1VA 3CR2A 3CDNA 3PN7B 4YRUA 1CNPA 2LUXA 2PSRA 1M31A 2KGRA 2BKHB 2KI6D 1OOHA 3PM2A 1KCYA 1K96A 1MWNA 2Y4QA 4ZCVA 3SG2A 2K2FA 2G9BA 2WORA 2LVJA 2JPTA 3BFBA 1RFJA 3ZWHA 2WCFA 4PE0A 2EGDA 4QJ4B 1J55A 3H4SE 1EL4A 1ZUZA 3VRNA 4AQJA 1FPWA 1NPQA 4I5KA 4OV2A 1Q80A 2WCHA 1TNXA 2QDIA 1CDPA 1B7TZ 1KK8B 1WLMA 2Y1MA 4NDDA 4F7FA 1U5IA 2L2CA 1QVIZ 4MZLA 2L4HA 4I5LB 2I18A 5HLOA 1OE9B 3IQOA 4N1GA 3OP0A 1WRKA 4GGFC 4L9MA 2MA2A 1C3ZA 1KSMA 2F2PA 1IKUA 5CSJA 2KFGA 3CZ1A 4XJKB 5EL2A 3S0GA 1WY9A 1P28A 1K94A 3CZ2A 1F54A 2PYQA 5I2OA 4HRGA 3CR4X 1DJGA 1KK8C 3PALA 1NCXA 4PHJA 4YGCB 1EG3A 1NYAA 2KDHA 1PVBA 1RROA 3CYZA 1Z2CB 1WRZA 1ALWA 1JF2A 2LVVA 2M3WA 1OMDA 1UHHA 1UURA 2P71A 3S0BA 1QJTA 2BCXA 1Y6WA 3PATA 1AK8A 1IGVA 1A75B 3EVVA 4GUKA 4JWQA 2JU0A 1F71A 1U5IB 1Y1AA 3BUWB 1B8LA 1C7WA 1MQ1A 1GGZA 5BPJA 1XYDA 5FI6A 2M7NA 4INXA 1IH0A 2ZN9A 2KFFA 5FYXA 3K1EA 1DJZA 1SK6D 1NSHA 4GPLB 3JTDC 4JPZB 1SCMC 1Y1XA 2KBIA 4CIDA 1N0YA 2R2IA 1NCYA 2KSPA 1KFUS 3PM8A 1SL8A 5JOLA 4JKTA 5IBWA 1IQ3A 4M2QA 1XFYO 2BBNA 1QLKA 2LLTA 3KHEA 4GAOA 1YUUA 4OZDA 1FBVA 2NLNA 1L2OC 4TNCA 2K7OA 2KBMA 1OMVA 3I5FC 2JOJA 3QMEA 1AP4A 1FI5A 1M63B 2OPOA 1KSOA 1WDCC 1B4CA 1SR6C 2LHIA 2JXLA 2O5GA 3DY9A 5AEQA 4P5OE 4PDZA 4A4CA 2WC5A 1N65A 3DVKA 2BCAA 3NSKA 3R72A 1DMOA 3V2LA 1UUSA 4BY4A 1C7VA 1XK4C 3KF9A 1JWDA 1J1EA 1DT7B 1A2XA 1BR4B 3LCPC 1QVIY 1R6PA 2WCMA 3SS3A 2AUCA 3D0YA 1K9PA 3FWBA 3CR5X 4D1EA 2WCKA 1CLBA 2SASA 4Q04A 1KFXL 1PSRA 1PALA 2LE9B 4YBHB 2ZRTA 2QEOA 3BJHA 3Q8IA 1CDMA 3BUXB 4YGAA 2FJUB 1QX5B 1TCFA 3R1VA 1BMOA 1S5GY 3RLZA 1MUXA 2M29A 3S0AA 2ISDA 3TS5C 1S3PA 1CB1A 1KK7Z 1G8IA 1TNQA 2L98A 1SL9A 1PSBA 5AXIA 1NX2A 5D7FA 3A4UB 3ZNIA 1QS7A 1DC1A 1CKKA 1K2HA 1LVCD 2JQ6A 2KI4B 5ER5A 1B8RA 3BOWA 2I2RE 2KQYA 5HL1A 4ICBA 1RWYA 1ODBA 2WC8A 3D0YB 5HKZA 1CFFA 1UWOA 2CCMA 2ZNEA 4CLNA 1ZFSA 2QPTA 1UP5A 3RM1A 2PALA 3I5HC 1TOPA 2L2EA 3I5GC 4GFTA 1KQMB 1J7PA 2QEBA 1IIOA 2H8VA 4N1FA 2RGIA 1NUBA 2Q4UA 4MN0A 5DKNA 1NX0A 2BCBA 5K89A 2AMIA 3NSIA 3VB1A 2H61A 2F33A 2HETA 5D3OA 2CXJA 2VRGA 2LANA 3K21A 3BUMB 1JFKA 1GQMA 2BBMA 2LP2A 1KQMC 2GV5A 2QACA 3SG6A 1J7RA 3D78A 4HSZA 2JULA 1J7OA 3BFHA 4A4BA 2H2KA 4DUQA 1EJ3A 2WNDA 3BOWB 5TNCA 1J1DA 2YGUA 1SY9A 1AUIB 1M39A 1KQVA 2ZRSA 3SG4A 2KQ6A 2QEHA 2BL0B 1YTZC 3SJSA 5DICA 3S0DA 1CM4A 1CDLA 1XFRA 3CGAA 3PN7C 2K60A 1HQVA 1PVAA 1RK9A 3BXKA 1EG4A 4NDCA 1GJYA 3O4YA 3N7HA 2LC5A 2L4IA 2MHHA 1WLZA 2ZKMX 1CFPA 1MHOA 2I7AA 3FIAA 3TZ1A 1G33A 1SCVA 2D8NA 1W7IB 2JPOA 2KPHA 3WHUB 1QWVA 2L5YA 2M97A 3E3RA 3I5IB 2L51A 4MZKA 2F3ZA 4WRIA 1OSAA 4YGEB 1G4YR 2F3YA 2BAPA 5G08A 3B88A 2DOQA 2KI6C 2K8MB 1K95A 2Q91A 4OR9B 4DCKA 2WCBA 1R2UA 1B47A 1NP8A 1PK0D 5FI2A 1V1GA 3HX4A 1F8HA 1IJ6A 1DJHA 2BECA 2FJYA 3IQQA 4PHKA 2BE4A 2GTEA 3S0EA 1GM0A 2MLEC 1W9ZA 3VRPA 2NZ0A 5CSFA 1FF1A 1UHJA 4ETOA 1Y0VH 2LAPA 1JC2A 1EXRA 1JBAA 4E68A 2WCLA 4QJ5B 1A29A 1IRJA 1SSEB 1UHIA 1YRUB 5DKRA 1OQPA 2WCJA 2KAVA 3SG5A 1S6IA 3DVMA 3CLNA 3R1OA 1YUTA 4MEWA 1DGUA 2ERBA 2BE6A 3M0WA 2F8PA 2JT8A 1AJ4A 4OVNF 4N5XA 2JT3A 3ICBA 4WQ2A 5KTYA 1CFCA 2KYCA 3GK2A 2KFHA 2F2OA 4MZJA 1SNLA 5CSNA 1W7JB 1CLMA 1MXLC 3PFVA 1OOIX 2I94A 2LVKA 2NCOA 4MLWA 1RJVA 4NDBA 4C0LA 4PE1A 1SYMA 1QLSA 4WQ3A 3SIBA 1B7TY 3L47A 4F0ZB 3D74A 4QJ3B 3VRQA 3BUOB 2IS9A 2NCPA 2E30A 4KYNA 3IF7A 3SG7A 1OZOA 2M9GA 3NSLA 5I2LA 1BJFA 1UHNA 3MSEB 3HCMA 3OHMB 2OTGB 4CPVA 1M46A 3VGOA 4DS7A 2KAXA 4M2OA 1BODA 1OMRA 3D73A 2FCDA 2WCEA 1KFUL 1RTP1 4NQGA 1YR5A 3NHIA 5CSIA 2L50A 3EK7A 2WOSA 2JXCA 3SIAA 1DTLA 2JWWA 2JNFA 3TUYB 3GK1A 3D75A 2ZN8A 3AKBA 5FI7A 3RZSA 5CPVA 1JF0A 3NSOA 3GK4X 2MRDA 1BR1B 1RECA 3O78A 1YVHA 2OS8B 2QEVA 2LNKA 3CZ0A 5ER4X 3A8RA 1QATA 1K9UA 3EKJA 3CTNA 3QRXA 4PE7A 2P70A 2M7LA 1SPYA 3CS1A 1S6JA 2PASA 1YURA 3EVRA 1XFVO 2FCEA 2CNPA 1YX7A 3DF0A 1IJ5A 2M1UA 5HKYA 4PHMA 2AAOA 1BG1A 2KAYA 2KI4C 3S0FA 4FQOA 1QIWA 2JTZA 1TTXA 2TN4A 3D10A 3LK1A 4PCWA 1CMFA 3BQ3A 3CABA 1YVLA 3GOFA 2K0JA 3EK4A 4DIRA 1Y1UA 2PMYA 3KEVA 1M45A 5AFPA 2KYFA 1XFZO 4GGFA 1DF0A 3FS7A 1YUSA 3CZTX 5KU1A 4ORBB 4YGDB 1CTRA 2LMVA 1NCZA 4ORAB 1FW4A 2JZIA 4HRHA 1F70A 1L7ZA 3OBVA 5HLVA 3DF0B 1NWDA 1FI6A 1AVSA 5B8IB 2BNXA 1S6CA 3DYEA 3UO9A 1S36A 2M8UA 1TUZA 4P2YB 2MJWB 5HYDA 4GBAA 1PULA 3UNWA 1F4QA 1F4OA 3B6XA 5I94A 1JSAA 1MR8A 4FQTA 2BL0C 2KNEA 2CTNA 4USLA 1SKTA 1A4PA 2JC2A 5HKWA 3TDUA 3TDZA 1SW8A 1H4BA 3FWCA 1KK7Y 2GGZA 1QTXA 1DF0B 3NGVA 1ZOTB 1TNWA 2EHBA 2WC6A 1NIWA 2KLEA 1LA3A 5DKQA 1V1FA 3B87A 3O6BA 5AANA 2H61C 1TUJA 1B1GA 1A75A 4GNKB 1EH2A 1TNPA 2PRUA 2SCPA 3D77A 2KLDA 3EG5B 2E6WA 3B86A 1BU3A 2PVBA 1BF5A 1DELA 2EC6B 5F6TA 1ORGA 3I5IC 4ORCB 3WNXB 1TCOB 1SBJA 2M0RA 1IWQA 2KGBC 3LLEA 1SL7A 4M2PA 3JVTB 2K7BA 1JFJA 1QV1A 1S26D 1XK4A 1S5GZ 1OOFA 2JRFA 1C07A 5PALA 1LKJA 4OCIA 4CFQA 1E8AA 1K93D 2EC6C 2LV7A 4PE4A 4XYNA 3OB1B 1QIVA 4YI9A 3SG3A 1CM1A 2KOTA 3EKHA 1VRKA 3JTDB 1SCMB 2LCPA 3R1PA 4I5JA 3OB2B 1QX2A 3BFAA 1DEKA 1BLQA 3JVTC 3BYAA 1QXPA 1LS8A
chains in the Genus database with same CATH topology
1S1EA 1GGWA 2Y5IA 1L2OB 1XVJA 3CWGA 1LXFC 3I5FB 1KFXS 1TIZA 4MSPA 1IG5A 4FTGA 5D69A 1J7QA 1AJ5A 1WDCB 2MAZA 2ZNDA 1SR6B 4C0KA 1B9AA 1N2DA 1ZMZA 1XFXO 2JT0A 4U8DA 1CMGA 1BOCA 1BT6A 2LMTA 4PALA 2G2BA 2JNXA 1XO5A 4IL1A 4DRWA 1NX1A 4CFRA 1JUOA 2P6BB 1K8UA 1ZACA 5JJGA 2K61A 1KWOB 4MVFA 1DJIA 2CBLA 4ZCUA 1K9KA 2B1UA 2FOTA 2HQ8A 3OX5A 1NX3A 1MXEA 1QV0A 2OTGC 3VROA 5I2QA 1QX7A 3DD4A 1XFUO 1PRWA 1QASA 4YGBB 4YI8A 1KWOC 1IQ5A 3KPXA 3TS5B 3LL8B 4C0JA 4I5NB 1TN4A 2JTTA 3EK8A 4JQ0D 3OX6A 2M49B 2K2AA 3LK0A 2NXQA 1HT9A 1ALVA 2MBXA 2MLFC 1LA0A 4OKHA 3TUYC 2V53A 2LLUA 2M1KB 2LLSA 3AKAA 2LUCA 3KO0A 2BKIB 1DJWA 3PSRA 3BUNB 5GQQC 5I8NA 2GGMA 3I5HB 3I5GB 1CFDA 1MF8B 4UPGA 2O60A 3F45A 5AERA 4AQIA 1A03A 1YRTB 2OS8C 1F55A 2HF5A 3EVUA 1DJYA 4R1EA 1DVIA 2Y1NA 1DJXA 2K7DA 1CLLA 5J3XA 3VRRA 1AHRA 1UHKA 2LP3A 1TRFA 1X02A 1XA5A 2ZFDA 1OZSA 1D1OA 2COLB 2CT9A 4MBEA 1SRAA 1WRLA 3DVJA 1XFWO 4MRXA 4AOMA 3AAKA 2HQWA 2K7CA 2KHNA 2L0PA 2LHLA 2A4JA 3O2PA 1SMGA 3NXAA 1DGVA 2LVIA 1K90D 3WHTB 3WXAA 3DVEA 5KSZA 3PLFB 2LM5A 1LINA 1CDNA 4HREE 1OOJA 1H8BA 4PHNA 3AAJA 1YX8A 4BY5A 2L5XB 2HPSA 4GGNA 4XJKA 3TDIA 1B8CA 4MRYA 2LMUA 3C1VA 3CR2A 3PN7B 4YRUA 1CNPA 2LUXA 2PSRA 1M31A 2KGRA 2BKHB 2KI6D 1KCYA 1K96A 1MWNA 2Y4QA 4ZCVA 3SG2A 2K2FA 2G9BA 2WORA 2LVJA 2JPTA 1RFJA 3ZWHA 2WCFA 4PE0A 2EGDA 4QJ4B 1J55A 3H4SE 1EL4A 1ZUZA 3VRNA 4AQJA 1FPWA 1NPQA 4I5KA 4OV2A 1Q80A 1TNXA 1CDPA 1B7TZ 1KK8B 1WLMA 2Y1MA 4NDDA 1U5IA 4MZLA 1QVIZ 2L4HA 4I5LB 2I18A 5HLOA 1OE9B 3IQOA 4N1GA 3OP0A 1WRKA 4GGFC 4L9MA 2MA2A 1KSMA 2F2PA 1IKUA 5CSJA 2KFGA 4XJKB 1WY9A 1K94A 1F54A 5I2OA 4HRGA 3CR4X 1DJGA 1KK8C 3PALA 1NCXA 4PHJA 4YGCB 1EG3A 1NYAA 2KDHA 1PVBA 1RROA 1WRZA 1ALWA 1JF2A 2LVVA 2M3WA 1OMDA 1UHHA 1UURA 1QJTA 2BCXA 1Y6WA 3PATA 1AK8A 1IGVA 1A75B 3EVVA 4GUKA 4JWQA 2JU0A 1F71A 1U5IB 1Y1AA 3BUWB 1B8LA 1C7WA 1MQ1A 1GGZA 5BPJA 1XYDA 1IH0A 2M7NA 2ZN9A 2KFFA 5FYXA 1DJZA 1SK6D 1NSHA 4GPLB 3JTDC 4JPZB 1SCMC 1Y1XA 2KBIA 4CIDA 1N0YA 2R2IA 1NCYA 2KSPA 1KFUS 3PM8A 1SL8A 5JOLA 5IBWA 1IQ3A 4M2QA 1XFYO 2BBNA 1QLKA 2LLTA 3KHEA 4GAOA 1YUUA 1FBVA 2NLNA 1L2OC 4TNCA 2K7OA 2KBMA 1OMVA 3I5FC 2JOJA 1AP4A 1FI5A 1M63B 2OPOA 1KSOA 1WDCC 1B4CA 1SR6C 2LHIA 2JXLA 2O5GA 4A4CA 5AEQA 4P5OE 4PDZA 1DMOA 1JBAA 1N65A 3DVKA 2BCAA 3NSKA 1JWDA 4BY4A 1UUSA 1C7VA 1XK4C 3KF9A 1J1EA 1DT7B 1A2XA 1BR4B 3LCPC 1QVIY 1R6PA 2AUCA 3D0YA 1K9PA 3FWBA 3CR5X 4D1EA 1CLBA 2SASA 4Q04A 1KFXL 1PSRA 1PALA 2LE9B 4YBHB 2ZRTA 1CDMA 3BUXB 4YGAA 2FJUB 1QX5B 1TCFA 1BMOA 1S5GY 3RLZA 1MUXA 2M29A 2ISDA 3TS5C 1S3PA 1CB1A 1KK7Z 1G8IA 1TNQA 2L98A 1SL9A 1PSBA 5AXIA 1NX2A 5D7FA 3A4UB 3ZNIA 1QS7A 1CKKA 1K2HA 1LVCD 2JQ6A 2KI4B 5ER5A 1B8RA 3BOWA 2I2RE 2KQYA 4ICBA 1RWYA 1ODBA 2WC8A 3D0YB 5HKZA 1CFFA 1UWOA 2CCMA 2ZNEA 4CLNA 1ZFSA 2QPTA 1UP5A 3RM1A 2PALA 3I5HC 1TOPA 2L2EA 3I5GC 4GFTA 1KQMB 1J7PA 4N1FA 2RGIA 1NUBA 2Q4UA 4MN0A 5DKNA 1NX0A 2BCBA 5K89A 2AMIA 3NSIA 2H61A 2F33A 2HETA 2CXJA 2VRGA 2LANA 3K21A 3BUMB 1JFKA 1GQMA 2BBMA 2LP2A 1KQMC 2GV5A 2QACA 3SG6A 1J7RA 4HSZA 2JULA 1J7OA 4A4BA 4DUQA 2H2KA 1EJ3A 2WNDA 3BOWB 5TNCA 1J1DA 1SY9A 1AUIB 1M39A 1KQVA 2ZRSA 3SG4A 2KQ6A 2BL0B 1YTZC 3SJSA 1CM4A 1CDLA 3CGAA 3PN7C 3BXKA 1HQVA 1PVAA 1RK9A 1EG4A 4NDCA 1GJYA 3O4YA 2LC5A 2L4IA 2MHHA 1WLZA 2ZKMX 1CFPA 1MHOA 2I7AA 3FIAA 3TZ1A 1G33A 1SCVA 2D8NA 1W7IB 3WHUB 2M97A 3E3RA 3I5IB 2L51A 4MZKA 2F3ZA 4WRIA 1OSAA 4YGEB 1G4YR 2F3YA 5G08A 2DOQA 2KI6C 2K8MB 1K95A 2Q91A 4OR9B 4DCKA 2WCBA 1R2UA 1B47A 1NP8A 1PK0D 1V1GA 3HX4A 1F8HA 1IJ6A 1DJHA 2BECA 3IQQA 4PHKA 2BE4A 2MLEC 3VRPA 2NZ0A 5CSFA 1FF1A 1UHJA 4ETOA 1Y0VH 2LAPA 1JC2A 1EXRA 4E68A 4QJ5B 1A29A 1IRJA 1UHIA 1YRUB 5DKRA 1OQPA 3SG5A 2KAVA 1S6IA 3DVMA 3CLNA 1YUTA 4MEWA 1DGUA 2BE6A 3M0WA 2F8PA 2JT8A 1AJ4A 4OVNF 4N5XA 2JT3A 3ICBA 4WQ2A 5KTYA 1CFCA 2KYCA 3GK2A 2KFHA 2F2OA 4MZJA 1SNLA 5CSNA 1W7JB 1CLMA 1MXLC 3PFVA 2I94A 2LVKA 2NCOA 4MLWA 1RJVA 4NDBA 4C0LA 4PE1A 1SYMA 1QLSA 4WQ3A 3SIBA 1B7TY 4F0ZB 4QJ3B 3VRQA 3BUOB 2IS9A 2NCPA 2E30A 3IF7A 3SG7A 1OZOA 2M9GA 3NSLA 5I2LA 1BJFA 1UHNA 3MSEB 3HCMA 3OHMB 2OTGB 4CPVA 1M46A 3VGOA 4DS7A 2KAXA 4M2OA 1BODA 1OMRA 2FCDA 2WCEA 1KFUL 1RTP1 4NQGA 1YR5A 5CSIA 2L50A 3EK7A 2WOSA 2JXCA 3SIAA 1DTLA 2JWWA 2JNFA 3TUYB 3GK1A 2ZN8A 3AKBA 5CPVA 1JF0A 3NSOA 3GK4X 2MRDA 1BR1B 1RECA 3O78A 1YVHA 2OS8B 5ER4X 2LNKA 3A8RA 1QATA 1K9UA 3EKJA 3CTNA 3QRXA 4PE7A 2M7LA 1SPYA 3CS1A 1S6JA 2PASA 1YURA 3EVRA 1XFVO 2FCEA 2CNPA 1YX7A 3DF0A 1IJ5A 2M1UA 5HKYA 4PHMA 2AAOA 1BG1A 2KAYA 2KI4C 4FQOA 1QIWA 2JTZA 1TTXA 2TN4A 3D10A 3LK1A 4PCWA 1CMFA 3BQ3A 1YVLA 3GOFA 2K0JA 3EK4A 4DIRA 1Y1UA 2PMYA 3KEVA 1M45A 5AFPA 2KYFA 1XFZO 4GGFA 1DF0A 3FS7A 1YUSA 3CZTX 5KU1A 4ORBB 4YGDB 1CTRA 2LMVA 1NCZA 4ORAB 1FW4A 2JZIA 4HRHA 1F70A 1L7ZA 5HLVA 3DF0B 1NWDA 1FI6A 1AVSA 5B8IB 1S6CA 1S36A 2M8UA 4P2YB 2MJWB 5HYDA 4GBAA 1PULA 1F4QA 1F4OA 1JSAA 1MR8A 2BL0C 2KNEA 2CTNA 4USLA 1SKTA 1A4PA 2JC2A 5HKWA 3TDUA 3TDZA 1SW8A 1H4BA 3FWCA 1KK7Y 2GGZA 1QTXA 1DF0B 1ZOTB 1TNWA 2EHBA 1NIWA 1LA3A 5DKQA 1V1FA 3O6BA 5AANA 2H61C 1B1GA 1A75A 4GNKB 1EH2A 1TNPA 2PRUA 2SCPA 2E6WA 1BU3A 2PVBA 1BF5A 2EC6B 5F6TA 3I5IC 3WNXB 4ORCB 1TCOB 1SBJA 2M0RA 1IWQA 2KGBC 3LLEA 1SL7A 4M2PA 3JVTB 2K7BA 1JFJA 1QV1A 1S26D 1XK4A 1S5GZ 2JRFA 1C07A 5PALA 1LKJA 4OCIA 4CFQA 1E8AA 1K93D 2EC6C 2LV7A 4PE4A 4XYNA 3OB1B 1QIVA 4YI9A 3SG3A 1CM1A 2KOTA 3EKHA 1VRKA 3JTDB 1SCMB 2LCPA 4I5JA 3OB2B 1QX2A 1BLQA 3JVTC 3BYAA 1QXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1E A;  1GGW A;  2Y5I A;  1L2O B;  1XVJ A;  3CWG A;  1LXF C;  3I5F B;  1KFX S;  1TIZ A;  4MSP A;  1IG5 A;  4FTG A;  5D69 A;  1J7Q A;  1AJ5 A;  1WDC B;  2MAZ A;  2ZND A;  1SR6 B;  4C0K A;  1B9A A;  1N2D A;  1ZMZ A;  1XFX O;  2JT0 A;  4U8D A;  1CMG A;  1BOC A;  1BT6 A;  2LMT A;  4PAL A;  2G2B A;  2JNX A;  1XO5 A;  4IL1 A;  4DRW A;  1NX1 A;  4CFR A;  1JUO A;  2P6B B;  1K8U A;  1ZAC A;  5JJG A;  2K61 A;  1KWO B;  4MVF A;  1DJI A;  2CBL A;  4ZCU A;  1K9K A;  2B1U A;  2FOT A;  2HQ8 A;  3OX5 A;  1NX3 A;  1MXE A;  1QV0 A;  2OTG C;  3VRO A;  5I2Q A;  1QX7 A;  3DD4 A;  1XFU O;  1PRW A;  1QAS A;  4YGB B;  4YI8 A;  1KWO C;  1IQ5 A;  3KPX A;  3TS5 B;  3LL8 B;  4C0J A;  4I5N B;  1TN4 A;  2JTT A;  3EK8 A;  4JQ0 D;  3OX6 A;  2M49 B;  2K2A A;  3LK0 A;  2NXQ A;  1HT9 A;  1ALV A;  2MBX A;  2MLF C;  1LA0 A;  4OKH A;  3TUY C;  2V53 A;  2LLU A;  2M1K B;  2LLS A;  3AKA A;  2LUC A;  3KO0 A;  2BKI B;  1DJW A;  3PSR A;  3BUN B;  5GQQ C;  5I8N A;  2GGM A;  3I5H B;  3I5G B;  1CFD A;  1MF8 B;  4UPG A;  2O60 A;  3F45 A;  5AER A;  4AQI A;  1A03 A;  1YRT B;  2OS8 C;  1F55 A;  2HF5 A;  3EVU A;  1DJY A;  4R1E A;  1DVI A;  2Y1N A;  1DJX A;  2K7D A;  1CLL A;  5J3X A;  3VRR A;  1AHR A;  1UHK A;  2LP3 A;  1TRF A;  1X02 A;  1XA5 A;  2ZFD A;  1OZS A;  1D1O A;  2COL B;  2CT9 A;  4MBE A;  1SRA A;  1WRL A;  3DVJ A;  1XFW O;  4MRX A;  4AOM A;  3AAK A;  2HQW A;  2K7C A;  2KHN A;  2L0P A;  2LHL A;  2A4J A;  3O2P A;  1SMG A;  3NXA A;  1DGV A;  2LVI A;  1K90 D;  3WHT B;  3WXA A;  3DVE A;  5KSZ A;  3PLF B;  2LM5 A;  1LIN A;  1CDN A;  4HRE E;  1OOJ A;  1H8B A;  4PHN A;  3AAJ A;  1YX8 A;  4BY5 A;  2L5X B;  2HPS A;  4GGN A;  4XJK A;  3TDI A;  1B8C A;  4MRY A;  2LMU A;  3C1V A;  3CR2 A;  3PN7 B;  4YRU A;  1CNP A;  2LUX A;  2PSR A;  1M31 A;  2KGR A;  2BKH B;  2KI6 D;  1KCY A;  1K96 A;  1MWN A;  2Y4Q A;  4ZCV A;  3SG2 A;  2K2F A;  2G9B A;  2WOR A;  2LVJ A;  2JPT A;  1RFJ A;  3ZWH A;  2WCF A;  4PE0 A;  2EGD A;  4QJ4 B;  1J55 A;  3H4S E;  1EL4 A;  1ZUZ A;  3VRN A;  4AQJ A;  1FPW A;  1NPQ A;  4I5K A;  4OV2 A;  1Q80 A;  1TNX A;  1CDP A;  1B7T Z;  1KK8 B;  1WLM A;  2Y1M A;  4NDD A;  1U5I A;  4MZL A;  1QVI Z;  2L4H A;  4I5L B;  2I18 A;  5HLO A;  1OE9 B;  3IQO A;  4N1G A;  3OP0 A;  1WRK A;  4GGF C;  4L9M A;  2MA2 A;  1KSM A;  2F2P A;  1IKU A;  5CSJ A;  2KFG A;  4XJK B;  1WY9 A;  1K94 A;  1F54 A;  5I2O A;  4HRG A;  3CR4 X;  1DJG A;  1KK8 C;  3PAL A;  1NCX A;  4PHJ A;  4YGC B;  1EG3 A;  1NYA A;  2KDH A;  1PVB A;  1RRO A;  1WRZ A;  1ALW A;  1JF2 A;  2LVV A;  2M3W A;  1OMD A;  1UHH A;  1UUR A;  1QJT A;  2BCX A;  1Y6W A;  3PAT A;  1AK8 A;  1IGV A;  1A75 B;  3EVV A;  4GUK A;  4JWQ A;  2JU0 A;  1F71 A;  1U5I B;  1Y1A A;  3BUW B;  1B8L A;  1C7W A;  1MQ1 A;  1GGZ A;  5BPJ A;  1XYD A;  1IH0 A;  2M7N A;  2ZN9 A;  2KFF A;  5FYX A;  1DJZ A;  1SK6 D;  1NSH A;  4GPL B;  3JTD C;  4JPZ B;  1SCM C;  1Y1X A;  2KBI A;  4CID A;  1N0Y A;  2R2I A;  1NCY A;  2KSP A;  1KFU S;  3PM8 A;  1SL8 A;  5JOL A;  5IBW A;  1IQ3 A;  4M2Q A;  1XFY O;  2BBN A;  1QLK A;  2LLT A;  3KHE A;  4GAO A;  1YUU A;  1FBV A;  2NLN A;  1L2O C;  4TNC A;  2K7O A;  2KBM A;  1OMV A;  3I5F C;  2JOJ A;  1AP4 A;  1FI5 A;  1M63 B;  2OPO A;  1KSO A;  1WDC C;  1B4C A;  1SR6 C;  2LHI A;  2JXL A;  2O5G A;  4A4C A;  5AEQ A;  4P5O E;  4PDZ A;  1DMO A;  1JBA A;  1N65 A;  3DVK A;  2BCA A;  3NSK A;  1JWD A;  4BY4 A;  1UUS A;  1C7V A;  1XK4 C;  3KF9 A;  1J1E A;  1DT7 B;  1A2X A;  1BR4 B;  3LCP C;  1QVI Y;  1R6P A;  2AUC A;  3D0Y A;  1K9P A;  3FWB A;  3CR5 X;  4D1E A;  1CLB A;  2SAS A;  4Q04 A;  1KFX L;  1PSR A;  1PAL A;  2LE9 B;  4YBH B;  2ZRT A;  1CDM A;  3BUX B;  4YGA A;  2FJU B;  1QX5 B;  1TCF A;  1BMO A;  1S5G Y;  3RLZ A;  1MUX A;  2M29 A;  2ISD A;  3TS5 C;  1S3P A;  1CB1 A;  1KK7 Z;  1G8I A;  1TNQ A;  2L98 A;  1SL9 A;  1PSB A;  5AXI A;  1NX2 A;  5D7F A;  3A4U B;  3ZNI A;  1QS7 A;  1CKK A;  1K2H A;  1LVC D;  2JQ6 A;  2KI4 B;  5ER5 A;  1B8R A;  3BOW A;  2I2R E;  2KQY A;  4ICB A;  1RWY A;  1ODB A;  2WC8 A;  3D0Y B;  5HKZ A;  1CFF A;  1UWO A;  2CCM A;  2ZNE A;  4CLN A;  1ZFS A;  2QPT A;  1UP5 A;  3RM1 A;  2PAL A;  3I5H C;  1TOP A;  2L2E A;  3I5G C;  4GFT A;  1KQM B;  1J7P A;  4N1F A;  2RGI A;  1NUB A;  2Q4U A;  4MN0 A;  5DKN A;  1NX0 A;  2BCB A;  5K89 A;  2AMI A;  3NSI A;  2H61 A;  2F33 A;  2HET A;  2CXJ A;  2VRG A;  2LAN A;  3K21 A;  3BUM B;  1JFK A;  1GQM A;  2BBM A;  2LP2 A;  1KQM C;  2GV5 A;  2QAC A;  3SG6 A;  1J7R A;  4HSZ A;  2JUL A;  1J7O A;  4A4B A;  4DUQ A;  2H2K A;  1EJ3 A;  2WND A;  3BOW B;  5TNC A;  1J1D A;  1SY9 A;  1AUI B;  1M39 A;  1KQV A;  2ZRS A;  3SG4 A;  2KQ6 A;  2BL0 B;  1YTZ C;  3SJS A;  1CM4 A;  1CDL A;  3CGA A;  3PN7 C;  3BXK A;  1HQV A;  1PVA A;  1RK9 A;  1EG4 A;  4NDC A;  1GJY A;  3O4Y A;  2LC5 A;  2L4I A;  2MHH A;  1WLZ A;  2ZKM X;  1CFP A;  1MHO A;  2I7A A;  3FIA A;  3TZ1 A;  1G33 A;  1SCV A;  2D8N A;  1W7I B;  3WHU B;  2M97 A;  3E3R A;  3I5I B;  2L51 A;  4MZK A;  2F3Z A;  4WRI A;  1OSA A;  4YGE B;  1G4Y R;  2F3Y A;  5G08 A;  2DOQ A;  2KI6 C;  2K8M B;  1K95 A;  2Q91 A;  4OR9 B;  4DCK A;  2WCB A;  1R2U A;  1B47 A;  1NP8 A;  1PK0 D;  1V1G A;  3HX4 A;  1F8H A;  1IJ6 A;  1DJH A;  2BEC A;  3IQQ A;  4PHK A;  2BE4 A;  2MLE C;  3VRP A;  2NZ0 A;  5CSF A;  1FF1 A;  1UHJ A;  4ETO A;  1Y0V H;  2LAP A;  1JC2 A;  1EXR A;  4E68 A;  4QJ5 B;  1A29 A;  1IRJ A;  1UHI A;  1YRU B;  5DKR A;  1OQP A;  3SG5 A;  2KAV A;  1S6I A;  3DVM A;  3CLN A;  1YUT A;  4MEW A;  1DGU A;  2BE6 A;  3M0W A;  2F8P A;  2JT8 A;  1AJ4 A;  4OVN F;  4N5X A;  2JT3 A;  3ICB A;  4WQ2 A;  5KTY A;  1CFC A;  2KYC A;  3GK2 A;  2KFH A;  2F2O A;  4MZJ A;  1SNL A;  5CSN A;  1W7J B;  1CLM A;  1MXL C;  3PFV A;  2I94 A;  2LVK A;  2NCO A;  4MLW A;  1RJV A;  4NDB A;  4C0L A;  4PE1 A;  1SYM A;  1QLS A;  4WQ3 A;  3SIB A;  1B7T Y;  4F0Z B;  4QJ3 B;  3VRQ A;  3BUO B;  2IS9 A;  2NCP A;  2E30 A;  3IF7 A;  3SG7 A;  1OZO A;  2M9G A;  3NSL A;  5I2L A;  1BJF A;  1UHN A;  3MSE B;  3HCM A;  3OHM B;  2OTG B;  4CPV A;  1M46 A;  3VGO A;  4DS7 A;  2KAX A;  4M2O A;  1BOD A;  1OMR A;  2FCD A;  2WCE A;  1KFU L;  1RTP 1;  4NQG A;  1YR5 A;  5CSI A;  2L50 A;  3EK7 A;  2WOS A;  2JXC A;  3SIA A;  1DTL A;  2JWW A;  2JNF A;  3TUY B;  3GK1 A;  2ZN8 A;  3AKB A;  5CPV A;  1JF0 A;  3NSO A;  3GK4 X;  2MRD A;  1BR1 B;  1REC A;  3O78 A;  1YVH A;  2OS8 B;  5ER4 X;  2LNK A;  3A8R A;  1QAT A;  1K9U A;  3EKJ A;  3CTN A;  3QRX A;  4PE7 A;  2M7L A;  1SPY A;  3CS1 A;  1S6J A;  2PAS A;  1YUR A;  3EVR A;  1XFV O;  2FCE A;  2CNP A;  1YX7 A;  3DF0 A;  1IJ5 A;  2M1U A;  5HKY A;  4PHM A;  2AAO A;  1BG1 A;  2KAY A;  2KI4 C;  4FQO A;  1QIW A;  2JTZ A;  1TTX A;  2TN4 A;  3D10 A;  3LK1 A;  4PCW A;  1CMF A;  3BQ3 A;  1YVL A;  3GOF A;  2K0J A;  3EK4 A;  4DIR A;  1Y1U A;  2PMY A;  3KEV A;  1M45 A;  5AFP A;  2KYF A;  1XFZ O;  4GGF A;  1DF0 A;  3FS7 A;  1YUS A;  3CZT X;  5KU1 A;  4ORB B;  4YGD B;  1CTR A;  2LMV A;  1NCZ A;  4ORA B;  1FW4 A;  2JZI A;  4HRH A;  1F70 A;  1L7Z A;  5HLV A;  3DF0 B;  1NWD A;  1FI6 A;  1AVS A;  5B8I B;  1S6C A;  1S36 A;  2M8U A;  4P2Y B;  2MJW B;  5HYD A;  4GBA A;  1PUL A;  1F4Q A;  1F4O A;  1JSA A;  1MR8 A;  2BL0 C;  2KNE A;  2CTN A;  4USL A;  1SKT A;  1A4P A;  2JC2 A;  5HKW A;  3TDU A;  3TDZ A;  1SW8 A;  1H4B A;  3FWC A;  1KK7 Y;  2GGZ A;  1QTX A;  1DF0 B;  1ZOT B;  1TNW A;  2EHB A;  1NIW A;  1LA3 A;  5DKQ A;  1V1F A;  3O6B A;  5AAN A;  2H61 C;  1B1G A;  1A75 A;  4GNK B;  1EH2 A;  1TNP A;  2PRU A;  2SCP A;  2E6W A;  1BU3 A;  2PVB A;  1BF5 A;  2EC6 B;  5F6T A;  3I5I C;  3WNX B;  4ORC B;  1TCO B;  1SBJ A;  2M0R A;  1IWQ A;  2KGB C;  3LLE A;  1SL7 A;  4M2P A;  3JVT B;  2K7B A;  1JFJ A;  1QV1 A;  1S26 D;  1XK4 A;  1S5G Z;  2JRF A;  1C07 A;  5PAL A;  1LKJ A;  4OCI A;  4CFQ A;  1E8A A;  1K93 D;  2EC6 C;  2LV7 A;  4PE4 A;  4XYN A;  3OB1 B;  1QIV A;  4YI9 A;  3SG3 A;  1CM1 A;  2KOT A;  3EKH A;  1VRK A;  3JTD B;  1SCM B;  2LCP A;  4I5J A;  3OB2 B;  1QX2 A;  1BLQ A;  3JVT C;  3BYA A;  1QXP A; 
#chains in the Genus database with same CATH topology
 1S1E A;  3L4L A;  2Y5I A;  1GGW A;  1L2O B;  1XVJ A;  3IVT A;  3CWG A;  1LXF C;  3I5F B;  1KFX S;  1TIZ A;  4MSP A;  1IG5 A;  4FTG A;  5D69 A;  1J7Q A;  1AJ5 A;  1WDC B;  2MAZ A;  2ZND A;  1SR6 B;  4C0K A;  1B9A A;  1N2D A;  1ZMZ A;  1OW4 A;  1XFX O;  2JT0 A;  4U8D A;  1CMG A;  1BOC A;  3DZT A;  1BT6 A;  2LMT A;  4PAL A;  2G2B A;  2JNX A;  1XO5 A;  4IL1 A;  4DRW A;  1NX1 A;  4CFR A;  1JUO A;  2P6B B;  1Z4H A;  1K8U A;  1ZAC A;  5JJG A;  2K61 A;  1KWO B;  4MVF A;  1TWO A;  1DJI A;  2CBL A;  4ZCU A;  1C3Y A;  1K9K A;  2B1U A;  2FOT A;  2HQ8 A;  3OX5 A;  1NX3 A;  3PJI A;  1MXE A;  1QV0 A;  2OTG C;  3VRO A;  5I2Q A;  3L4A A;  1QX7 A;  3DD4 A;  1XFU O;  3OGN A;  4IJ7 A;  4INW A;  1PRW A;  1QAS A;  3O4X A;  4PT1 A;  4YI8 A;  1KWO C;  1IQ5 A;  3KPX A;  4YGB B;  3TS5 B;  3FE9 A;  1T14 A;  3LL8 B;  4C0J A;  4I5N B;  1TN4 A;  2JTT A;  3EK8 A;  4JQ0 D;  3OX6 A;  2M49 B;  2K2A A;  3LK0 A;  2NXQ A;  1HT9 A;  1ALV A;  2MBX A;  2MLF C;  3SS4 A;  1LA0 A;  4JD9 A;  4OKH A;  3TUY C;  2V53 A;  2LLU A;  2M1K B;  2LLS A;  3AKA A;  2LUC A;  3KO0 A;  2BKI B;  2PQL A;  1DJW A;  3PSR A;  3BUN B;  5GQQ C;  5I8N A;  3FE8 A;  2GGM A;  3I5H B;  3I5G B;  1CFD A;  1MF8 B;  4UPG A;  2O60 A;  3DXL A;  3F45 A;  5AER A;  3D76 A;  4AQI A;  1A03 A;  1YRT B;  2OS8 C;  1F55 A;  2HF5 A;  3EVU A;  1DJY A;  4R1E A;  1DVI A;  3SS5 A;  2Y1N A;  1DJX A;  2K7D A;  1CLL A;  5J3X A;  3VRR A;  1AHR A;  1UHK A;  2LP3 A;  1TRF A;  1X02 A;  1XA5 A;  2ZFD A;  1OZS A;  1D1O A;  2COL B;  2CT9 A;  4MBE A;  1SRA A;  1WRL A;  3DVJ A;  1XFW O;  4MRX A;  4AOM A;  3AAK A;  3B7A A;  2HQW A;  2K7C A;  2KHN A;  2L0P A;  2LHL A;  3NHT A;  2A4J A;  3O2P A;  1SMG A;  3NXA A;  1DGV A;  2LVI A;  1K90 D;  1DQE A;  1OOG A;  3WHT B;  3WXA A;  3DVE A;  5KSZ A;  3PLF B;  2LM5 A;  1LIN A;  1CDN A;  4HRE E;  1OOJ A;  1H8B A;  4PHN A;  3AAJ A;  1YX8 A;  4BY5 A;  2L5X B;  2HPS A;  4GGN A;  4XJK A;  3FE6 A;  3TDI A;  1B8C A;  4MRY A;  2LMU A;  3C1V A;  3CR2 A;  3CDN A;  3PN7 B;  4YRU A;  1CNP A;  2LUX A;  2PSR A;  1M31 A;  2KGR A;  2BKH B;  2KI6 D;  1OOH A;  3PM2 A;  1KCY A;  1K96 A;  1MWN A;  2Y4Q A;  4ZCV A;  3SG2 A;  2K2F A;  2G9B A;  2WOR A;  2LVJ A;  2JPT A;  3BFB A;  1RFJ A;  3ZWH A;  2WCF A;  4PE0 A;  2EGD A;  4QJ4 B;  1J55 A;  3H4S E;  1EL4 A;  1ZUZ A;  3VRN A;  4AQJ A;  1FPW A;  1NPQ A;  4I5K A;  4OV2 A;  1Q80 A;  2WCH A;  1TNX A;  2QDI A;  1CDP A;  1B7T Z;  1KK8 B;  1WLM A;  2Y1M A;  4NDD A;  4F7F A;  1U5I A;  2L2C A;  1QVI Z;  4MZL A;  2L4H A;  4I5L B;  2I18 A;  5HLO A;  1OE9 B;  3IQO A;  4N1G A;  3OP0 A;  1WRK A;  4GGF C;  4L9M A;  2MA2 A;  1C3Z A;  1KSM A;  2F2P A;  1IKU A;  5CSJ A;  2KFG A;  3CZ1 A;  4XJK B;  5EL2 A;  3S0G A;  1WY9 A;  1P28 A;  1K94 A;  3CZ2 A;  1F54 A;  2PYQ A;  5I2O A;  4HRG A;  3CR4 X;  1DJG A;  1KK8 C;  3PAL A;  1NCX A;  4PHJ A;  4YGC B;  1EG3 A;  1NYA A;  2KDH A;  1PVB A;  1RRO A;  3CYZ A;  1Z2C B;  1WRZ A;  1ALW A;  1JF2 A;  2LVV A;  2M3W A;  1OMD A;  1UHH A;  1UUR A;  2P71 A;  3S0B A;  1QJT A;  2BCX A;  1Y6W A;  3PAT A;  1AK8 A;  1IGV A;  1A75 B;  3EVV A;  4GUK A;  4JWQ A;  2JU0 A;  1F71 A;  1U5I B;  1Y1A A;  3BUW B;  1B8L A;  1C7W A;  1MQ1 A;  1GGZ A;  5BPJ A;  1XYD A;  5FI6 A;  2M7N A;  4INX A;  1IH0 A;  2ZN9 A;  2KFF A;  5FYX A;  3K1E A;  1DJZ A;  1SK6 D;  1NSH A;  4GPL B;  3JTD C;  4JPZ B;  1SCM C;  1Y1X A;  2KBI A;  4CID A;  1N0Y A;  2R2I A;  1NCY A;  2KSP A;  1KFU S;  3PM8 A;  1SL8 A;  5JOL A;  4JKT A;  5IBW A;  1IQ3 A;  4M2Q A;  1XFY O;  2BBN A;  1QLK A;  2LLT A;  3KHE A;  4GAO A;  1YUU A;  4OZD A;  1FBV A;  2NLN A;  1L2O C;  4TNC A;  2K7O A;  2KBM A;  1OMV A;  3I5F C;  2JOJ A;  3QME A;  1AP4 A;  1FI5 A;  1M63 B;  2OPO A;  1KSO A;  1WDC C;  1B4C A;  1SR6 C;  2LHI A;  2JXL A;  2O5G A;  3DY9 A;  5AEQ A;  4P5O E;  4PDZ A;  4A4C A;  2WC5 A;  1N65 A;  3DVK A;  2BCA A;  3NSK A;  3R72 A;  1DMO A;  3V2L A;  1UUS A;  4BY4 A;  1C7V A;  1XK4 C;  3KF9 A;  1JWD A;  1J1E A;  1DT7 B;  1A2X A;  1BR4 B;  3LCP C;  1QVI Y;  1R6P A;  2WCM A;  3SS3 A;  2AUC A;  3D0Y A;  1K9P A;  3FWB A;  3CR5 X;  4D1E A;  2WCK A;  1CLB A;  2SAS A;  4Q04 A;  1KFX L;  1PSR A;  1PAL A;  2LE9 B;  4YBH B;  2ZRT A;  2QEO A;  3BJH A;  3Q8I A;  1CDM A;  3BUX B;  4YGA A;  2FJU B;  1QX5 B;  1TCF A;  3R1V A;  1BMO A;  1S5G Y;  3RLZ A;  1MUX A;  2M29 A;  3S0A A;  2ISD A;  3TS5 C;  1S3P A;  1CB1 A;  1KK7 Z;  1G8I A;  1TNQ A;  2L98 A;  1SL9 A;  1PSB A;  5AXI A;  1NX2 A;  5D7F A;  3A4U B;  3ZNI A;  1QS7 A;  1DC1 A;  1CKK A;  1K2H A;  1LVC D;  2JQ6 A;  2KI4 B;  5ER5 A;  1B8R A;  3BOW A;  2I2R E;  2KQY A;  5HL1 A;  4ICB A;  1RWY A;  1ODB A;  2WC8 A;  3D0Y B;  5HKZ A;  1CFF A;  1UWO A;  2CCM A;  2ZNE A;  4CLN A;  1ZFS A;  2QPT A;  1UP5 A;  3RM1 A;  2PAL A;  3I5H C;  1TOP A;  2L2E A;  3I5G C;  4GFT A;  1KQM B;  1J7P A;  2QEB A;  1IIO A;  2H8V A;  4N1F A;  2RGI A;  1NUB A;  2Q4U A;  4MN0 A;  5DKN A;  1NX0 A;  2BCB A;  5K89 A;  2AMI A;  3NSI A;  3VB1 A;  2H61 A;  2F33 A;  2HET A;  5D3O A;  2CXJ A;  2VRG A;  2LAN A;  3K21 A;  3BUM B;  1JFK A;  1GQM A;  2BBM A;  2LP2 A;  1KQM C;  2GV5 A;  2QAC A;  3SG6 A;  1J7R A;  3D78 A;  4HSZ A;  2JUL A;  1J7O A;  3BFH A;  4A4B A;  2H2K A;  4DUQ A;  1EJ3 A;  2WND A;  3BOW B;  5TNC A;  1J1D A;  2YGU A;  1SY9 A;  1AUI B;  1M39 A;  1KQV A;  2ZRS A;  3SG4 A;  2KQ6 A;  2QEH A;  2BL0 B;  1YTZ C;  3SJS A;  5DIC A;  3S0D A;  1CM4 A;  1CDL A;  1XFR A;  3CGA A;  3PN7 C;  2K60 A;  1HQV A;  1PVA A;  1RK9 A;  3BXK A;  1EG4 A;  4NDC A;  1GJY A;  3O4Y A;  3N7H A;  2LC5 A;  2L4I A;  2MHH A;  1WLZ A;  2ZKM X;  1CFP A;  1MHO A;  2I7A A;  3FIA A;  3TZ1 A;  1G33 A;  1SCV A;  2D8N A;  1W7I B;  2JPO A;  2KPH A;  3WHU B;  1QWV A;  2L5Y A;  2M97 A;  3E3R A;  3I5I B;  2L51 A;  4MZK A;  2F3Z A;  4WRI A;  1OSA A;  4YGE B;  1G4Y R;  2F3Y A;  2BAP A;  5G08 A;  3B88 A;  2DOQ A;  2KI6 C;  2K8M B;  1K95 A;  2Q91 A;  4OR9 B;  4DCK A;  2WCB A;  1R2U A;  1B47 A;  1NP8 A;  1PK0 D;  5FI2 A;  1V1G A;  3HX4 A;  1F8H A;  1IJ6 A;  1DJH A;  2BEC A;  2FJY A;  3IQQ A;  4PHK A;  2BE4 A;  2GTE A;  3S0E A;  1GM0 A;  2MLE C;  1W9Z A;  3VRP A;  2NZ0 A;  5CSF A;  1FF1 A;  1UHJ A;  4ETO A;  1Y0V H;  2LAP A;  1JC2 A;  1EXR A;  1JBA A;  4E68 A;  2WCL A;  4QJ5 B;  1A29 A;  1IRJ A;  1SSE B;  1UHI A;  1YRU B;  5DKR A;  1OQP A;  2WCJ A;  2KAV A;  3SG5 A;  1S6I A;  3DVM A;  3CLN A;  3R1O A;  1YUT A;  4MEW A;  1DGU A;  2ERB A;  2BE6 A;  3M0W A;  2F8P A;  2JT8 A;  1AJ4 A;  4OVN F;  4N5X A;  2JT3 A;  3ICB A;  4WQ2 A;  5KTY A;  1CFC A;  2KYC A;  3GK2 A;  2KFH A;  2F2O A;  4MZJ A;  1SNL A;  5CSN A;  1W7J B;  1CLM A;  1MXL C;  3PFV A;  1OOI X;  2I94 A;  2LVK A;  2NCO A;  4MLW A;  1RJV A;  4NDB A;  4C0L A;  4PE1 A;  1SYM A;  1QLS A;  4WQ3 A;  3SIB A;  1B7T Y;  3L47 A;  4F0Z B;  3D74 A;  4QJ3 B;  3VRQ A;  3BUO B;  2IS9 A;  2NCP A;  2E30 A;  4KYN A;  3IF7 A;  3SG7 A;  1OZO A;  2M9G A;  3NSL A;  5I2L A;  1BJF A;  1UHN A;  3MSE B;  3HCM A;  3OHM B;  2OTG B;  4CPV A;  1M46 A;  3VGO A;  4DS7 A;  2KAX A;  4M2O A;  1BOD A;  1OMR A;  3D73 A;  2FCD A;  2WCE A;  1KFU L;  1RTP 1;  4NQG A;  1YR5 A;  3NHI A;  5CSI A;  2L50 A;  3EK7 A;  2WOS A;  2JXC A;  3SIA A;  1DTL A;  2JWW A;  2JNF A;  3TUY B;  3GK1 A;  3D75 A;  2ZN8 A;  3AKB A;  5FI7 A;  3RZS A;  5CPV A;  1JF0 A;  3NSO A;  3GK4 X;  2MRD A;  1BR1 B;  1REC A;  3O78 A;  1YVH A;  2OS8 B;  2QEV A;  2LNK A;  3CZ0 A;  5ER4 X;  3A8R A;  1QAT A;  1K9U A;  3EKJ A;  3CTN A;  3QRX A;  4PE7 A;  2P70 A;  2M7L A;  1SPY A;  3CS1 A;  1S6J A;  2PAS A;  1YUR A;  3EVR A;  1XFV O;  2FCE A;  2CNP A;  1YX7 A;  3DF0 A;  1IJ5 A;  2M1U A;  5HKY A;  4PHM A;  2AAO A;  1BG1 A;  2KAY A;  2KI4 C;  3S0F A;  4FQO A;  1QIW A;  2JTZ A;  1TTX A;  2TN4 A;  3D10 A;  3LK1 A;  4PCW A;  1CMF A;  3BQ3 A;  3CAB A;  1YVL A;  3GOF A;  2K0J A;  3EK4 A;  4DIR A;  1Y1U A;  2PMY A;  3KEV A;  1M45 A;  5AFP A;  2KYF A;  1XFZ O;  4GGF A;  1DF0 A;  3FS7 A;  1YUS A;  3CZT X;  5KU1 A;  4ORB B;  4YGD B;  1CTR A;  2LMV A;  1NCZ A;  4ORA B;  1FW4 A;  2JZI A;  4HRH A;  1F70 A;  1L7Z A;  3OBV A;  5HLV A;  3DF0 B;  1NWD A;  1FI6 A;  1AVS A;  5B8I B;  2BNX A;  1S6C A;  3DYE A;  3UO9 A;  1S36 A;  2M8U A;  1TUZ A;  4P2Y B;  2MJW B;  5HYD A;  4GBA A;  1PUL A;  3UNW A;  1F4Q A;  1F4O A;  3B6X A;  5I94 A;  1JSA A;  1MR8 A;  4FQT A;  2BL0 C;  2KNE A;  2CTN A;  4USL A;  1SKT A;  1A4P A;  2JC2 A;  5HKW A;  3TDU A;  3TDZ A;  1SW8 A;  1H4B A;  3FWC A;  1KK7 Y;  2GGZ A;  1QTX A;  1DF0 B;  3NGV A;  1ZOT B;  1TNW A;  2EHB A;  2WC6 A;  1NIW A;  2KLE A;  1LA3 A;  5DKQ A;  1V1F A;  3B87 A;  3O6B A;  5AAN A;  2H61 C;  1TUJ A;  1B1G A;  1A75 A;  4GNK B;  1EH2 A;  1TNP A;  2PRU A;  2SCP A;  3D77 A;  2KLD A;  3EG5 B;  2E6W A;  3B86 A;  1BU3 A;  2PVB A;  1BF5 A;  1DEL A;  2EC6 B;  5F6T A;  1ORG A;  3I5I C;  4ORC B;  3WNX B;  1TCO B;  1SBJ A;  2M0R A;  1IWQ A;  2KGB C;  3LLE A;  1SL7 A;  4M2P A;  3JVT B;  2K7B A;  1JFJ A;  1QV1 A;  1S26 D;  1XK4 A;  1S5G Z;  1OOF A;  2JRF A;  1C07 A;  5PAL A;  1LKJ A;  4OCI A;  4CFQ A;  1E8A A;  1K93 D;  2EC6 C;  2LV7 A;  4PE4 A;  4XYN A;  3OB1 B;  1QIV A;  4YI9 A;  3SG3 A;  1CM1 A;  2KOT A;  3EKH A;  1VRK A;  3JTD B;  1SCM B;  2LCP A;  3R1P A;  4I5J A;  3OB2 B;  1QX2 A;  3BFA A;  1DEK A;  1BLQ A;  3JVT C;  3BYA A;  1QXP A;  1LS8 A; 
#chains in the Genus database with same CATH homology
 1S1E A;  1GGW A;  2Y5I A;  1L2O B;  1XVJ A;  3CWG A;  1LXF C;  3I5F B;  1KFX S;  1TIZ A;  4MSP A;  1IG5 A;  4FTG A;  5D69 A;  1J7Q A;  1AJ5 A;  1WDC B;  2MAZ A;  2ZND A;  1SR6 B;  4C0K A;  1B9A A;  1N2D A;  1ZMZ A;  1XFX O;  2JT0 A;  4U8D A;  1CMG A;  1BOC A;  1BT6 A;  2LMT A;  4PAL A;  2G2B A;  2JNX A;  1XO5 A;  4IL1 A;  4DRW A;  1NX1 A;  4CFR A;  1JUO A;  2P6B B;  1K8U A;  1ZAC A;  5JJG A;  2K61 A;  1KWO B;  4MVF A;  1DJI A;  2CBL A;  4ZCU A;  1K9K A;  2B1U A;  2FOT A;  2HQ8 A;  3OX5 A;  1NX3 A;  1MXE A;  1QV0 A;  2OTG C;  3VRO A;  5I2Q A;  1QX7 A;  3DD4 A;  1XFU O;  1PRW A;  1QAS A;  4YGB B;  4YI8 A;  1KWO C;  1IQ5 A;  3KPX A;  3TS5 B;  3LL8 B;  4C0J A;  4I5N B;  1TN4 A;  2JTT A;  3EK8 A;  4JQ0 D;  3OX6 A;  2M49 B;  2K2A A;  3LK0 A;  2NXQ A;  1HT9 A;  1ALV A;  2MBX A;  2MLF C;  1LA0 A;  4OKH A;  3TUY C;  2V53 A;  2LLU A;  2M1K B;  2LLS A;  3AKA A;  2LUC A;  3KO0 A;  2BKI B;  1DJW A;  3PSR A;  3BUN B;  5GQQ C;  5I8N A;  2GGM A;  3I5H B;  3I5G B;  1CFD A;  1MF8 B;  4UPG A;  2O60 A;  3F45 A;  5AER A;  4AQI A;  1A03 A;  1YRT B;  2OS8 C;  1F55 A;  2HF5 A;  3EVU A;  1DJY A;  4R1E A;  1DVI A;  2Y1N A;  1DJX A;  2K7D A;  1CLL A;  5J3X A;  3VRR A;  1AHR A;  1UHK A;  2LP3 A;  1TRF A;  1X02 A;  1XA5 A;  2ZFD A;  1OZS A;  1D1O A;  2COL B;  2CT9 A;  4MBE A;  1SRA A;  1WRL A;  3DVJ A;  1XFW O;  4MRX A;  4AOM A;  3AAK A;  2HQW A;  2K7C A;  2KHN A;  2L0P A;  2LHL A;  2A4J A;  3O2P A;  1SMG A;  3NXA A;  1DGV A;  2LVI A;  1K90 D;  3WHT B;  3WXA A;  3DVE A;  5KSZ A;  3PLF B;  2LM5 A;  1LIN A;  1CDN A;  4HRE E;  1OOJ A;  1H8B A;  4PHN A;  3AAJ A;  1YX8 A;  4BY5 A;  2L5X B;  2HPS A;  4GGN A;  4XJK A;  3TDI A;  1B8C A;  4MRY A;  2LMU A;  3C1V A;  3CR2 A;  3PN7 B;  4YRU A;  1CNP A;  2LUX A;  2PSR A;  1M31 A;  2KGR A;  2BKH B;  2KI6 D;  1KCY A;  1K96 A;  1MWN A;  2Y4Q A;  4ZCV A;  3SG2 A;  2K2F A;  2G9B A;  2WOR A;  2LVJ A;  2JPT A;  1RFJ A;  3ZWH A;  2WCF A;  4PE0 A;  2EGD A;  4QJ4 B;  1J55 A;  3H4S E;  1EL4 A;  1ZUZ A;  3VRN A;  4AQJ A;  1FPW A;  1NPQ A;  4I5K A;  4OV2 A;  1Q80 A;  1TNX A;  1CDP A;  1B7T Z;  1KK8 B;  1WLM A;  2Y1M A;  4NDD A;  1U5I A;  4MZL A;  1QVI Z;  2L4H A;  4I5L B;  2I18 A;  5HLO A;  1OE9 B;  3IQO A;  4N1G A;  3OP0 A;  1WRK A;  4GGF C;  4L9M A;  2MA2 A;  1KSM A;  2F2P A;  1IKU A;  5CSJ A;  2KFG A;  4XJK B;  1WY9 A;  1K94 A;  1F54 A;  5I2O A;  4HRG A;  3CR4 X;  1DJG A;  1KK8 C;  3PAL A;  1NCX A;  4PHJ A;  4YGC B;  1EG3 A;  1NYA A;  2KDH A;  1PVB A;  1RRO A;  1WRZ A;  1ALW A;  1JF2 A;  2LVV A;  2M3W A;  1OMD A;  1UHH A;  1UUR A;  1QJT A;  2BCX A;  1Y6W A;  3PAT A;  1AK8 A;  1IGV A;  1A75 B;  3EVV A;  4GUK A;  4JWQ A;  2JU0 A;  1F71 A;  1U5I B;  1Y1A A;  3BUW B;  1B8L A;  1C7W A;  1MQ1 A;  1GGZ A;  5BPJ A;  1XYD A;  1IH0 A;  2M7N A;  2ZN9 A;  2KFF A;  5FYX A;  1DJZ A;  1SK6 D;  1NSH A;  4GPL B;  3JTD C;  4JPZ B;  1SCM C;  1Y1X A;  2KBI A;  4CID A;  1N0Y A;  2R2I A;  1NCY A;  2KSP A;  1KFU S;  3PM8 A;  1SL8 A;  5JOL A;  5IBW A;  1IQ3 A;  4M2Q A;  1XFY O;  2BBN A;  1QLK A;  2LLT A;  3KHE A;  4GAO A;  1YUU A;  1FBV A;  2NLN A;  1L2O C;  4TNC A;  2K7O A;  2KBM A;  1OMV A;  3I5F C;  2JOJ A;  1AP4 A;  1FI5 A;  1M63 B;  2OPO A;  1KSO A;  1WDC C;  1B4C A;  1SR6 C;  2LHI A;  2JXL A;  2O5G A;  4A4C A;  5AEQ A;  4P5O E;  4PDZ A;  1DMO A;  1JBA A;  1N65 A;  3DVK A;  2BCA A;  3NSK A;  1JWD A;  4BY4 A;  1UUS A;  1C7V A;  1XK4 C;  3KF9 A;  1J1E A;  1DT7 B;  1A2X A;  1BR4 B;  3LCP C;  1QVI Y;  1R6P A;  2AUC A;  3D0Y A;  1K9P A;  3FWB A;  3CR5 X;  4D1E A;  1CLB A;  2SAS A;  4Q04 A;  1KFX L;  1PSR A;  1PAL A;  2LE9 B;  4YBH B;  2ZRT A;  1CDM A;  3BUX B;  4YGA A;  2FJU B;  1QX5 B;  1TCF A;  1BMO A;  1S5G Y;  3RLZ A;  1MUX A;  2M29 A;  2ISD A;  3TS5 C;  1S3P A;  1CB1 A;  1KK7 Z;  1G8I A;  1TNQ A;  2L98 A;  1SL9 A;  1PSB A;  5AXI A;  1NX2 A;  5D7F A;  3A4U B;  3ZNI A;  1QS7 A;  1CKK A;  1K2H A;  1LVC D;  2JQ6 A;  2KI4 B;  5ER5 A;  1B8R A;  3BOW A;  2I2R E;  2KQY A;  4ICB A;  1RWY A;  1ODB A;  2WC8 A;  3D0Y B;  5HKZ A;  1CFF A;  1UWO A;  2CCM A;  2ZNE A;  4CLN A;  1ZFS A;  2QPT A;  1UP5 A;  3RM1 A;  2PAL A;  3I5H C;  1TOP A;  2L2E A;  3I5G C;  4GFT A;  1KQM B;  1J7P A;  4N1F A;  2RGI A;  1NUB A;  2Q4U A;  4MN0 A;  5DKN A;  1NX0 A;  2BCB A;  5K89 A;  2AMI A;  3NSI A;  2H61 A;  2F33 A;  2HET A;  2CXJ A;  2VRG A;  2LAN A;  3K21 A;  3BUM B;  1JFK A;  1GQM A;  2BBM A;  2LP2 A;  1KQM C;  2GV5 A;  2QAC A;  3SG6 A;  1J7R A;  4HSZ A;  2JUL A;  1J7O A;  4A4B A;  4DUQ A;  2H2K A;  1EJ3 A;  2WND A;  3BOW B;  5TNC A;  1J1D A;  1SY9 A;  1AUI B;  1M39 A;  1KQV A;  2ZRS A;  3SG4 A;  2KQ6 A;  2BL0 B;  1YTZ C;  3SJS A;  1CM4 A;  1CDL A;  3CGA A;  3PN7 C;  3BXK A;  1HQV A;  1PVA A;  1RK9 A;  1EG4 A;  4NDC A;  1GJY A;  3O4Y A;  2LC5 A;  2L4I A;  2MHH A;  1WLZ A;  2ZKM X;  1CFP A;  1MHO A;  2I7A A;  3FIA A;  3TZ1 A;  1G33 A;  1SCV A;  2D8N A;  1W7I B;  3WHU B;  2M97 A;  3E3R A;  3I5I B;  2L51 A;  4MZK A;  2F3Z A;  4WRI A;  1OSA A;  4YGE B;  1G4Y R;  2F3Y A;  5G08 A;  2DOQ A;  2KI6 C;  2K8M B;  1K95 A;  2Q91 A;  4OR9 B;  4DCK A;  2WCB A;  1R2U A;  1B47 A;  1NP8 A;  1PK0 D;  1V1G A;  3HX4 A;  1F8H A;  1IJ6 A;  1DJH A;  2BEC A;  3IQQ A;  4PHK A;  2BE4 A;  2MLE C;  3VRP A;  2NZ0 A;  5CSF A;  1FF1 A;  1UHJ A;  4ETO A;  1Y0V H;  2LAP A;  1JC2 A;  1EXR A;  4E68 A;  4QJ5 B;  1A29 A;  1IRJ A;  1UHI A;  1YRU B;  5DKR A;  1OQP A;  3SG5 A;  2KAV A;  1S6I A;  3DVM A;  3CLN A;  1YUT A;  4MEW A;  1DGU A;  2BE6 A;  3M0W A;  2F8P A;  2JT8 A;  1AJ4 A;  4OVN F;  4N5X A;  2JT3 A;  3ICB A;  4WQ2 A;  5KTY A;  1CFC A;  2KYC A;  3GK2 A;  2KFH A;  2F2O A;  4MZJ A;  1SNL A;  5CSN A;  1W7J B;  1CLM A;  1MXL C;  3PFV A;  2I94 A;  2LVK A;  2NCO A;  4MLW A;  1RJV A;  4NDB A;  4C0L A;  4PE1 A;  1SYM A;  1QLS A;  4WQ3 A;  3SIB A;  1B7T Y;  4F0Z B;  4QJ3 B;  3VRQ A;  3BUO B;  2IS9 A;  2NCP A;  2E30 A;  3IF7 A;  3SG7 A;  1OZO A;  2M9G A;  3NSL A;  5I2L A;  1BJF A;  1UHN A;  3MSE B;  3HCM A;  3OHM B;  2OTG B;  4CPV A;  1M46 A;  3VGO A;  4DS7 A;  2KAX A;  4M2O A;  1BOD A;  1OMR A;  2FCD A;  2WCE A;  1KFU L;  1RTP 1;  4NQG A;  1YR5 A;  5CSI A;  2L50 A;  3EK7 A;  2WOS A;  2JXC A;  3SIA A;  1DTL A;  2JWW A;  2JNF A;  3TUY B;  3GK1 A;  2ZN8 A;  3AKB A;  5CPV A;  1JF0 A;  3NSO A;  3GK4 X;  2MRD A;  1BR1 B;  1REC A;  3O78 A;  1YVH A;  2OS8 B;  5ER4 X;  2LNK A;  3A8R A;  1QAT A;  1K9U A;  3EKJ A;  3CTN A;  3QRX A;  4PE7 A;  2M7L A;  1SPY A;  3CS1 A;  1S6J A;  2PAS A;  1YUR A;  3EVR A;  1XFV O;  2FCE A;  2CNP A;  1YX7 A;  3DF0 A;  1IJ5 A;  2M1U A;  5HKY A;  4PHM A;  2AAO A;  1BG1 A;  2KAY A;  2KI4 C;  4FQO A;  1QIW A;  2JTZ A;  1TTX A;  2TN4 A;  3D10 A;  3LK1 A;  4PCW A;  1CMF A;  3BQ3 A;  1YVL A;  3GOF A;  2K0J A;  3EK4 A;  4DIR A;  1Y1U A;  2PMY A;  3KEV A;  1M45 A;  5AFP A;  2KYF A;  1XFZ O;  4GGF A;  1DF0 A;  3FS7 A;  1YUS A;  3CZT X;  5KU1 A;  4ORB B;  4YGD B;  1CTR A;  2LMV A;  1NCZ A;  4ORA B;  1FW4 A;  2JZI A;  4HRH A;  1F70 A;  1L7Z A;  5HLV A;  3DF0 B;  1NWD A;  1FI6 A;  1AVS A;  5B8I B;  1S6C A;  1S36 A;  2M8U A;  4P2Y B;  2MJW B;  5HYD A;  4GBA A;  1PUL A;  1F4Q A;  1F4O A;  1JSA A;  1MR8 A;  2BL0 C;  2KNE A;  2CTN A;  4USL A;  1SKT A;  1A4P A;  2JC2 A;  5HKW A;  3TDU A;  3TDZ A;  1SW8 A;  1H4B A;  3FWC A;  1KK7 Y;  2GGZ A;  1QTX A;  1DF0 B;  1ZOT B;  1TNW A;  2EHB A;  1NIW A;  1LA3 A;  5DKQ A;  1V1F A;  3O6B A;  5AAN A;  2H61 C;  1B1G A;  1A75 A;  4GNK B;  1EH2 A;  1TNP A;  2PRU A;  2SCP A;  2E6W A;  1BU3 A;  2PVB A;  1BF5 A;  2EC6 B;  5F6T A;  3I5I C;  3WNX B;  4ORC B;  1TCO B;  1SBJ A;  2M0R A;  1IWQ A;  2KGB C;  3LLE A;  1SL7 A;  4M2P A;  3JVT B;  2K7B A;  1JFJ A;  1QV1 A;  1S26 D;  1XK4 A;  1S5G Z;  2JRF A;  1C07 A;  5PAL A;  1LKJ A;  4OCI A;  4CFQ A;  1E8A A;  1K93 D;  2EC6 C;  2LV7 A;  4PE4 A;  4XYN A;  3OB1 B;  1QIV A;  4YI9 A;  3SG3 A;  1CM1 A;  2KOT A;  3EKH A;  1VRK A;  3JTD B;  1SCM B;  2LCP A;  4I5J A;  3OB2 B;  1QX2 A;  1BLQ A;  3JVT C;  3BYA A;  1QXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...