2ZNDA

Crystal structure of ca2+-free form of des3-20alg-2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
167
structure length
167
Chain Sequence
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Programmed cell death protein 6
publication title Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13202 EF-hand_5 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2zndA00
2HF5A 4NDCA 1XFYO 4GFTA 1A75B 1DGVA 1NX3A 1QV0A 3CR4X 2LANA 4YI8A 2JRFA 1RWYA 1UUSA 4I5KA 1YX8A 3NSOA 1UP5A 1RECA 2AUCA 2KGRA 3NSLA 5CPVA 1CMGA 2CTNA 2ZNEA 1SNLA 1FF1A 1RJVA 2KDHA 4UPGA 2K8MB 4NDBA 3AAJA 4XJKA 3VROA 1XFUO 3VGOA 5HKWA 4Q04A 1J7RA 2MRDA 3I5IC 1IH0A 3DF0A 4C0KA 1LKJA 4XYNA 2AMIA 1DJWA 2MLFC 1CMFA 1IWQA 2E30A 1XK4A 2WCBA 4DCKA 5AANA 1YUSA 2WC8A 4AQJA 2F2PA 1KK7Y 1YUUA 1IQ5A 1UHKA 3VRRA 2DOQA 1S5GY 2LVIA 1JC2A 2K7DA 3O2PA 2G9BA 2MBXA 1ZMZA 2KI4B 2JZIA 2MAZA 3DVJA 4MN0A 3A4UB 4OKHA 3RLZA 1MXEA 1F4OA 2BE6A 2M97A 1QJTA 1K96A 2F33A 1PVAA 2FOTA 4MZLA 3OB2B 4M2OA 5HLVA 1GJYA 1J7QA 2MJWB 5CSJA 1CDMA 1F55A 1KFUS 1S6JA 1C7VA 2AAOA 1J1EA 3IF7A 2NXQA 1OOJA 2NCOA 3LLEA 3PATA 2KNEA 2HQ8A 3DVEA 3FWBA 4GBAA 4M2QA 1YX7A 1UURA 2LMTA 1UHIA 4IL1A 4MVFA 4GAOA 3GK2A 4YGCB 1XFWO 1BG1A 2BCXA 2M29A 2CBLA 1CDNA 1B9AA 1A29A 4YI9A 2O5GA 1L7ZA 5KU1A 3AKAA 3F45A 2KAVA 2Y1NA 1KSOA 1YRTB 3CR5X 1FPWA 2ZKMX 1B4CA 1TTXA 1OMRA 2IS9A 1S6IA 3TDIA 1GQMA 1R6PA 2OTGB 1QATA 3FS7A 3SG4A 5KTYA 2LUXA 3H4SE 2LVVA 2Q4UA 1XO5A 5K89A 1YRUB 2KI4C 4GGFA 2LMVA 2PMYA 4DIRA 2JQ6A 1LXFC 1K95A 4F0ZB 3SG2A 3PM8A 1K9UA 1TOPA 2G2BA 1S3PA 4ORBB 1B7TZ 5HKZA 1SCVA 2MLEC 1DJZA 1IQ3A 2KFHA 3MSEB 4I5LB 3ZWHA 3IQQA 3I5HB 4I5JA 4QJ3B 1KQVA 2L4HA 1B8RA 1M31A 2LM5A 2COLB 1DJXA 1PVBA 1AUIB 1BR1B 1IGVA 2M0RA 3PN7B 2I2RE 2I94A 3LCPC 3TS5C 5PALA 4MRXA 1DF0B 2JTTA 2MHHA 5ER5A 5AERA 2LLTA 3DD4A 4PHJA 3EK4A 1CLLA 3CS1A 2OS8C 2PASA 3SG5A 1KCYA 1PK0D 4PE1A 1J7PA 1SYMA 2L50A 2WCFA 2LNKA 3OHMB 1NCYA 3PSRA 1ALVA 2Q91A 4FQOA 1BU3A 3CGAA 1VRKA 1BF5A 1R2UA 3FWCA 2P6BB 5HYDA 1BJFA 2WNDA 3I5GB 1B1GA 4CLNA 2JT3A 4I5NB 5AEQA 1EH2A 1F4QA 1FW4A 1IJ5A 5KSZA 2OTGC 1S36A 1AHRA 3D0YB 4QJ5B 1B47A 1AK8A 1DGUA 1NX1A 1JFJA 3BOWB 4CIDA 2L51A 1EL4A 1QXPA 1K9KA 5DKNA 3SJSA 2L0PA 4PCWA 1BR4B 5D7FA 3KF9A 4A4CA 5JOLA 1XFXO 2M8UA 3BQ3A 3I5HC 3BUXB 1G4YR 2EGDA 1K94A 3TDUA 2KI6C 1QX5B 1JWDA 2BCAA 2ZN8A 2K61A 4P5OE 1WY9A 3I5FB 3VRNA 4PE0A 3BUNB 4WQ3A 1UHJA 5F6TA 2BE4A 3PN7C 3WNXB 1IG5A 1QS7A 2H61A 4BY5A 1LA0A 4TNCA 4MZJA 2LHLA 1BT6A 3ICBA 5IBWA 1B7TY 1CDLA 3EK8A 3AAKA 3DVKA 4WRIA 2KSPA 1TNXA 3SG6A 1SL7A 2HQWA 4XJKB 1QX7A 5I2OA 4ETOA 1K9PA 4DUQA 1U5IA 1QIVA 4AOMA 4JPZB 3DF0B 3NXAA 2ZRTA 4L9MA 2JNFA 3PFVA 3RM1A 2M1UA 2LP3A 1KFXL 1DJHA 4ORAB 1S1EA 1CLMA 1BODA 3I5GC 1Y6WA 3WHUB 2A4JA 2BBNA 1YURA 2NLNA 2EHBA 2ZFDA 2Y1MA 1ODBA 1PALA 1CKKA 1LA3A 3SIBA 2BBMA 2KBMA 1JSAA 2KOTA 1JF2A 2K2FA 1TIZA 2H2KA 1Y0VH 1JBAA 1Y1UA 2F2OA 3SG7A 1NCZA 1OE9B 4YRUA 2EC6B 2LCPA 2K7OA 4N5XA 1U5IB 1XFVO 2B1UA 1ZUZA 2LLSA 3E3RA 3LL8B 1WLZA 2KI6D 4HRGA 4AQIA 2FCEA 1SRAA 1MQ1A 1TNPA 2M49B 4DRWA 1CFPA 4ICBA 4WQ2A 5CSFA 3KPXA 1DJGA 1NPQA 3O78A 1N2DA 3I5FC 1N0YA 1QIWA 2HPSA 2LV7A 3D10A 1OMVA 1CDPA 1DJYA 2CNPA 2K2AA 4PDZA 1K90D 1CNPA 1NSHA 2CCMA 1DTLA 4ORCB 2CXJA 1AJ5A 1BOCA 1NX0A 3QRXA 2NCPA 3M0WA 1YR5A 5D69A 1WRKA 3BUOB 4MRYA 1MHOA 1W7IB 2K7BA 2WCEA 3GK4X 3JTDB 4MEWA 1F54A 4PE4A 4PE7A 4OR9B 1DMOA 1XK4C 1C07A 5DKQA 2CT9A 2JXLA 1SL9A 1XVJA 2JWWA 4JQ0D 2M7LA 1OZOA 1UHHA 4QJ4B 1CB1A 2LLUA 1H4BA 2V53A 1RTP1 4USLA 5HKYA 2KQYA 1CM4A 1FI6A 2F8PA 1CTRA 1TNWA 1WDCB 4YGDB 3K21A 1Y1XA 2KAYA 1SW8A 2EC6C 4MBEA 3WHTB 3SIAA 1SKTA 3EKJA 1UHNA 4A4BA 1S5GZ 1TNQA 2LUCA 2PRUA 5I2LA 1BLQA 2LE9B 1CFFA 5ER4X 3EK7A 4MZKA 1B8LA 1ALWA 3DVMA 2LVJA 1PRWA 5CSNA 4YGEB 5I2QA 1M46A 4OV2A 1F8HA 1OQPA 3NSKA 2PALA 1GGZA 2BKHB 3AKBA 4YBHB 2RGIA 1RK9A 5DKRA 2E6WA 3CWGA 1ZACA 1L2OB 1ZOTB 2JU0A 3SG3A 1TRFA 2ZNDA 1RROA 2LAPA 1QLKA 1JF0A 3CTNA 1AVSA 1OSAA 5G08A 2KYFA 1KFXS 1YVLA 1A03A 3GK1A 3JTDC 1XYDA 2L2EA 2BKIB 2BL0B 3KHEA 2Y4QA 1MXLC 1NYAA 2KYCA 5FYXA 2JULA 1X02A 2I18A 1JUOA 1SCMB 1NP8A 1WDCC 2ISDA 1EG4A 3TUYB 1CM1A 2L5XB 4GGFC 2M7NA 2QPTA 1A2XA 2TN4A 4NQGA 2WOSA 1HT9A 2R2IA 3CLNA 4HREE 2M1KB 2F3YA 2K0JA 2BECA 3EVRA 1W7JB 1N65A 4GNKB 5BPJA 2ZN9A 1M45A 2L4IA 1PSRA 4HRHA 1CLBA 2I7AA 1Q80A 3PLFB 3BUWB 1EG3A 2Y5IA 1KSMA 1S6CA 1KK8B 1WRLA 1JFKA 1IJ6A 1M39A 1SR6B 2D8NA 1SBJA 2KQ6A 2KFGA 3FIAA 3NSIA 4CPVA 1KQMB 3KEVA 1WLMA 2OPOA 4GGNA 1GGWA 1OZSA 3KO0A 1L2OC 1NCXA 4C0LA 4FTGA 4U8DA 3LK1A 2HETA 1QVIZ 1M63B 1OMDA 4PHNA 2PSRA 1E8AA 4DS7A 5JJGA 1MF8B 3OB1B 1QLSA 4YGBB 2LVKA 2K7CA 2LP2A 1RFJA 1PULA 2JOJA 1C7WA 1V1GA 1FBVA 1TCOB 4CFRA 2JXCA 2GGMA 1DVIA 2BL0C 2JPTA 2O60A 4PALA 1EXRA 2QACA 5J3XA 1UWOA 1QV1A 1XA5A 3BXKA 3EKHA 3OX5A 1SL8A 1LVCD 2L98A 2FCDA 2NZ0A 3JVTB 3TS5B 1NWDA 5AFPA 1SCMC 1SPYA 3HX4A 1QASA 2GV5A 1K8UA 3TUYC 1V1FA 1XFZO 1ZFSA 2F3ZA 1YUTA 2M9GA 2VRGA 2KBIA 3EVVA 3IQOA 1AP4A 4YGAA 5TNCA 4HSZA 2OS8B 2LMUA 3LK0A 4NDDA 3WXAA 1DT7B 1KWOB 1AJ4A 1EJ3A 1YTZC 2PVBA 1IRJA 1NX2A 1J55A 4D1EA 1SR6C 3BYAA 1KK8C 1SK6D 4ZCVA 3TZ1A 2M3WA 4OCIA 3VRPA 3O6BA 1NIWA 1KQMC 2JTZA 3CZTX 1MWNA 4GUKA 4MLWA 2JNXA 4P2YB 3EVUA 1CFCA 2KAXA 1QX2A 3C1VA 2H61C 5I8NA 1TN4A 1K93D 1MUXA 1K2HA 1A4PA 1B8CA 2WORA 1KFUL 1FI5A 2SASA 4JWQA 4MSPA 1DF0A 4ZCUA 1SY9A 4N1FA 1KK7Z 4M2PA 3ZNIA 5B8IB 1CFDA 5GQQC 1J7OA 4R1EA 1SMGA 3PALA 3GOFA 3O4YA 1IKUA 2SCPA 2ZRSA 3I5IB 4BY4A 1YVHA 3TDZA 1TCFA 2JT8A 3BUMB 1QVIY 1H8BA 1MR8A 4OVNF 2JC2A 1DJIA 1Y1AA 4GPLB 4N1GA 2JT0A 4E68A 1LINA 1PSBA 3JVTC 1A75A 1NUBA 2KHNA 3OP0A 2GGZA 5HLOA 2LC5A 4PHMA 2FJUB 3D0YA 1G33A 2LHIA 2BCBA 1WRZA 2KFFA 1S26D 3A8RA 3OX6A 5CSIA 4PHKA 1QTXA 2MA2A 3VRQA 4CFQA 1KWOC 1HQVA 3BOWA 3CR2A 1J1DA 4C0JA 1F70A 2KGBC 1BMOA 1G8IA 5AXIA 1F71A 1D1OA 3HCMA
chains in the Genus database with same CATH superfamily
2HF5A 4NDCA 1XFYO 4GFTA 1A75B 1DGVA 1NX3A 1QV0A 3CR4X 3Q8IA 2LANA 4YI8A 2WCLA 2JRFA 1RWYA 1T14A 1UUSA 4I5KA 1YX8A 3NSOA 1UP5A 4F7FA 1RECA 2AUCA 2KGRA 3NSLA 5CPVA 1CMGA 2CTNA 2ZNEA 1SNLA 1FF1A 1OOFA 3B87A 1RJVA 2KDHA 4UPGA 2K8MB 4NDBA 3AAJA 4XJKA 3VROA 1XFUO 3VGOA 3QMEA 5HKWA 4Q04A 1J7RA 2MRDA 3I5IC 1IH0A 3DF0A 4C0KA 1LKJA 3DYEA 4XYNA 2AMIA 1DJWA 2MLFC 1CMFA 1IWQA 2L2CA 2E30A 1XK4A 2WCBA 4DCKA 3SS4A 5AANA 1QWVA 1YUSA 2WC8A 4AQJA 2F2PA 1KK7Y 1YUUA 1IQ5A 2QEVA 1UHKA 3VRRA 2DOQA 1S5GY 2LVIA 1JC2A 2K7DA 3O2PA 2G9BA 2MBXA 1DQEA 1ZMZA 2KI4B 2JZIA 2MAZA 3DVJA 4MN0A 3A4UB 4OKHA 3RLZA 1MXEA 1TUJA 1F4OA 2BE6A 3FE9A 2M97A 1QJTA 1K96A 3R1OA 2F33A 1PVAA 2FOTA 4MZLA 3OB2B 4M2OA 5HLVA 1GJYA 1J7QA 2MJWB 5CSJA 1CDMA 3CZ2A 1F55A 1KFUS 1S6JA 1C7VA 2AAOA 1J1EA 3IF7A 2NXQA 1OOJA 2NCOA 3LLEA 3PATA 2KNEA 1Z2CB 2HQ8A 3S0BA 3DVEA 2FJYA 3FWBA 4GBAA 4M2QA 1YX7A 1UURA 2LMTA 1UHIA 4IL1A 3CZ0A 4MVFA 4GAOA 3GK2A 4YGCB 1P28A 2BNXA 4INXA 2WCHA 1XFWO 5EL2A 1BG1A 2BCXA 2M29A 2CBLA 1CDNA 1B9AA 1A29A 4YI9A 2O5GA 1L7ZA 2YGUA 3AKAA 3O4XA 5KU1A 3F45A 2KAVA 2Y1NA 1DELA 1KSOA 1YRTB 3CR5X 1FPWA 2ZKMX 5FI6A 1B4CA 1TTXA 1OMRA 3S0FA 3CDNA 2IS9A 1S6IA 3TDIA 1GQMA 1R6PA 2OTGB 1QATA 1TUZA 3FS7A 2KLEA 3SG4A 5KTYA 2LUXA 3H4SE 2LVVA 2Q4UA 1XO5A 5K89A 1YRUB 2KI4C 4GGFA 2LMVA 2PMYA 4DIRA 2JQ6A 1LXFC 1K95A 4F0ZB 3VB1A 3SG2A 3PM8A 1K9UA 1TOPA 2P70A 2G2BA 1S3PA 4ORBB 1B7TZ 5HKZA 1SCVA 2MLEC 1DJZA 1IQ3A 2KFHA 2KLDA 3MSEB 4I5LB 3ZWHA 3NHIA 3IQQA 2PYQA 3I5HB 4I5JA 4QJ3B 1KQVA 2L4HA 2WC5A 1ORGA 1B8RA 1M31A 2LM5A 2COLB 1DJXA 4INWA 1PVBA 1AUIB 1BR1B 1IGVA 2M0RA 3PN7B 2I2RE 2I94A 3LCPC 3TS5C 5PALA 4MRXA 1OOHA 1DF0B 2JTTA 2MHHA 5ER5A 2GTEA 5AERA 2LLTA 3DD4A 4PHJA 3EK4A 1CLLA 3CS1A 2OS8C 2PASA 3SG5A 1KCYA 3R72A 1PK0D 4PE1A 1J7PA 1SYMA 2L50A 2WCFA 2LNKA 3OHMB 1NCYA 3PSRA 1ALVA 2Q91A 4FQOA 1IIOA 1BU3A 3D73A 3CGAA 1VRKA 1BF5A 1R2UA 3FWCA 2P6BB 5HYDA 2JPOA 1BJFA 2WNDA 3I5GB 1B1GA 3S0EA 4CLNA 2JT3A 4I5NB 5AEQA 1EH2A 3SS3A 1F4QA 1FW4A 1IJ5A 2P71A 3BFAA 2OTGC 5KSZA 1S36A 1AHRA 3D0YB 4QJ5B 1B47A 3RZSA 3B88A 1AK8A 1DGUA 1NX1A 1OW4A 1JFJA 5HL1A 3BOWB 1C3ZA 4CIDA 2L51A 1EL4A 1QXPA 1K9KA 5DKNA 3SJSA 2L0PA 4PCWA 1BR4B 5D7FA 3KF9A 3BFBA 5JOLA 4A4CA 1XFXO 2M8UA 3BQ3A 3I5HC 3BUXB 1G4YR 2EGDA 1K94A 3TDUA 2KI6C 1QX5B 1JWDA 2BCAA 2ZN8A 2K61A 4P5OE 1AP4A 1WY9A 3I5FB 3VRNA 1LS8A 4PE0A 2BAPA 3BUNB 4WQ3A 1UHJA 5F6TA 2BE4A 3PN7C 3WNXB 1IG5A 1QS7A 2H61A 4BY5A 1LA0A 4TNCA 4MZJA 2LHLA 5I94A 1BT6A 3ICBA 5IBWA 1B7TY 1CDLA 3EK8A 3AAKA 3DVKA 4WRIA 2KSPA 1TNXA 1F54A 3SG6A 1SL7A 2HQWA 4XJKB 1QX7A 5I2OA 4ETOA 1K9PA 4DUQA 1U5IA 2L5YA 1QIVA 4AOMA 4JPZB 3DF0B 3NXAA 2ZRTA 4L9MA 2JNFA 3PFVA 3RM1A 2M1UA 2LP3A 1KFXL 1DJHA 3NHTA 4ORAB 1S1EA 1CLMA 1BODA 3I5GC 1Y6WA 3WHUB 2A4JA 2BBNA 1YURA 2NLNA 2EHBA 2ZFDA 4JKTA 2Y1MA 1ODBA 1PALA 2WCKA 1CKKA 1LA3A 3SIBA 2BBMA 2QDIA 2KBMA 1JSAA 2KOTA 1JF2A 2K2FA 1TIZA 2H2KA 1Y0VH 1JBAA 1Y1UA 2F2OA 5DICA 1NCZA 1OE9B 3SG7A 4YRUA 2EC6B 2LCPA 2K7OA 4N5XA 1U5IB 2KPHA 1XFVO 2B1UA 1ZUZA 2LLSA 3E3RA 3LL8B 3L47A 1WLZA 2KI6D 4HRGA 4AQIA 2FCEA 1SRAA 3R1VA 1MQ1A 1TNPA 2M49B 2QEHA 4DRWA 1CFPA 4ICBA 4WQ2A 5CSFA 3KPXA 4PT1A 1DJGA 1NPQA 3O78A 1N2DA 3I5FC 1N0YA 1QIWA 2HPSA 2LV7A 3D10A 2WCMA 1OMVA 1CDPA 1Z4HA 1DJYA 3FE6A 2CNPA 2K2AA 4PDZA 3D78A 1K90D 1CNPA 1NSHA 2CCMA 1TWOA 1DTLA 4ORCB 2CXJA 1AJ5A 1BOCA 1NX0A 3QRXA 2NCPA 3M0WA 1YR5A 5D69A 1WRKA 3BUOB 4MRYA 5D3OA 1MHOA 1W7IB 2K7BA 2WCEA 3GK4X 3JTDB 3R1PA 4MEWA 4PE4A 4PE7A 3N7HA 4OR9B 1DMOA 1XK4C 1C07A 5DKQA 2CT9A 2JXLA 1SL9A 1XVJA 2JWWA 4JQ0D 2M7LA 1OZOA 1UHHA 4QJ4B 2K60A 2LLUA 1CB1A 1H4BA 2V53A 1RTP1 4USLA 5HKYA 2KQYA 3L4LA 1CM4A 1FI6A 2F8PA 1CTRA 1TNWA 1WDCB 4YGDB 3K21A 1Y1XA 2KAYA 1SW8A 2EC6C 4MBEA 3WHTB 2QEOA 1SKTA 3SIAA 3EKJA 1UHNA 4A4BA 3V2LA 1S5GZ 1TNQA 2LUCA 3FE8A 2PRUA 5I2LA 1BLQA 2LE9B 3S0GA 1CFFA 5ER4X 3EK7A 4MZKA 1B8LA 1ALWA 2WCJA 3DVMA 2LVJA 1PRWA 5CSNA 4YGEB 5I2QA 1M46A 4OV2A 5FI7A 1F8HA 1OQPA 3BJHA 3NSKA 2PALA 1GGZA 2BKHB 3AKBA 4YBHB 2RGIA 1RK9A 5DKRA 2E6WA 3CWGA 1ZACA 1L2OB 1ZOTB 2JU0A 3SG3A 2WC6A 1XFRA 1TRFA 2ZNDA 1RROA 2LAPA 1QLKA 1JF0A 3CTNA 1AVSA 1OSAA 3DZTA 5G08A 2KYFA 1KFXS 5FI2A 1YVLA 1A03A 3GK1A 3NGVA 3JTDC 1XYDA 2L2EA 3B6XA 2BKIB 2BL0B 3KHEA 2Y4QA 1MXLC 1NYAA 2KYCA 1SSEB 5FYXA 2JULA 1X02A 3UO9A 2I18A 1JUOA 1SCMB 1NP8A 1WDCC 2ISDA 1GM0A 1EG4A 3TUYB 1CM1A 1W9ZA 2L5XB 1DEKA 4GGFC 3D74A 2M7NA 2QPTA 1A2XA 2TN4A 4NQGA 2WOSA 1HT9A 2R2IA 3CLNA 4HREE 2M1KB 2F3YA 2K0JA 2BECA 3D76A 3EVRA 1W7JB 3PJIA 3CZ1A 1N65A 4GNKB 5BPJA 2ZN9A 1M45A 2L4IA 1PSRA 4HRHA 3CABA 2I7AA 1Q80A 3PLFB 3BUWB 1CLBA 1EG3A 2Y5IA 1KSMA 1S6CA 1KK8B 1WRLA 1JFKA 1IJ6A 1M39A 1SR6B 2D8NA 1SBJA 2KQ6A 2KFGA 3FIAA 3K1EA 3NSIA 4CPVA 1KQMB 3KEVA 1WLMA 2OPOA 4GGNA 1GGWA 1OZSA 3B7AA 3KO0A 1L2OC 1NCXA 4C0LA 4FTGA 4U8DA 3LK1A 3S0AA 2HETA 1QVIZ 1M63B 1OMDA 4PHNA 2PSRA 1E8AA 4DS7A 5JJGA 1MF8B 3OB1B 1QLSA 4YGBB 2LVKA 2K7CA 2LP2A 1RFJA 4JD9A 1PULA 2JOJA 1C7WA 3B86A 1V1GA 1FBVA 1TCOB 4CFRA 2JXCA 2GGMA 1DVIA 2BL0C 2JPTA 2O60A 4PALA 1EXRA 2QACA 3EG5B 5J3XA 3D75A 1UWOA 1QV1A 1XA5A 3BXKA 3EKHA 3OX5A 1SL8A 1LVCD 2L98A 2FCDA 2NZ0A 3JVTB 1OOIX 3CYZA 1NWDA 3TS5B 5AFPA 1SCMC 1SPYA 3HX4A 1QASA 2GV5A 1DC1A 1K8UA 3TUYC 1V1FA 1XFZO 1ZFSA 2F3ZA 1YUTA 2M9GA 2VRGA 2KBIA 3EVVA 3IQOA 2ERBA 4YGAA 5TNCA 4HSZA 2OS8B 2LMUA 2PQLA 3LK0A 4NDDA 3D77A 3WXAA 1DT7B 1KWOB 1OOGA 3S0DA 1AJ4A 1EJ3A 1YTZC 2PVBA 1IRJA 1NX2A 1J55A 4D1EA 1SR6C 3BYAA 1KK8C 1SK6D 4ZCVA 3TZ1A 2M3WA 4OCIA 3VRPA 3O6BA 3DXLA 1NIWA 1KQMC 2JTZA 3CZTX 1MWNA 4GUKA 4MLWA 2JNXA 4P2YB 3EVUA 1CFCA 2KAXA 1QX2A 3C1VA 2H61C 5I8NA 1TN4A 1K93D 1MUXA 1K2HA 1A4PA 1B8CA 2WORA 1KFUL 3SS5A 1FI5A 2SASA 4JWQA 4MSPA 1DF0A 4IJ7A 4ZCUA 1SY9A 3IVTA 2QEBA 4N1FA 4KYNA 3L4AA 1KK7Z 4M2PA 3ZNIA 5B8IB 1CFDA 5GQQC 4OZDA 1J7OA 4R1EA 1SMGA 3PALA 3GOFA 3O4YA 1IKUA 2SCPA 2ZRSA 3I5IB 4BY4A 1YVHA 3TDZA 1C3YA 1TCFA 2JT8A 3BUMB 1QVIY 1H8BA 1MR8A 4OVNF 3OGNA 2JC2A 1DJIA 1Y1AA 4GPLB 3DY9A 3BFHA 2JT0A 4N1GA 4E68A 1LINA 1PSBA 3JVTC 1A75A 1NUBA 2KHNA 3OP0A 2GGZA 5HLOA 2LC5A 4PHMA 2FJUB 3D0YA 3UNWA 1G33A 2LHIA 2BCBA 1WRZA 2KFFA 1S26D 3A8RA 3OX6A 5CSIA 4PHKA 1QTXA 2MA2A 3VRQA 4CFQA 1KWOC 1HQVA 3BOWA 3CR2A 4FQTA 1J1DA 4C0JA 1F70A 2KGBC 3OBVA 1BMOA 1G8IA 2H8VA 5AXIA 1F71A 3PM2A 1D1OA 3HCMA
chains in the Genus database with same CATH topology
2HF5A 4NDCA 1XFYO 4GFTA 1A75B 1DGVA 1NX3A 1QV0A 3CR4X 2LANA 4YI8A 2JRFA 1RWYA 1UUSA 4I5KA 1YX8A 3NSOA 1UP5A 1RECA 2AUCA 2KGRA 3NSLA 5CPVA 1CMGA 2CTNA 2ZNEA 1SNLA 1FF1A 1RJVA 2KDHA 4UPGA 2K8MB 4NDBA 3AAJA 4XJKA 3VROA 1XFUO 3VGOA 5HKWA 4Q04A 1J7RA 2MRDA 3I5IC 1IH0A 3DF0A 4C0KA 1LKJA 4XYNA 2AMIA 1DJWA 2MLFC 1CMFA 1IWQA 2E30A 1XK4A 2WCBA 4DCKA 5AANA 1YUSA 2WC8A 4AQJA 2F2PA 1KK7Y 1YUUA 1IQ5A 1UHKA 3VRRA 2DOQA 1S5GY 2LVIA 1JC2A 2K7DA 3O2PA 2G9BA 2MBXA 1ZMZA 2KI4B 2JZIA 2MAZA 3DVJA 4MN0A 3A4UB 4OKHA 3RLZA 1MXEA 1F4OA 2BE6A 2M97A 1QJTA 1K96A 2F33A 1PVAA 2FOTA 4MZLA 3OB2B 4M2OA 5HLVA 1GJYA 1J7QA 2MJWB 5CSJA 1CDMA 1F55A 1KFUS 1S6JA 1C7VA 2AAOA 1J1EA 3IF7A 2NXQA 1OOJA 2NCOA 3LLEA 3PATA 2KNEA 2HQ8A 3DVEA 3FWBA 4GBAA 4M2QA 1YX7A 1UURA 2LMTA 1UHIA 4IL1A 4MVFA 4GAOA 3GK2A 4YGCB 1XFWO 1BG1A 2BCXA 2M29A 2CBLA 1CDNA 1B9AA 1A29A 4YI9A 2O5GA 1L7ZA 5KU1A 3AKAA 3F45A 2KAVA 2Y1NA 1KSOA 1YRTB 3CR5X 1FPWA 2ZKMX 1B4CA 1TTXA 1OMRA 2IS9A 1S6IA 3TDIA 1GQMA 1R6PA 2OTGB 1QATA 3FS7A 3SG4A 5KTYA 2LUXA 3H4SE 2LVVA 2Q4UA 1XO5A 5K89A 1YRUB 2KI4C 4GGFA 2LMVA 2PMYA 4DIRA 2JQ6A 1LXFC 1K95A 4F0ZB 3SG2A 3PM8A 1K9UA 1TOPA 2G2BA 1S3PA 4ORBB 1B7TZ 5HKZA 1SCVA 2MLEC 1DJZA 1IQ3A 2KFHA 3MSEB 4I5LB 3ZWHA 3IQQA 3I5HB 4I5JA 4QJ3B 1KQVA 2L4HA 1B8RA 1M31A 2LM5A 2COLB 1DJXA 1PVBA 1AUIB 1BR1B 1IGVA 2M0RA 3PN7B 2I2RE 2I94A 3LCPC 3TS5C 5PALA 4MRXA 1DF0B 2JTTA 2MHHA 5ER5A 5AERA 2LLTA 3DD4A 4PHJA 3EK4A 1CLLA 3CS1A 2OS8C 2PASA 3SG5A 1KCYA 1PK0D 4PE1A 1J7PA 1SYMA 2L50A 2WCFA 2LNKA 3OHMB 1NCYA 3PSRA 1ALVA 2Q91A 4FQOA 1BU3A 3CGAA 1VRKA 1BF5A 1R2UA 3FWCA 2P6BB 5HYDA 1BJFA 2WNDA 3I5GB 1B1GA 4CLNA 2JT3A 4I5NB 5AEQA 1EH2A 1F4QA 1FW4A 1IJ5A 5KSZA 2OTGC 1S36A 1AHRA 3D0YB 4QJ5B 1B47A 1AK8A 1DGUA 1NX1A 1JFJA 3BOWB 4CIDA 2L51A 1EL4A 1QXPA 1K9KA 5DKNA 3SJSA 2L0PA 4PCWA 1BR4B 5D7FA 3KF9A 4A4CA 5JOLA 1XFXO 2M8UA 3BQ3A 3I5HC 3BUXB 1G4YR 2EGDA 1K94A 3TDUA 2KI6C 1QX5B 1JWDA 2BCAA 2ZN8A 2K61A 4P5OE 1WY9A 3I5FB 3VRNA 4PE0A 3BUNB 4WQ3A 1UHJA 5F6TA 2BE4A 3PN7C 3WNXB 1IG5A 1QS7A 2H61A 4BY5A 1LA0A 4TNCA 4MZJA 2LHLA 1BT6A 3ICBA 5IBWA 1B7TY 1CDLA 3EK8A 3AAKA 3DVKA 4WRIA 2KSPA 1TNXA 3SG6A 1SL7A 2HQWA 4XJKB 1QX7A 5I2OA 4ETOA 1K9PA 4DUQA 1U5IA 1QIVA 4AOMA 4JPZB 3DF0B 3NXAA 2ZRTA 4L9MA 2JNFA 3PFVA 3RM1A 2M1UA 2LP3A 1KFXL 1DJHA 4ORAB 1S1EA 1CLMA 1BODA 3I5GC 1Y6WA 3WHUB 2A4JA 2BBNA 1YURA 2NLNA 2EHBA 2ZFDA 2Y1MA 1ODBA 1PALA 1CKKA 1LA3A 3SIBA 2BBMA 2KBMA 1JSAA 2KOTA 1JF2A 2K2FA 1TIZA 2H2KA 1Y0VH 1JBAA 1Y1UA 2F2OA 3SG7A 1NCZA 1OE9B 4YRUA 2EC6B 2LCPA 2K7OA 4N5XA 1U5IB 1XFVO 2B1UA 1ZUZA 2LLSA 3E3RA 3LL8B 1WLZA 2KI6D 4HRGA 4AQIA 2FCEA 1SRAA 1MQ1A 1TNPA 2M49B 4DRWA 1CFPA 4ICBA 4WQ2A 5CSFA 3KPXA 1DJGA 1NPQA 3O78A 1N2DA 3I5FC 1N0YA 1QIWA 2HPSA 2LV7A 3D10A 1OMVA 1CDPA 1DJYA 2CNPA 2K2AA 4PDZA 1K90D 1CNPA 1NSHA 2CCMA 1DTLA 4ORCB 2CXJA 1AJ5A 1BOCA 1NX0A 3QRXA 2NCPA 3M0WA 1YR5A 5D69A 1WRKA 3BUOB 4MRYA 1MHOA 1W7IB 2K7BA 2WCEA 3GK4X 3JTDB 4MEWA 1F54A 4PE4A 4PE7A 4OR9B 1DMOA 1XK4C 1C07A 5DKQA 2CT9A 2JXLA 1SL9A 1XVJA 2JWWA 4JQ0D 2M7LA 1OZOA 1UHHA 4QJ4B 1CB1A 2LLUA 1H4BA 2V53A 1RTP1 4USLA 5HKYA 2KQYA 1CM4A 1FI6A 2F8PA 1CTRA 1TNWA 1WDCB 4YGDB 3K21A 1Y1XA 2KAYA 1SW8A 2EC6C 4MBEA 3WHTB 3SIAA 1SKTA 3EKJA 1UHNA 4A4BA 1S5GZ 1TNQA 2LUCA 2PRUA 5I2LA 1BLQA 2LE9B 1CFFA 5ER4X 3EK7A 4MZKA 1B8LA 1ALWA 3DVMA 2LVJA 1PRWA 5CSNA 4YGEB 5I2QA 1M46A 4OV2A 1F8HA 1OQPA 3NSKA 2PALA 1GGZA 2BKHB 3AKBA 4YBHB 2RGIA 1RK9A 5DKRA 2E6WA 3CWGA 1ZACA 1L2OB 1ZOTB 2JU0A 3SG3A 1TRFA 2ZNDA 1RROA 2LAPA 1QLKA 1JF0A 3CTNA 1AVSA 1OSAA 5G08A 2KYFA 1KFXS 1YVLA 1A03A 3GK1A 3JTDC 1XYDA 2L2EA 2BKIB 2BL0B 3KHEA 2Y4QA 1MXLC 1NYAA 2KYCA 5FYXA 2JULA 1X02A 2I18A 1JUOA 1SCMB 1NP8A 1WDCC 2ISDA 1EG4A 3TUYB 1CM1A 2L5XB 4GGFC 2M7NA 2QPTA 1A2XA 2TN4A 4NQGA 2WOSA 1HT9A 2R2IA 3CLNA 4HREE 2M1KB 2F3YA 2K0JA 2BECA 3EVRA 1W7JB 1N65A 4GNKB 5BPJA 2ZN9A 1M45A 2L4IA 1PSRA 4HRHA 1CLBA 2I7AA 1Q80A 3PLFB 3BUWB 1EG3A 2Y5IA 1KSMA 1S6CA 1KK8B 1WRLA 1JFKA 1IJ6A 1M39A 1SR6B 2D8NA 1SBJA 2KQ6A 2KFGA 3FIAA 3NSIA 4CPVA 1KQMB 3KEVA 1WLMA 2OPOA 4GGNA 1GGWA 1OZSA 3KO0A 1L2OC 1NCXA 4C0LA 4FTGA 4U8DA 3LK1A 2HETA 1QVIZ 1M63B 1OMDA 4PHNA 2PSRA 1E8AA 4DS7A 5JJGA 1MF8B 3OB1B 1QLSA 4YGBB 2LVKA 2K7CA 2LP2A 1RFJA 1PULA 2JOJA 1C7WA 1V1GA 1FBVA 1TCOB 4CFRA 2JXCA 2GGMA 1DVIA 2BL0C 2JPTA 2O60A 4PALA 1EXRA 2QACA 5J3XA 1UWOA 1QV1A 1XA5A 3BXKA 3EKHA 3OX5A 1SL8A 1LVCD 2L98A 2FCDA 2NZ0A 3JVTB 3TS5B 1NWDA 5AFPA 1SCMC 1SPYA 3HX4A 1QASA 2GV5A 1K8UA 3TUYC 1V1FA 1XFZO 1ZFSA 2F3ZA 1YUTA 2M9GA 2VRGA 2KBIA 3EVVA 3IQOA 1AP4A 4YGAA 5TNCA 4HSZA 2OS8B 2LMUA 3LK0A 4NDDA 3WXAA 1DT7B 1KWOB 1AJ4A 1EJ3A 1YTZC 2PVBA 1IRJA 1NX2A 1J55A 4D1EA 1SR6C 3BYAA 1KK8C 1SK6D 4ZCVA 3TZ1A 2M3WA 4OCIA 3VRPA 3O6BA 1NIWA 1KQMC 2JTZA 3CZTX 1MWNA 4GUKA 4MLWA 2JNXA 4P2YB 3EVUA 1CFCA 2KAXA 1QX2A 3C1VA 2H61C 5I8NA 1TN4A 1K93D 1MUXA 1K2HA 1A4PA 1B8CA 2WORA 1KFUL 1FI5A 2SASA 4JWQA 4MSPA 1DF0A 4ZCUA 1SY9A 4N1FA 1KK7Z 4M2PA 3ZNIA 5B8IB 1CFDA 5GQQC 1J7OA 4R1EA 1SMGA 3PALA 3GOFA 3O4YA 1IKUA 2SCPA 2ZRSA 3I5IB 4BY4A 1YVHA 3TDZA 1TCFA 2JT8A 3BUMB 1QVIY 1H8BA 1MR8A 4OVNF 2JC2A 1DJIA 1Y1AA 4GPLB 4N1GA 2JT0A 4E68A 1LINA 1PSBA 3JVTC 1A75A 1NUBA 2KHNA 3OP0A 2GGZA 5HLOA 2LC5A 4PHMA 2FJUB 3D0YA 1G33A 2LHIA 2BCBA 1WRZA 2KFFA 1S26D 3A8RA 3OX6A 5CSIA 4PHKA 1QTXA 2MA2A 3VRQA 4CFQA 1KWOC 1HQVA 3BOWA 3CR2A 1J1DA 4C0JA 1F70A 2KGBC 1BMOA 1G8IA 5AXIA 1F71A 1D1OA 3HCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF5 A;  4NDC A;  1XFY O;  4GFT A;  1A75 B;  1DGV A;  1NX3 A;  1QV0 A;  3CR4 X;  2LAN A;  4YI8 A;  2JRF A;  1RWY A;  1UUS A;  4I5K A;  1YX8 A;  3NSO A;  1UP5 A;  1REC A;  2AUC A;  2KGR A;  3NSL A;  5CPV A;  1CMG A;  2CTN A;  2ZNE A;  1SNL A;  1FF1 A;  1RJV A;  2KDH A;  4UPG A;  2K8M B;  4NDB A;  3AAJ A;  4XJK A;  3VRO A;  1XFU O;  3VGO A;  5HKW A;  4Q04 A;  1J7R A;  2MRD A;  3I5I C;  1IH0 A;  3DF0 A;  4C0K A;  1LKJ A;  4XYN A;  2AMI A;  1DJW A;  2MLF C;  1CMF A;  1IWQ A;  2E30 A;  1XK4 A;  2WCB A;  4DCK A;  5AAN A;  1YUS A;  2WC8 A;  4AQJ A;  2F2P A;  1KK7 Y;  1YUU A;  1IQ5 A;  1UHK A;  3VRR A;  2DOQ A;  1S5G Y;  2LVI A;  1JC2 A;  2K7D A;  3O2P A;  2G9B A;  2MBX A;  1ZMZ A;  2KI4 B;  2JZI A;  2MAZ A;  3DVJ A;  4MN0 A;  3A4U B;  4OKH A;  3RLZ A;  1MXE A;  1F4O A;  2BE6 A;  2M97 A;  1QJT A;  1K96 A;  2F33 A;  1PVA A;  2FOT A;  4MZL A;  3OB2 B;  4M2O A;  5HLV A;  1GJY A;  1J7Q A;  2MJW B;  5CSJ A;  1CDM A;  1F55 A;  1KFU S;  1S6J A;  1C7V A;  2AAO A;  1J1E A;  3IF7 A;  2NXQ A;  1OOJ A;  2NCO A;  3LLE A;  3PAT A;  2KNE A;  2HQ8 A;  3DVE A;  3FWB A;  4GBA A;  4M2Q A;  1YX7 A;  1UUR A;  2LMT A;  1UHI A;  4IL1 A;  4MVF A;  4GAO A;  3GK2 A;  4YGC B;  1XFW O;  1BG1 A;  2BCX A;  2M29 A;  2CBL A;  1CDN A;  1B9A A;  1A29 A;  4YI9 A;  2O5G A;  1L7Z A;  5KU1 A;  3AKA A;  3F45 A;  2KAV A;  2Y1N A;  1KSO A;  1YRT B;  3CR5 X;  1FPW A;  2ZKM X;  1B4C A;  1TTX A;  1OMR A;  2IS9 A;  1S6I A;  3TDI A;  1GQM A;  1R6P A;  2OTG B;  1QAT A;  3FS7 A;  3SG4 A;  5KTY A;  2LUX A;  3H4S E;  2LVV A;  2Q4U A;  1XO5 A;  5K89 A;  1YRU B;  2KI4 C;  4GGF A;  2LMV A;  2PMY A;  4DIR A;  2JQ6 A;  1LXF C;  1K95 A;  4F0Z B;  3SG2 A;  3PM8 A;  1K9U A;  1TOP A;  2G2B A;  1S3P A;  4ORB B;  1B7T Z;  5HKZ A;  1SCV A;  2MLE C;  1DJZ A;  1IQ3 A;  2KFH A;  3MSE B;  4I5L B;  3ZWH A;  3IQQ A;  3I5H B;  4I5J A;  4QJ3 B;  1KQV A;  2L4H A;  1B8R A;  1M31 A;  2LM5 A;  2COL B;  1DJX A;  1PVB A;  1AUI B;  1BR1 B;  1IGV A;  2M0R A;  3PN7 B;  2I2R E;  2I94 A;  3LCP C;  3TS5 C;  5PAL A;  4MRX A;  1DF0 B;  2JTT A;  2MHH A;  5ER5 A;  5AER A;  2LLT A;  3DD4 A;  4PHJ A;  3EK4 A;  1CLL A;  3CS1 A;  2OS8 C;  2PAS A;  3SG5 A;  1KCY A;  1PK0 D;  4PE1 A;  1J7P A;  1SYM A;  2L50 A;  2WCF A;  2LNK A;  3OHM B;  1NCY A;  3PSR A;  1ALV A;  2Q91 A;  4FQO A;  1BU3 A;  3CGA A;  1VRK A;  1BF5 A;  1R2U A;  3FWC A;  2P6B B;  5HYD A;  1BJF A;  2WND A;  3I5G B;  1B1G A;  4CLN A;  2JT3 A;  4I5N B;  5AEQ A;  1EH2 A;  1F4Q A;  1FW4 A;  1IJ5 A;  5KSZ A;  2OTG C;  1S36 A;  1AHR A;  3D0Y B;  4QJ5 B;  1B47 A;  1AK8 A;  1DGU A;  1NX1 A;  1JFJ A;  3BOW B;  4CID A;  2L51 A;  1EL4 A;  1QXP A;  1K9K A;  5DKN A;  3SJS A;  2L0P A;  4PCW A;  1BR4 B;  5D7F A;  3KF9 A;  4A4C A;  5JOL A;  1XFX O;  2M8U A;  3BQ3 A;  3I5H C;  3BUX B;  1G4Y R;  2EGD A;  1K94 A;  3TDU A;  2KI6 C;  1QX5 B;  1JWD A;  2BCA A;  2ZN8 A;  2K61 A;  4P5O E;  1WY9 A;  3I5F B;  3VRN A;  4PE0 A;  3BUN B;  4WQ3 A;  1UHJ A;  5F6T A;  2BE4 A;  3PN7 C;  3WNX B;  1IG5 A;  1QS7 A;  2H61 A;  4BY5 A;  1LA0 A;  4TNC A;  4MZJ A;  2LHL A;  1BT6 A;  3ICB A;  5IBW A;  1B7T Y;  1CDL A;  3EK8 A;  3AAK A;  3DVK A;  4WRI A;  2KSP A;  1TNX A;  3SG6 A;  1SL7 A;  2HQW A;  4XJK B;  1QX7 A;  5I2O A;  4ETO A;  1K9P A;  4DUQ A;  1U5I A;  1QIV A;  4AOM A;  4JPZ B;  3DF0 B;  3NXA A;  2ZRT A;  4L9M A;  2JNF A;  3PFV A;  3RM1 A;  2M1U A;  2LP3 A;  1KFX L;  1DJH A;  4ORA B;  1S1E A;  1CLM A;  1BOD A;  3I5G C;  1Y6W A;  3WHU B;  2A4J A;  2BBN A;  1YUR A;  2NLN A;  2EHB A;  2ZFD A;  2Y1M A;  1ODB A;  1PAL A;  1CKK A;  1LA3 A;  3SIB A;  2BBM A;  2KBM A;  1JSA A;  2KOT A;  1JF2 A;  2K2F A;  1TIZ A;  2H2K A;  1Y0V H;  1JBA A;  1Y1U A;  2F2O A;  3SG7 A;  1NCZ A;  1OE9 B;  4YRU A;  2EC6 B;  2LCP A;  2K7O A;  4N5X A;  1U5I B;  1XFV O;  2B1U A;  1ZUZ A;  2LLS A;  3E3R A;  3LL8 B;  1WLZ A;  2KI6 D;  4HRG A;  4AQI A;  2FCE A;  1SRA A;  1MQ1 A;  1TNP A;  2M49 B;  4DRW A;  1CFP A;  4ICB A;  4WQ2 A;  5CSF A;  3KPX A;  1DJG A;  1NPQ A;  3O78 A;  1N2D A;  3I5F C;  1N0Y A;  1QIW A;  2HPS A;  2LV7 A;  3D10 A;  1OMV A;  1CDP A;  1DJY A;  2CNP A;  2K2A A;  4PDZ A;  1K90 D;  1CNP A;  1NSH A;  2CCM A;  1DTL A;  4ORC B;  2CXJ A;  1AJ5 A;  1BOC A;  1NX0 A;  3QRX A;  2NCP A;  3M0W A;  1YR5 A;  5D69 A;  1WRK A;  3BUO B;  4MRY A;  1MHO A;  1W7I B;  2K7B A;  2WCE A;  3GK4 X;  3JTD B;  4MEW A;  1F54 A;  4PE4 A;  4PE7 A;  4OR9 B;  1DMO A;  1XK4 C;  1C07 A;  5DKQ A;  2CT9 A;  2JXL A;  1SL9 A;  1XVJ A;  2JWW A;  4JQ0 D;  2M7L A;  1OZO A;  1UHH A;  4QJ4 B;  1CB1 A;  2LLU A;  1H4B A;  2V53 A;  1RTP 1;  4USL A;  5HKY A;  2KQY A;  1CM4 A;  1FI6 A;  2F8P A;  1CTR A;  1TNW A;  1WDC B;  4YGD B;  3K21 A;  1Y1X A;  2KAY A;  1SW8 A;  2EC6 C;  4MBE A;  3WHT B;  3SIA A;  1SKT A;  3EKJ A;  1UHN A;  4A4B A;  1S5G Z;  1TNQ A;  2LUC A;  2PRU A;  5I2L A;  1BLQ A;  2LE9 B;  1CFF A;  5ER4 X;  3EK7 A;  4MZK A;  1B8L A;  1ALW A;  3DVM A;  2LVJ A;  1PRW A;  5CSN A;  4YGE B;  5I2Q A;  1M46 A;  4OV2 A;  1F8H A;  1OQP A;  3NSK A;  2PAL A;  1GGZ A;  2BKH B;  3AKB A;  4YBH B;  2RGI A;  1RK9 A;  5DKR A;  2E6W A;  3CWG A;  1ZAC A;  1L2O B;  1ZOT B;  2JU0 A;  3SG3 A;  1TRF A;  2ZND A;  1RRO A;  2LAP A;  1QLK A;  1JF0 A;  3CTN A;  1AVS A;  1OSA A;  5G08 A;  2KYF A;  1KFX S;  1YVL A;  1A03 A;  3GK1 A;  3JTD C;  1XYD A;  2L2E A;  2BKI B;  2BL0 B;  3KHE A;  2Y4Q A;  1MXL C;  1NYA A;  2KYC A;  5FYX A;  2JUL A;  1X02 A;  2I18 A;  1JUO A;  1SCM B;  1NP8 A;  1WDC C;  2ISD A;  1EG4 A;  3TUY B;  1CM1 A;  2L5X B;  4GGF C;  2M7N A;  2QPT A;  1A2X A;  2TN4 A;  4NQG A;  2WOS A;  1HT9 A;  2R2I A;  3CLN A;  4HRE E;  2M1K B;  2F3Y A;  2K0J A;  2BEC A;  3EVR A;  1W7J B;  1N65 A;  4GNK B;  5BPJ A;  2ZN9 A;  1M45 A;  2L4I A;  1PSR A;  4HRH A;  1CLB A;  2I7A A;  1Q80 A;  3PLF B;  3BUW B;  1EG3 A;  2Y5I A;  1KSM A;  1S6C A;  1KK8 B;  1WRL A;  1JFK A;  1IJ6 A;  1M39 A;  1SR6 B;  2D8N A;  1SBJ A;  2KQ6 A;  2KFG A;  3FIA A;  3NSI A;  4CPV A;  1KQM B;  3KEV A;  1WLM A;  2OPO A;  4GGN A;  1GGW A;  1OZS A;  3KO0 A;  1L2O C;  1NCX A;  4C0L A;  4FTG A;  4U8D A;  3LK1 A;  2HET A;  1QVI Z;  1M63 B;  1OMD A;  4PHN A;  2PSR A;  1E8A A;  4DS7 A;  5JJG A;  1MF8 B;  3OB1 B;  1QLS A;  4YGB B;  2LVK A;  2K7C A;  2LP2 A;  1RFJ A;  1PUL A;  2JOJ A;  1C7W A;  1V1G A;  1FBV A;  1TCO B;  4CFR A;  2JXC A;  2GGM A;  1DVI A;  2BL0 C;  2JPT A;  2O60 A;  4PAL A;  1EXR A;  2QAC A;  5J3X A;  1UWO A;  1QV1 A;  1XA5 A;  3BXK A;  3EKH A;  3OX5 A;  1SL8 A;  1LVC D;  2L98 A;  2FCD A;  2NZ0 A;  3JVT B;  3TS5 B;  1NWD A;  5AFP A;  1SCM C;  1SPY A;  3HX4 A;  1QAS A;  2GV5 A;  1K8U A;  3TUY C;  1V1F A;  1XFZ O;  1ZFS A;  2F3Z A;  1YUT A;  2M9G A;  2VRG A;  2KBI A;  3EVV A;  3IQO A;  1AP4 A;  4YGA A;  5TNC A;  4HSZ A;  2OS8 B;  2LMU A;  3LK0 A;  4NDD A;  3WXA A;  1DT7 B;  1KWO B;  1AJ4 A;  1EJ3 A;  1YTZ C;  2PVB A;  1IRJ A;  1NX2 A;  1J55 A;  4D1E A;  1SR6 C;  3BYA A;  1KK8 C;  1SK6 D;  4ZCV A;  3TZ1 A;  2M3W A;  4OCI A;  3VRP A;  3O6B A;  1NIW A;  1KQM C;  2JTZ A;  3CZT X;  1MWN A;  4GUK A;  4MLW A;  2JNX A;  4P2Y B;  3EVU A;  1CFC A;  2KAX A;  1QX2 A;  3C1V A;  2H61 C;  5I8N A;  1TN4 A;  1K93 D;  1MUX A;  1K2H A;  1A4P A;  1B8C A;  2WOR A;  1KFU L;  1FI5 A;  2SAS A;  4JWQ A;  4MSP A;  1DF0 A;  4ZCU A;  1SY9 A;  4N1F A;  1KK7 Z;  4M2P A;  3ZNI A;  5B8I B;  1CFD A;  5GQQ C;  1J7O A;  4R1E A;  1SMG A;  3PAL A;  3GOF A;  3O4Y A;  1IKU A;  2SCP A;  2ZRS A;  3I5I B;  4BY4 A;  1YVH A;  3TDZ A;  1TCF A;  2JT8 A;  3BUM B;  1QVI Y;  1H8B A;  1MR8 A;  4OVN F;  2JC2 A;  1DJI A;  1Y1A A;  4GPL B;  4N1G A;  2JT0 A;  4E68 A;  1LIN A;  1PSB A;  3JVT C;  1A75 A;  1NUB A;  2KHN A;  3OP0 A;  2GGZ A;  5HLO A;  2LC5 A;  4PHM A;  2FJU B;  3D0Y A;  1G33 A;  2LHI A;  2BCB A;  1WRZ A;  2KFF A;  1S26 D;  3A8R A;  3OX6 A;  5CSI A;  4PHK A;  1QTX A;  2MA2 A;  3VRQ A;  4CFQ A;  1KWO C;  1HQV A;  3BOW A;  3CR2 A;  1J1D A;  4C0J A;  1F70 A;  2KGB C;  1BMO A;  1G8I A;  5AXI A;  1F71 A;  1D1O A;  3HCM A; 
#chains in the Genus database with same CATH topology
 2HF5 A;  4NDC A;  1XFY O;  4GFT A;  1A75 B;  1DGV A;  1NX3 A;  1QV0 A;  3CR4 X;  3Q8I A;  2LAN A;  4YI8 A;  2WCL A;  2JRF A;  1RWY A;  1T14 A;  1UUS A;  4I5K A;  1YX8 A;  3NSO A;  1UP5 A;  4F7F A;  1REC A;  2AUC A;  2KGR A;  3NSL A;  5CPV A;  1CMG A;  2CTN A;  2ZNE A;  1SNL A;  1FF1 A;  1OOF A;  3B87 A;  1RJV A;  2KDH A;  4UPG A;  2K8M B;  4NDB A;  3AAJ A;  4XJK A;  3VRO A;  1XFU O;  3VGO A;  3QME A;  5HKW A;  4Q04 A;  1J7R A;  2MRD A;  3I5I C;  1IH0 A;  3DF0 A;  4C0K A;  1LKJ A;  3DYE A;  4XYN A;  2AMI A;  1DJW A;  2MLF C;  1CMF A;  1IWQ A;  2L2C A;  2E30 A;  1XK4 A;  2WCB A;  4DCK A;  3SS4 A;  5AAN A;  1QWV A;  1YUS A;  2WC8 A;  4AQJ A;  2F2P A;  1KK7 Y;  1YUU A;  1IQ5 A;  2QEV A;  1UHK A;  3VRR A;  2DOQ A;  1S5G Y;  2LVI A;  1JC2 A;  2K7D A;  3O2P A;  2G9B A;  2MBX A;  1DQE A;  1ZMZ A;  2KI4 B;  2JZI A;  2MAZ A;  3DVJ A;  4MN0 A;  3A4U B;  4OKH A;  3RLZ A;  1MXE A;  1TUJ A;  1F4O A;  2BE6 A;  3FE9 A;  2M97 A;  1QJT A;  1K96 A;  3R1O A;  2F33 A;  1PVA A;  2FOT A;  4MZL A;  3OB2 B;  4M2O A;  5HLV A;  1GJY A;  1J7Q A;  2MJW B;  5CSJ A;  1CDM A;  3CZ2 A;  1F55 A;  1KFU S;  1S6J A;  1C7V A;  2AAO A;  1J1E A;  3IF7 A;  2NXQ A;  1OOJ A;  2NCO A;  3LLE A;  3PAT A;  2KNE A;  1Z2C B;  2HQ8 A;  3S0B A;  3DVE A;  2FJY A;  3FWB A;  4GBA A;  4M2Q A;  1YX7 A;  1UUR A;  2LMT A;  1UHI A;  4IL1 A;  3CZ0 A;  4MVF A;  4GAO A;  3GK2 A;  4YGC B;  1P28 A;  2BNX A;  4INX A;  2WCH A;  1XFW O;  5EL2 A;  1BG1 A;  2BCX A;  2M29 A;  2CBL A;  1CDN A;  1B9A A;  1A29 A;  4YI9 A;  2O5G A;  1L7Z A;  2YGU A;  3AKA A;  3O4X A;  5KU1 A;  3F45 A;  2KAV A;  2Y1N A;  1DEL A;  1KSO A;  1YRT B;  3CR5 X;  1FPW A;  2ZKM X;  5FI6 A;  1B4C A;  1TTX A;  1OMR A;  3S0F A;  3CDN A;  2IS9 A;  1S6I A;  3TDI A;  1GQM A;  1R6P A;  2OTG B;  1QAT A;  1TUZ A;  3FS7 A;  2KLE A;  3SG4 A;  5KTY A;  2LUX A;  3H4S E;  2LVV A;  2Q4U A;  1XO5 A;  5K89 A;  1YRU B;  2KI4 C;  4GGF A;  2LMV A;  2PMY A;  4DIR A;  2JQ6 A;  1LXF C;  1K95 A;  4F0Z B;  3VB1 A;  3SG2 A;  3PM8 A;  1K9U A;  1TOP A;  2P70 A;  2G2B A;  1S3P A;  4ORB B;  1B7T Z;  5HKZ A;  1SCV A;  2MLE C;  1DJZ A;  1IQ3 A;  2KFH A;  2KLD A;  3MSE B;  4I5L B;  3ZWH A;  3NHI A;  3IQQ A;  2PYQ A;  3I5H B;  4I5J A;  4QJ3 B;  1KQV A;  2L4H A;  2WC5 A;  1ORG A;  1B8R A;  1M31 A;  2LM5 A;  2COL B;  1DJX A;  4INW A;  1PVB A;  1AUI B;  1BR1 B;  1IGV A;  2M0R A;  3PN7 B;  2I2R E;  2I94 A;  3LCP C;  3TS5 C;  5PAL A;  4MRX A;  1OOH A;  1DF0 B;  2JTT A;  2MHH A;  5ER5 A;  2GTE A;  5AER A;  2LLT A;  3DD4 A;  4PHJ A;  3EK4 A;  1CLL A;  3CS1 A;  2OS8 C;  2PAS A;  3SG5 A;  1KCY A;  3R72 A;  1PK0 D;  4PE1 A;  1J7P A;  1SYM A;  2L50 A;  2WCF A;  2LNK A;  3OHM B;  1NCY A;  3PSR A;  1ALV A;  2Q91 A;  4FQO A;  1IIO A;  1BU3 A;  3D73 A;  3CGA A;  1VRK A;  1BF5 A;  1R2U A;  3FWC A;  2P6B B;  5HYD A;  2JPO A;  1BJF A;  2WND A;  3I5G B;  1B1G A;  3S0E A;  4CLN A;  2JT3 A;  4I5N B;  5AEQ A;  1EH2 A;  3SS3 A;  1F4Q A;  1FW4 A;  1IJ5 A;  2P71 A;  3BFA A;  2OTG C;  5KSZ A;  1S36 A;  1AHR A;  3D0Y B;  4QJ5 B;  1B47 A;  3RZS A;  3B88 A;  1AK8 A;  1DGU A;  1NX1 A;  1OW4 A;  1JFJ A;  5HL1 A;  3BOW B;  1C3Z A;  4CID A;  2L51 A;  1EL4 A;  1QXP A;  1K9K A;  5DKN A;  3SJS A;  2L0P A;  4PCW A;  1BR4 B;  5D7F A;  3KF9 A;  3BFB A;  5JOL A;  4A4C A;  1XFX O;  2M8U A;  3BQ3 A;  3I5H C;  3BUX B;  1G4Y R;  2EGD A;  1K94 A;  3TDU A;  2KI6 C;  1QX5 B;  1JWD A;  2BCA A;  2ZN8 A;  2K61 A;  4P5O E;  1AP4 A;  1WY9 A;  3I5F B;  3VRN A;  1LS8 A;  4PE0 A;  2BAP A;  3BUN B;  4WQ3 A;  1UHJ A;  5F6T A;  2BE4 A;  3PN7 C;  3WNX B;  1IG5 A;  1QS7 A;  2H61 A;  4BY5 A;  1LA0 A;  4TNC A;  4MZJ A;  2LHL A;  5I94 A;  1BT6 A;  3ICB A;  5IBW A;  1B7T Y;  1CDL A;  3EK8 A;  3AAK A;  3DVK A;  4WRI A;  2KSP A;  1TNX A;  1F54 A;  3SG6 A;  1SL7 A;  2HQW A;  4XJK B;  1QX7 A;  5I2O A;  4ETO A;  1K9P A;  4DUQ A;  1U5I A;  2L5Y A;  1QIV A;  4AOM A;  4JPZ B;  3DF0 B;  3NXA A;  2ZRT A;  4L9M A;  2JNF A;  3PFV A;  3RM1 A;  2M1U A;  2LP3 A;  1KFX L;  1DJH A;  3NHT A;  4ORA B;  1S1E A;  1CLM A;  1BOD A;  3I5G C;  1Y6W A;  3WHU B;  2A4J A;  2BBN A;  1YUR A;  2NLN A;  2EHB A;  2ZFD A;  4JKT A;  2Y1M A;  1ODB A;  1PAL A;  2WCK A;  1CKK A;  1LA3 A;  3SIB A;  2BBM A;  2QDI A;  2KBM A;  1JSA A;  2KOT A;  1JF2 A;  2K2F A;  1TIZ A;  2H2K A;  1Y0V H;  1JBA A;  1Y1U A;  2F2O A;  5DIC A;  1NCZ A;  1OE9 B;  3SG7 A;  4YRU A;  2EC6 B;  2LCP A;  2K7O A;  4N5X A;  1U5I B;  2KPH A;  1XFV O;  2B1U A;  1ZUZ A;  2LLS A;  3E3R A;  3LL8 B;  3L47 A;  1WLZ A;  2KI6 D;  4HRG A;  4AQI A;  2FCE A;  1SRA A;  3R1V A;  1MQ1 A;  1TNP A;  2M49 B;  2QEH A;  4DRW A;  1CFP A;  4ICB A;  4WQ2 A;  5CSF A;  3KPX A;  4PT1 A;  1DJG A;  1NPQ A;  3O78 A;  1N2D A;  3I5F C;  1N0Y A;  1QIW A;  2HPS A;  2LV7 A;  3D10 A;  2WCM A;  1OMV A;  1CDP A;  1Z4H A;  1DJY A;  3FE6 A;  2CNP A;  2K2A A;  4PDZ A;  3D78 A;  1K90 D;  1CNP A;  1NSH A;  2CCM A;  1TWO A;  1DTL A;  4ORC B;  2CXJ A;  1AJ5 A;  1BOC A;  1NX0 A;  3QRX A;  2NCP A;  3M0W A;  1YR5 A;  5D69 A;  1WRK A;  3BUO B;  4MRY A;  5D3O A;  1MHO A;  1W7I B;  2K7B A;  2WCE A;  3GK4 X;  3JTD B;  3R1P A;  4MEW A;  4PE4 A;  4PE7 A;  3N7H A;  4OR9 B;  1DMO A;  1XK4 C;  1C07 A;  5DKQ A;  2CT9 A;  2JXL A;  1SL9 A;  1XVJ A;  2JWW A;  4JQ0 D;  2M7L A;  1OZO A;  1UHH A;  4QJ4 B;  2K60 A;  2LLU A;  1CB1 A;  1H4B A;  2V53 A;  1RTP 1;  4USL A;  5HKY A;  2KQY A;  3L4L A;  1CM4 A;  1FI6 A;  2F8P A;  1CTR A;  1TNW A;  1WDC B;  4YGD B;  3K21 A;  1Y1X A;  2KAY A;  1SW8 A;  2EC6 C;  4MBE A;  3WHT B;  2QEO A;  1SKT A;  3SIA A;  3EKJ A;  1UHN A;  4A4B A;  3V2L A;  1S5G Z;  1TNQ A;  2LUC A;  3FE8 A;  2PRU A;  5I2L A;  1BLQ A;  2LE9 B;  3S0G A;  1CFF A;  5ER4 X;  3EK7 A;  4MZK A;  1B8L A;  1ALW A;  2WCJ A;  3DVM A;  2LVJ A;  1PRW A;  5CSN A;  4YGE B;  5I2Q A;  1M46 A;  4OV2 A;  5FI7 A;  1F8H A;  1OQP A;  3BJH A;  3NSK A;  2PAL A;  1GGZ A;  2BKH B;  3AKB A;  4YBH B;  2RGI A;  1RK9 A;  5DKR A;  2E6W A;  3CWG A;  1ZAC A;  1L2O B;  1ZOT B;  2JU0 A;  3SG3 A;  2WC6 A;  1XFR A;  1TRF A;  2ZND A;  1RRO A;  2LAP A;  1QLK A;  1JF0 A;  3CTN A;  1AVS A;  1OSA A;  3DZT A;  5G08 A;  2KYF A;  1KFX S;  5FI2 A;  1YVL A;  1A03 A;  3GK1 A;  3NGV A;  3JTD C;  1XYD A;  2L2E A;  3B6X A;  2BKI B;  2BL0 B;  3KHE A;  2Y4Q A;  1MXL C;  1NYA A;  2KYC A;  1SSE B;  5FYX A;  2JUL A;  1X02 A;  3UO9 A;  2I18 A;  1JUO A;  1SCM B;  1NP8 A;  1WDC C;  2ISD A;  1GM0 A;  1EG4 A;  3TUY B;  1CM1 A;  1W9Z A;  2L5X B;  1DEK A;  4GGF C;  3D74 A;  2M7N A;  2QPT A;  1A2X A;  2TN4 A;  4NQG A;  2WOS A;  1HT9 A;  2R2I A;  3CLN A;  4HRE E;  2M1K B;  2F3Y A;  2K0J A;  2BEC A;  3D76 A;  3EVR A;  1W7J B;  3PJI A;  3CZ1 A;  1N65 A;  4GNK B;  5BPJ A;  2ZN9 A;  1M45 A;  2L4I A;  1PSR A;  4HRH A;  3CAB A;  2I7A A;  1Q80 A;  3PLF B;  3BUW B;  1CLB A;  1EG3 A;  2Y5I A;  1KSM A;  1S6C A;  1KK8 B;  1WRL A;  1JFK A;  1IJ6 A;  1M39 A;  1SR6 B;  2D8N A;  1SBJ A;  2KQ6 A;  2KFG A;  3FIA A;  3K1E A;  3NSI A;  4CPV A;  1KQM B;  3KEV A;  1WLM A;  2OPO A;  4GGN A;  1GGW A;  1OZS A;  3B7A A;  3KO0 A;  1L2O C;  1NCX A;  4C0L A;  4FTG A;  4U8D A;  3LK1 A;  3S0A A;  2HET A;  1QVI Z;  1M63 B;  1OMD A;  4PHN A;  2PSR A;  1E8A A;  4DS7 A;  5JJG A;  1MF8 B;  3OB1 B;  1QLS A;  4YGB B;  2LVK A;  2K7C A;  2LP2 A;  1RFJ A;  4JD9 A;  1PUL A;  2JOJ A;  1C7W A;  3B86 A;  1V1G A;  1FBV A;  1TCO B;  4CFR A;  2JXC A;  2GGM A;  1DVI A;  2BL0 C;  2JPT A;  2O60 A;  4PAL A;  1EXR A;  2QAC A;  3EG5 B;  5J3X A;  3D75 A;  1UWO A;  1QV1 A;  1XA5 A;  3BXK A;  3EKH A;  3OX5 A;  1SL8 A;  1LVC D;  2L98 A;  2FCD A;  2NZ0 A;  3JVT B;  1OOI X;  3CYZ A;  1NWD A;  3TS5 B;  5AFP A;  1SCM C;  1SPY A;  3HX4 A;  1QAS A;  2GV5 A;  1DC1 A;  1K8U A;  3TUY C;  1V1F A;  1XFZ O;  1ZFS A;  2F3Z A;  1YUT A;  2M9G A;  2VRG A;  2KBI A;  3EVV A;  3IQO A;  2ERB A;  4YGA A;  5TNC A;  4HSZ A;  2OS8 B;  2LMU A;  2PQL A;  3LK0 A;  4NDD A;  3D77 A;  3WXA A;  1DT7 B;  1KWO B;  1OOG A;  3S0D A;  1AJ4 A;  1EJ3 A;  1YTZ C;  2PVB A;  1IRJ A;  1NX2 A;  1J55 A;  4D1E A;  1SR6 C;  3BYA A;  1KK8 C;  1SK6 D;  4ZCV A;  3TZ1 A;  2M3W A;  4OCI A;  3VRP A;  3O6B A;  3DXL A;  1NIW A;  1KQM C;  2JTZ A;  3CZT X;  1MWN A;  4GUK A;  4MLW A;  2JNX A;  4P2Y B;  3EVU A;  1CFC A;  2KAX A;  1QX2 A;  3C1V A;  2H61 C;  5I8N A;  1TN4 A;  1K93 D;  1MUX A;  1K2H A;  1A4P A;  1B8C A;  2WOR A;  1KFU L;  3SS5 A;  1FI5 A;  2SAS A;  4JWQ A;  4MSP A;  1DF0 A;  4IJ7 A;  4ZCU A;  1SY9 A;  3IVT A;  2QEB A;  4N1F A;  4KYN A;  3L4A A;  1KK7 Z;  4M2P A;  3ZNI A;  5B8I B;  1CFD A;  5GQQ C;  4OZD A;  1J7O A;  4R1E A;  1SMG A;  3PAL A;  3GOF A;  3O4Y A;  1IKU A;  2SCP A;  2ZRS A;  3I5I B;  4BY4 A;  1YVH A;  3TDZ A;  1C3Y A;  1TCF A;  2JT8 A;  3BUM B;  1QVI Y;  1H8B A;  1MR8 A;  4OVN F;  3OGN A;  2JC2 A;  1DJI A;  1Y1A A;  4GPL B;  3DY9 A;  3BFH A;  2JT0 A;  4N1G A;  4E68 A;  1LIN A;  1PSB A;  3JVT C;  1A75 A;  1NUB A;  2KHN A;  3OP0 A;  2GGZ A;  5HLO A;  2LC5 A;  4PHM A;  2FJU B;  3D0Y A;  3UNW A;  1G33 A;  2LHI A;  2BCB A;  1WRZ A;  2KFF A;  1S26 D;  3A8R A;  3OX6 A;  5CSI A;  4PHK A;  1QTX A;  2MA2 A;  3VRQ A;  4CFQ A;  1KWO C;  1HQV A;  3BOW A;  3CR2 A;  4FQT A;  1J1D A;  4C0J A;  1F70 A;  2KGB C;  3OBV A;  1BMO A;  1G8I A;  2H8V A;  5AXI A;  1F71 A;  3PM2 A;  1D1O A;  3HCM A; 
#chains in the Genus database with same CATH homology
 2HF5 A;  4NDC A;  1XFY O;  4GFT A;  1A75 B;  1DGV A;  1NX3 A;  1QV0 A;  3CR4 X;  2LAN A;  4YI8 A;  2JRF A;  1RWY A;  1UUS A;  4I5K A;  1YX8 A;  3NSO A;  1UP5 A;  1REC A;  2AUC A;  2KGR A;  3NSL A;  5CPV A;  1CMG A;  2CTN A;  2ZNE A;  1SNL A;  1FF1 A;  1RJV A;  2KDH A;  4UPG A;  2K8M B;  4NDB A;  3AAJ A;  4XJK A;  3VRO A;  1XFU O;  3VGO A;  5HKW A;  4Q04 A;  1J7R A;  2MRD A;  3I5I C;  1IH0 A;  3DF0 A;  4C0K A;  1LKJ A;  4XYN A;  2AMI A;  1DJW A;  2MLF C;  1CMF A;  1IWQ A;  2E30 A;  1XK4 A;  2WCB A;  4DCK A;  5AAN A;  1YUS A;  2WC8 A;  4AQJ A;  2F2P A;  1KK7 Y;  1YUU A;  1IQ5 A;  1UHK A;  3VRR A;  2DOQ A;  1S5G Y;  2LVI A;  1JC2 A;  2K7D A;  3O2P A;  2G9B A;  2MBX A;  1ZMZ A;  2KI4 B;  2JZI A;  2MAZ A;  3DVJ A;  4MN0 A;  3A4U B;  4OKH A;  3RLZ A;  1MXE A;  1F4O A;  2BE6 A;  2M97 A;  1QJT A;  1K96 A;  2F33 A;  1PVA A;  2FOT A;  4MZL A;  3OB2 B;  4M2O A;  5HLV A;  1GJY A;  1J7Q A;  2MJW B;  5CSJ A;  1CDM A;  1F55 A;  1KFU S;  1S6J A;  1C7V A;  2AAO A;  1J1E A;  3IF7 A;  2NXQ A;  1OOJ A;  2NCO A;  3LLE A;  3PAT A;  2KNE A;  2HQ8 A;  3DVE A;  3FWB A;  4GBA A;  4M2Q A;  1YX7 A;  1UUR A;  2LMT A;  1UHI A;  4IL1 A;  4MVF A;  4GAO A;  3GK2 A;  4YGC B;  1XFW O;  1BG1 A;  2BCX A;  2M29 A;  2CBL A;  1CDN A;  1B9A A;  1A29 A;  4YI9 A;  2O5G A;  1L7Z A;  5KU1 A;  3AKA A;  3F45 A;  2KAV A;  2Y1N A;  1KSO A;  1YRT B;  3CR5 X;  1FPW A;  2ZKM X;  1B4C A;  1TTX A;  1OMR A;  2IS9 A;  1S6I A;  3TDI A;  1GQM A;  1R6P A;  2OTG B;  1QAT A;  3FS7 A;  3SG4 A;  5KTY A;  2LUX A;  3H4S E;  2LVV A;  2Q4U A;  1XO5 A;  5K89 A;  1YRU B;  2KI4 C;  4GGF A;  2LMV A;  2PMY A;  4DIR A;  2JQ6 A;  1LXF C;  1K95 A;  4F0Z B;  3SG2 A;  3PM8 A;  1K9U A;  1TOP A;  2G2B A;  1S3P A;  4ORB B;  1B7T Z;  5HKZ A;  1SCV A;  2MLE C;  1DJZ A;  1IQ3 A;  2KFH A;  3MSE B;  4I5L B;  3ZWH A;  3IQQ A;  3I5H B;  4I5J A;  4QJ3 B;  1KQV A;  2L4H A;  1B8R A;  1M31 A;  2LM5 A;  2COL B;  1DJX A;  1PVB A;  1AUI B;  1BR1 B;  1IGV A;  2M0R A;  3PN7 B;  2I2R E;  2I94 A;  3LCP C;  3TS5 C;  5PAL A;  4MRX A;  1DF0 B;  2JTT A;  2MHH A;  5ER5 A;  5AER A;  2LLT A;  3DD4 A;  4PHJ A;  3EK4 A;  1CLL A;  3CS1 A;  2OS8 C;  2PAS A;  3SG5 A;  1KCY A;  1PK0 D;  4PE1 A;  1J7P A;  1SYM A;  2L50 A;  2WCF A;  2LNK A;  3OHM B;  1NCY A;  3PSR A;  1ALV A;  2Q91 A;  4FQO A;  1BU3 A;  3CGA A;  1VRK A;  1BF5 A;  1R2U A;  3FWC A;  2P6B B;  5HYD A;  1BJF A;  2WND A;  3I5G B;  1B1G A;  4CLN A;  2JT3 A;  4I5N B;  5AEQ A;  1EH2 A;  1F4Q A;  1FW4 A;  1IJ5 A;  5KSZ A;  2OTG C;  1S36 A;  1AHR A;  3D0Y B;  4QJ5 B;  1B47 A;  1AK8 A;  1DGU A;  1NX1 A;  1JFJ A;  3BOW B;  4CID A;  2L51 A;  1EL4 A;  1QXP A;  1K9K A;  5DKN A;  3SJS A;  2L0P A;  4PCW A;  1BR4 B;  5D7F A;  3KF9 A;  4A4C A;  5JOL A;  1XFX O;  2M8U A;  3BQ3 A;  3I5H C;  3BUX B;  1G4Y R;  2EGD A;  1K94 A;  3TDU A;  2KI6 C;  1QX5 B;  1JWD A;  2BCA A;  2ZN8 A;  2K61 A;  4P5O E;  1WY9 A;  3I5F B;  3VRN A;  4PE0 A;  3BUN B;  4WQ3 A;  1UHJ A;  5F6T A;  2BE4 A;  3PN7 C;  3WNX B;  1IG5 A;  1QS7 A;  2H61 A;  4BY5 A;  1LA0 A;  4TNC A;  4MZJ A;  2LHL A;  1BT6 A;  3ICB A;  5IBW A;  1B7T Y;  1CDL A;  3EK8 A;  3AAK A;  3DVK A;  4WRI A;  2KSP A;  1TNX A;  3SG6 A;  1SL7 A;  2HQW A;  4XJK B;  1QX7 A;  5I2O A;  4ETO A;  1K9P A;  4DUQ A;  1U5I A;  1QIV A;  4AOM A;  4JPZ B;  3DF0 B;  3NXA A;  2ZRT A;  4L9M A;  2JNF A;  3PFV A;  3RM1 A;  2M1U A;  2LP3 A;  1KFX L;  1DJH A;  4ORA B;  1S1E A;  1CLM A;  1BOD A;  3I5G C;  1Y6W A;  3WHU B;  2A4J A;  2BBN A;  1YUR A;  2NLN A;  2EHB A;  2ZFD A;  2Y1M A;  1ODB A;  1PAL A;  1CKK A;  1LA3 A;  3SIB A;  2BBM A;  2KBM A;  1JSA A;  2KOT A;  1JF2 A;  2K2F A;  1TIZ A;  2H2K A;  1Y0V H;  1JBA A;  1Y1U A;  2F2O A;  3SG7 A;  1NCZ A;  1OE9 B;  4YRU A;  2EC6 B;  2LCP A;  2K7O A;  4N5X A;  1U5I B;  1XFV O;  2B1U A;  1ZUZ A;  2LLS A;  3E3R A;  3LL8 B;  1WLZ A;  2KI6 D;  4HRG A;  4AQI A;  2FCE A;  1SRA A;  1MQ1 A;  1TNP A;  2M49 B;  4DRW A;  1CFP A;  4ICB A;  4WQ2 A;  5CSF A;  3KPX A;  1DJG A;  1NPQ A;  3O78 A;  1N2D A;  3I5F C;  1N0Y A;  1QIW A;  2HPS A;  2LV7 A;  3D10 A;  1OMV A;  1CDP A;  1DJY A;  2CNP A;  2K2A A;  4PDZ A;  1K90 D;  1CNP A;  1NSH A;  2CCM A;  1DTL A;  4ORC B;  2CXJ A;  1AJ5 A;  1BOC A;  1NX0 A;  3QRX A;  2NCP A;  3M0W A;  1YR5 A;  5D69 A;  1WRK A;  3BUO B;  4MRY A;  1MHO A;  1W7I B;  2K7B A;  2WCE A;  3GK4 X;  3JTD B;  4MEW A;  1F54 A;  4PE4 A;  4PE7 A;  4OR9 B;  1DMO A;  1XK4 C;  1C07 A;  5DKQ A;  2CT9 A;  2JXL A;  1SL9 A;  1XVJ A;  2JWW A;  4JQ0 D;  2M7L A;  1OZO A;  1UHH A;  4QJ4 B;  1CB1 A;  2LLU A;  1H4B A;  2V53 A;  1RTP 1;  4USL A;  5HKY A;  2KQY A;  1CM4 A;  1FI6 A;  2F8P A;  1CTR A;  1TNW A;  1WDC B;  4YGD B;  3K21 A;  1Y1X A;  2KAY A;  1SW8 A;  2EC6 C;  4MBE A;  3WHT B;  3SIA A;  1SKT A;  3EKJ A;  1UHN A;  4A4B A;  1S5G Z;  1TNQ A;  2LUC A;  2PRU A;  5I2L A;  1BLQ A;  2LE9 B;  1CFF A;  5ER4 X;  3EK7 A;  4MZK A;  1B8L A;  1ALW A;  3DVM A;  2LVJ A;  1PRW A;  5CSN A;  4YGE B;  5I2Q A;  1M46 A;  4OV2 A;  1F8H A;  1OQP A;  3NSK A;  2PAL A;  1GGZ A;  2BKH B;  3AKB A;  4YBH B;  2RGI A;  1RK9 A;  5DKR A;  2E6W A;  3CWG A;  1ZAC A;  1L2O B;  1ZOT B;  2JU0 A;  3SG3 A;  1TRF A;  2ZND A;  1RRO A;  2LAP A;  1QLK A;  1JF0 A;  3CTN A;  1AVS A;  1OSA A;  5G08 A;  2KYF A;  1KFX S;  1YVL A;  1A03 A;  3GK1 A;  3JTD C;  1XYD A;  2L2E A;  2BKI B;  2BL0 B;  3KHE A;  2Y4Q A;  1MXL C;  1NYA A;  2KYC A;  5FYX A;  2JUL A;  1X02 A;  2I18 A;  1JUO A;  1SCM B;  1NP8 A;  1WDC C;  2ISD A;  1EG4 A;  3TUY B;  1CM1 A;  2L5X B;  4GGF C;  2M7N A;  2QPT A;  1A2X A;  2TN4 A;  4NQG A;  2WOS A;  1HT9 A;  2R2I A;  3CLN A;  4HRE E;  2M1K B;  2F3Y A;  2K0J A;  2BEC A;  3EVR A;  1W7J B;  1N65 A;  4GNK B;  5BPJ A;  2ZN9 A;  1M45 A;  2L4I A;  1PSR A;  4HRH A;  1CLB A;  2I7A A;  1Q80 A;  3PLF B;  3BUW B;  1EG3 A;  2Y5I A;  1KSM A;  1S6C A;  1KK8 B;  1WRL A;  1JFK A;  1IJ6 A;  1M39 A;  1SR6 B;  2D8N A;  1SBJ A;  2KQ6 A;  2KFG A;  3FIA A;  3NSI A;  4CPV A;  1KQM B;  3KEV A;  1WLM A;  2OPO A;  4GGN A;  1GGW A;  1OZS A;  3KO0 A;  1L2O C;  1NCX A;  4C0L A;  4FTG A;  4U8D A;  3LK1 A;  2HET A;  1QVI Z;  1M63 B;  1OMD A;  4PHN A;  2PSR A;  1E8A A;  4DS7 A;  5JJG A;  1MF8 B;  3OB1 B;  1QLS A;  4YGB B;  2LVK A;  2K7C A;  2LP2 A;  1RFJ A;  1PUL A;  2JOJ A;  1C7W A;  1V1G A;  1FBV A;  1TCO B;  4CFR A;  2JXC A;  2GGM A;  1DVI A;  2BL0 C;  2JPT A;  2O60 A;  4PAL A;  1EXR A;  2QAC A;  5J3X A;  1UWO A;  1QV1 A;  1XA5 A;  3BXK A;  3EKH A;  3OX5 A;  1SL8 A;  1LVC D;  2L98 A;  2FCD A;  2NZ0 A;  3JVT B;  3TS5 B;  1NWD A;  5AFP A;  1SCM C;  1SPY A;  3HX4 A;  1QAS A;  2GV5 A;  1K8U A;  3TUY C;  1V1F A;  1XFZ O;  1ZFS A;  2F3Z A;  1YUT A;  2M9G A;  2VRG A;  2KBI A;  3EVV A;  3IQO A;  1AP4 A;  4YGA A;  5TNC A;  4HSZ A;  2OS8 B;  2LMU A;  3LK0 A;  4NDD A;  3WXA A;  1DT7 B;  1KWO B;  1AJ4 A;  1EJ3 A;  1YTZ C;  2PVB A;  1IRJ A;  1NX2 A;  1J55 A;  4D1E A;  1SR6 C;  3BYA A;  1KK8 C;  1SK6 D;  4ZCV A;  3TZ1 A;  2M3W A;  4OCI A;  3VRP A;  3O6B A;  1NIW A;  1KQM C;  2JTZ A;  3CZT X;  1MWN A;  4GUK A;  4MLW A;  2JNX A;  4P2Y B;  3EVU A;  1CFC A;  2KAX A;  1QX2 A;  3C1V A;  2H61 C;  5I8N A;  1TN4 A;  1K93 D;  1MUX A;  1K2H A;  1A4P A;  1B8C A;  2WOR A;  1KFU L;  1FI5 A;  2SAS A;  4JWQ A;  4MSP A;  1DF0 A;  4ZCU A;  1SY9 A;  4N1F A;  1KK7 Z;  4M2P A;  3ZNI A;  5B8I B;  1CFD A;  5GQQ C;  1J7O A;  4R1E A;  1SMG A;  3PAL A;  3GOF A;  3O4Y A;  1IKU A;  2SCP A;  2ZRS A;  3I5I B;  4BY4 A;  1YVH A;  3TDZ A;  1TCF A;  2JT8 A;  3BUM B;  1QVI Y;  1H8B A;  1MR8 A;  4OVN F;  2JC2 A;  1DJI A;  1Y1A A;  4GPL B;  4N1G A;  2JT0 A;  4E68 A;  1LIN A;  1PSB A;  3JVT C;  1A75 A;  1NUB A;  2KHN A;  3OP0 A;  2GGZ A;  5HLO A;  2LC5 A;  4PHM A;  2FJU B;  3D0Y A;  1G33 A;  2LHI A;  2BCB A;  1WRZ A;  2KFF A;  1S26 D;  3A8R A;  3OX6 A;  5CSI A;  4PHK A;  1QTX A;  2MA2 A;  3VRQ A;  4CFQ A;  1KWO C;  1HQV A;  3BOW A;  3CR2 A;  1J1D A;  4C0J A;  1F70 A;  2KGB C;  1BMO A;  1G8I A;  5AXI A;  1F71 A;  1D1O A;  3HCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...