2LMTA

Nmr structure of androcam
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 38
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmtA01
3CTNA 2HF5A 3OP0A 3BXKA 1YUUA 2PASA 3AKBA 3IF7A 2BKHB 2PMYA 2K2AA 4JPZB 4XJKA 2LM5A 1AK8A 1NCYA 4PCWA 2OTGB 5D69A 4YGDB 2WNDA 1BLQA 3JTDB 2JT0A 4NDDA 2KFFA 2JXLA 1QJTA 1CDPA 3PN7B 2CNPA 3TS5B 1PK0D 1K9UA 3I5FC 3OB2B 4HRGA 3EKJA 1XFUO 1WDCB 2MA2A 2L4HA 2QPTA 1OMDA 2GGMA 5KTYA 4QJ3B 1R6PA 1SR6C 3GK1A 1BF5A 3SIBA 1UHHA 2OPOA 4OKHA 2D8NA 1DJZA 1NSHA 2WORA 1EJ3A 3GK4X 1JSAA 1CM1A 1QLKA 2GGZA 4PE1A 5HKZA 5BPJA 1KQMC 1SW8A 1UP5A 1QATA 2MRDA 2Q91A 4HREE 3BUMB 3EVUA 2TN4A 4AQIA 1L7ZA 3EVVA 3CR5X 1XA5A 1BR4B 3CLNA 2V53A 5KU1A 1SCMC 3O2PA 2KYCA 2LE9B 4NQGA 1PALA 4I5JA 4FQOA 2FCDA 2LC5A 1B1GA 1RECA 2E6WA 1RROA 3AKAA 3LCPC 2VRGA 3I5HB 1DMOA 4USLA 1CMFA 1K8UA 1NX0A 3DF0B 1LXFC 3PLFB 1KWOC 1CTRA 1KCYA 3BUOB 3SG3A 4CFQA 1MR8A 1K9PA 3KF9A 1KSMA 1IJ5A 1PULA 2Y1NA 3M0WA 4PHMA 1JBAA 1KK7Z 4PDZA 1BG1A 1PSBA 4PE4A 2KAVA 2LMTA 1UHJA 2LLUA 2SASA 2BL0B 4MRXA 3PSRA 1EG4A 3CGAA 1J7OA 1ZACA 3D0YA 4UPGA 1OE9B 3BUNB 1OOJA 1QIWA 1QVIY 4MSPA 1KQMB 3VRPA 1S36A 2F2OA 2Q4UA 1SL9A 3GK2A 2JWWA 2H61A 4GGFA 1BODA 5DKRA 1W7JB 3SG6A 3SG5A 1CDLA 1CLLA 2HQ8A 2E30A 3WHTB 2K0JA 1UHIA 3NSLA 2HETA 1YX7A 5JOLA 1JF2A 4N1GA 3VROA 3WNXB 1CDNA 1FI6A 1SL8A 2I2RE 3RLZA 2CT9A 1X02A 3EK7A 5FYXA 1SNLA 1CFCA 1GGZA 1RTP1 4L9MA 1J1DA 1UUSA 4OVNF 5D7FA 1KWOB 1MUXA 1K93D 4WQ3A 1J1EA 1KSOA 4ORBB 3KHEA 2OTGC 4GNKB 4Q04A 1CMGA 4DRWA 3ZNIA 3JTDC 1AHRA 1MXLC 3A8RA 3LK1A 2JQ6A 4CLNA 1J7PA 3DVKA 3KPXA 1YTZC 3LLEA 1K95A 1DJXA 1XK4A 4MRYA 4PALA 3FS7A 1XFWO 3PN7C 2WCEA 2AMIA 3TS5C 1NP8A 4M2QA 4MZJA 4N5XA 2K8MB 4AOMA 1WDCC 5I8NA 2K61A 1BU3A 2L2EA 1KFUS 2L4IA 1EH2A 2PRUA 1AP4A 1N0YA 4TNCA 1IGVA 1XYDA 4ETOA 2ZN8A 1C7VA 2FJUB 1NPQA 4QJ5B 1ZOTB 1PSRA 4QJ4B 1OZOA 2L5XB 2F3YA 1F8HA 1L2OB 4E68A 2LMVA 1TTXA 1RFJA 2K7DA 1MXEA 1E8AA 1LA0A 1F4QA 3JVTB 1HT9A 1VRKA 3IQQA 3E3RA 4FTGA 3BOWB 4ZCVA 1S6JA 1IG5A 4MLWA 1C07A 2O5GA 2WOSA 2JT3A 2B1UA 1G33A 2DOQA 3I5HC 1IWQA 1NX3A 1CB1A 1SMGA 1CNPA 1NX2A 3VRNA 1DJIA 2JC2A 2JZIA 1XFVO 1Y1XA 4I5KA 1WRZA 2MJWB 5CSFA 2KQYA 1SPYA 2LNKA 1KQVA 2ISDA 1KFXS 3OX6A 1LKJA 1WLZA 1CFFA 3FWBA 1DJGA 3IQOA 1DF0B 1QX7A 1AUIB 2KSPA 1EL4A 2BL0C 2LVVA 1MQ1A 4YI9A 3VRQA 3TUYB 1TIZA 4YRUA 5JJGA 2KFGA 1PVAA 3I5IB 1IQ3A 3DVMA 2I18A 5ER4X 4DUQA 1ZUZA 2M3WA 4DS7A 3OHMB 2KQ6A 4JQ0D 3SG2A 1DTLA 2I94A 2Y5IA 1QV0A 2LLTA 1YUSA 2PVBA 2BBMA 4PHJA 1S6CA 2PALA 1S6IA 3EK4A 2KI4B 1KK8B 3ICBA 1B7TY 1NWDA 2LAPA 1GQMA 3CWGA 2KI6C 2NCOA 2LLSA 4JWQA 2I7AA 1J7QA 1QS7A 1QVIZ 2A4JA 1UURA 2M0RA 4ICBA 1BOCA 2LVIA 2BCXA 1K2HA 4CIDA 3EKHA 3PFVA 2L51A 3GOFA 1WLMA 1U5IA 1Q80A 3AAJA 2KAXA 4I5NB 1M46A 3BQ3A 2JPTA 4MVFA 1PRWA 2KYFA 3OB1B 5CPVA 3QRXA 4GBAA 1MWNA 1OMRA 1YX8A 2MAZA 1KFUL 2M7NA 3TDIA 1YVLA 2LHIA 1M45A 2ZKMX 1WY9A 2R2IA 2CTNA 3DD4A 4M2OA 1DT7B 4XJKB 1YRTB 2LCPA 4YGAA 2WCBA 3LK0A 3LL8B 3TDZA 1A4PA 2BCBA 1V1FA 2L50A 4YI8A 1GGWA 2MLFC 3EVRA 5CSJA 2JU0A 3F45A 1RK9A 1R2UA 2LUCA 2HPSA 2JXCA 1CDMA 3O6BA 2EHBA 2M29A 1JF0A 2ZNEA 3NSKA 1QTXA 1G4YR 1L2OC 2PSRA 4NDCA 4ORAB 1M39A 3JVTC 4ORCB 1AJ5A 3NSIA 3O4YA 1NX1A 5ER5A 3TZ1A 1FF1A 1KFXL 1NYAA 1H4BA 2KGRA 4MBEA 1M31A 5HLVA 3FWCA 1PVBA 4P5OE 1CM4A 1SYMA 1GJYA 1B8RA 1EXRA 2EC6B 1QLSA 2KAYA 4A4CA 3DVJA 2JTZA 2NZ0A 4GFTA 2NXQA 1ALVA 1S5GY 3NXAA 2FOTA 1DJHA 4GAOA 4C0KA 2AUCA 4I5LB 2OS8B 4BY4A 2ZFDA 4IL1A 1MF8B 2F2PA 1BMOA 1QXPA 2F3ZA 4MZKA 5AANA 5HYDA 1IH0A 4WQ2A 1F71A 5HKWA 3TUYC 3EK8A 1FPWA 3FIAA 4OCIA 3I5IC 1UHKA 2LANA 1UWOA 3NSOA 1QX2A 3PM8A 3A4UB 5F6TA 5AERA 1Y1AA 3I5GB 1A75B 1M63B 3D10A 1K94A 2CBLA 4HRHA 2BBNA 1IKUA 1J55A 4M2PA 1DJYA 1S26D 1TN4A 2JNXA 2BE6A 2KI4C 1KK8C 3SG4A 4D1EA 1JC2A 4N1FA 3WHUB 1ZMZA 2M97A 3BYAA 3DF0A 4CPVA 1CFDA 1YRUB 3H4SE 3KO0A 4MEWA 1YR5A 1SBJA 2ZRSA 3PALA 1F55A 1B47A 1F70A 2KOTA 2JT8A 1A29A 1B4CA 1AVSA 5HKYA 3VRRA 4GGNA 4HSZA 2KNEA 5AEQA 4PHKA 1B7TZ 1K9KA 2O60A 1B9AA 3K21A 3CR4X 2HQWA 1CLMA 1Y0VH 2KBMA 5I2QA 1AJ4A 1J7RA 4DIRA 1XVJA 2BE4A 1NCZA 1SY9A 2JOJA 3MSEB 3WXAA 3OX5A 3AAKA 1UHNA 2AAOA 2COLB 2LP3A 2ZRTA 2NCPA 4A4BA 3CS1A 1BT6A 3SIAA 2BECA 4U8DA 1TNPA 5KSZA 2LMUA 3DVEA 1TNXA 2JULA 2CXJA 1XFYO 4OR9B 2WCFA 1NIWA 3TDUA 1WRKA 3RM1A 3BUWB 3CZTX 2JTTA 1K90D 1N2DA 1TNWA 5GQQC 5IBWA 1DGVA 1FBVA 3PATA 4PE7A 4C0JA 1TRFA 1N65A 1JFKA 1NCXA 1DGUA 1SKTA 2GV5A 2KGBC 1G8IA 1YUTA 2RGIA 1IJ6A 1DJWA 2KI6D 1D1OA 1H8BA 2K7BA 2F8PA 2MLEC 4AQJA 4PHNA 1DVIA 2EC6C 1TCOB 1Y6WA 5G08A 1FW4A 1FI5A 1YURA 4ZCUA 4NDBA 2SCPA 3ZWHA 2K7CA 2OS8C 2NLNA 5DKQA 1CLBA 4YBHB 4DCKA 1QX5B 2CCMA 1JWDA 2Y4QA 5I2LA 1F54A 1XFZO 4CFRA 2IS9A 3HCMA 1JUOA 1LVCD 1A75A 1YVHA 1XO5A 2M7LA 3I5FB 1QV1A 1A2XA 2JRFA 1S5GZ 1SL7A 1IRJA 2WC8A 2QACA 1IQ5A 1CKKA 3I5GC 1ALWA 3BOWA 1HQVA 2LVKA 5AFPA 1SR6B 3C1VA 1TOPA 4BY5A 2L98A 2LV7A 2H2KA 2ZN9A 2M1KB 2M49B 2MHHA 5DKNA 1CFPA 3CR2A 4GPLB 1OSAA 5B8IB 1MHOA 2ZNDA 2KHNA 4YGCB 2M1UA 1SCMB 1Y1UA 5TNCA 1K96A 2BKIB 1QASA 2JNFA 1B8CA 2LVJA 1KK7Y 1RJVA 2H61C 4GGFC 3SG7A 4YGEB 1DF0A 2M8UA 4PE0A 2F33A 4R1EA 5AXIA 4WRIA 2EGDA 4YGBB 5K89A 1EG3A 1S1EA 5CSIA 1OMVA 1WRLA 3BUXB 1BR1B 1LA3A 1LINA 1XFXO 4MN0A 2MBXA 2K7OA 1SCVA 2BCAA 5PALA 5I2OA 1SK6D 1NUBA 1OQPA 1A03A 2LUXA 3KEVA 1U5IB 3VGOA 1OZSA 2P6BB 4GUKA 1QIVA 2KFHA 1RWYA 1B8LA 2LHLA 1ODBA 1TNQA 2FCEA 1S3PA 3HX4A 2G9BA 1XK4C 2LP2A 2Y1MA 4MZLA 3D0YB 1JFJA 1ZFSA 4F0ZB 2M9GA 1SRAA 1BJFA 2G2BA 1V1GA 4OV2A 2KDHA 2L0PA 5CSNA 5HLOA 1F4OA 4C0LA 3SJSA 4XYNA 1W7IB 1C7WA 3O78A 1TCFA 4P2YB 2K2FA 5J3XA 2KBIA
chains in the Genus database with same CATH superfamily
3CTNA 2HF5A 2YGUA 3OP0A 3D77A 3BXKA 1YUUA 2PASA 3AKBA 3IF7A 2BKHB 2PMYA 2K2AA 4JPZB 4XJKA 2LM5A 1OW4A 1AK8A 1NCYA 3K1EA 2OTGB 4PCWA 5D69A 4YGDB 2WNDA 1BLQA 2KPHA 3JTDB 2JT0A 3B86A 3R1OA 4NDDA 2KFFA 2JXLA 1QJTA 1CDPA 3PN7B 2CNPA 3TS5B 1PK0D 1K9UA 3I5FC 3OB2B 3PM2A 4HRGA 3EKJA 1XFUO 1WDCB 2MA2A 2L4HA 2QPTA 3RZSA 1OMDA 2GGMA 5KTYA 1C3ZA 4QJ3B 1R6PA 1SR6C 1TUZA 3BFAA 3GK1A 1BF5A 1OOFA 3SIBA 1UHHA 2OPOA 4OKHA 2D8NA 1DJZA 1NSHA 2WORA 1EJ3A 3GK4X 1JSAA 1CM1A 1QLKA 2GGZA 2H8VA 4PE1A 5HKZA 4F7FA 5BPJA 3R72A 1KQMC 1SW8A 1UP5A 3R1VA 1QATA 2MRDA 2Q91A 4HREE 3BUMB 3EVUA 2TN4A 4AQIA 1L7ZA 3BJHA 3EVVA 3CR5X 5FI2A 1XA5A 1BR4B 3CLNA 2V53A 3L4LA 5KU1A 1SCMC 3O2PA 2KYCA 2LE9B 4NQGA 1PALA 4I5JA 4FQOA 2FCDA 2LC5A 1B1GA 1RECA 2E6WA 1RROA 3AKAA 2WCLA 2VRGA 3LCPC 3I5HB 1DMOA 4USLA 1CMFA 1K8UA 1NX0A 3DF0B 1LXFC 3PLFB 3DYEA 2BNXA 1KWOC 1CTRA 1KCYA 3BUOB 3SG3A 4CFQA 1MR8A 1K9PA 2PYQA 1KSMA 1IJ5A 3KF9A 1PULA 2Y1NA 2QEOA 3M0WA 4PHMA 1JBAA 1KK7Z 4PDZA 1BG1A 1PSBA 3D74A 4PE4A 2KAVA 2LMTA 1UHJA 2LLUA 2SASA 3S0FA 2BL0B 4MRXA 3PSRA 1EG4A 3CGAA 1J7OA 1ZACA 3D0YA 4UPGA 1OE9B 3BUNB 4JD9A 1OOJA 1QIWA 1QVIY 4MSPA 1KQMB 3VRPA 1S36A 4KYNA 2F2OA 2Q4UA 1LS8A 1SL9A 3GK2A 2JWWA 2H61A 4GGFA 1BODA 5DKRA 1W7JB 3SG6A 3SG5A 1CDLA 1CLLA 2HQ8A 2E30A 3WHTB 2K0JA 1UHIA 3NSLA 2HETA 1YX7A 5JOLA 1JF2A 4N1GA 3VROA 3WNXB 1CDNA 1FI6A 1SL8A 2I2RE 3RLZA 1X02A 2CT9A 3EK7A 5FYXA 1SNLA 1CFCA 1GGZA 1RTP1 4L9MA 1J1DA 1UUSA 2QDIA 4OVNF 5D7FA 1KWOB 1MUXA 1K93D 2L5YA 4WQ3A 1J1EA 1KSOA 4ORBB 3KHEA 2OTGC 4GNKB 4Q04A 1CMGA 4DRWA 3ZNIA 3JTDC 1AHRA 1MXLC 3A8RA 3LK1A 2JQ6A 4CLNA 1J7PA 3DVKA 3KPXA 1YTZC 3LLEA 1K95A 1DJXA 1XK4A 4MRYA 4PALA 3FS7A 1XFWO 3PN7C 2WCEA 2AMIA 3TS5C 1NP8A 4M2QA 4MZJA 2BAPA 4N5XA 3UO9A 2K8MB 4AOMA 1WDCC 5I8NA 2K61A 3S0GA 1BU3A 2L2EA 1KFUS 3QMEA 2L4IA 1EH2A 2PRUA 1AP4A 1N0YA 3SS5A 4TNCA 1IGVA 1XYDA 4ETOA 3L47A 2ZN8A 2WCJA 3FE8A 1C7VA 2FJUB 1NPQA 4QJ5B 1ZOTB 3CZ2A 1PSRA 4QJ4B 1OZOA 2L5XB 2F3YA 2GTEA 1L2OB 3DXLA 2LMVA 4E68A 1F8HA 1TTXA 1RFJA 2K7DA 1MXEA 1E8AA 1LA0A 1F4QA 3JVTB 1HT9A 1VRKA 3IQQA 3E3RA 4FTGA 3BOWB 4ZCVA 1S6JA 1IG5A 4MLWA 1C07A 2O5GA 2WOSA 2JT3A 3SS3A 2B1UA 2KLEA 1G33A 1C3YA 2DOQA 3I5HC 1IWQA 3FE6A 1NX3A 1OOHA 1CB1A 1SMGA 1CNPA 1NX2A 3VRNA 1DJIA 2JC2A 1W9ZA 1XFVO 1Y1XA 2JZIA 4I5KA 1WRZA 5D3OA 3CABA 2MJWB 2WC6A 5CSFA 2KQYA 1SPYA 2LNKA 1KQVA 2ISDA 1KFXS 3OGNA 3OX6A 1LKJA 1WLZA 3O4XA 3OBVA 1DQEA 3FWBA 1DJGA 3IQOA 1CFFA 1DF0B 1QX7A 1AUIB 2KSPA 1EL4A 2QEHA 2BL0C 2LVVA 1MQ1A 3D73A 4YI9A 3VRQA 3TUYB 1TIZA 4YRUA 5JJGA 2KFGA 1PVAA 3I5IB 1IQ3A 3DVMA 2I18A 5ER4X 5FI7A 3CZ0A 4DUQA 1ZUZA 2M3WA 4DS7A 3OHMB 2KQ6A 4JQ0D 3SG2A 1DTLA 2I94A 2Y5IA 1QV0A 2K60A 2LLTA 1YUSA 2PVBA 2BBMA 4PHJA 1S6CA 2PALA 1S6IA 3EK4A 3N7HA 2KI4B 1KK8B 3ICBA 3S0BA 1B7TY 1NWDA 2LAPA 1GQMA 3BFHA 3CDNA 3CWGA 2KI6C 3PJIA 2NCOA 3CZ1A 2LLSA 4JWQA 2I7AA 1J7QA 1QS7A 1QVIZ 2A4JA 1UURA 2M0RA 4ICBA 1BOCA 2LVIA 2BCXA 1TUJA 4CIDA 1K2HA 3EKHA 2QEVA 3PFVA 2L51A 3GOFA 1WLMA 1U5IA 1Q80A 3AAJA 2KAXA 4I5NB 1M46A 3BQ3A 2JPTA 4MVFA 1PRWA 2KYFA 3OB1B 5CPVA 3QRXA 4GBAA 1MWNA 1OMRA 1YX8A 2MAZA 1KFUL 2M7NA 3TDIA 1YVLA 2LHIA 1M45A 2ZKMX 1WY9A 2R2IA 2CTNA 3DD4A 4M2OA 5HL1A 1DT7B 5DICA 4XJKB 1YRTB 2LCPA 2PQLA 4YGAA 2WCBA 3LK0A 3LL8B 3TDZA 1A4PA 2BCBA 1V1FA 2L50A 4YI8A 1GGWA 2MLFC 3EVRA 5CSJA 2JU0A 3L4AA 3F45A 1RK9A 1R2UA 2LUCA 2HPSA 2JXCA 1CDMA 3B88A 3O6BA 2EHBA 2M29A 1JF0A 2ZNEA 3NSKA 1QTXA 1G4YR 1L2OC 2PSRA 4NDCA 4ORAB 1T14A 1M39A 3S0DA 3JVTC 4ORCB 1AJ5A 3NSIA 3O4YA 1NX1A 5ER5A 3TZ1A 1OOIX 4INWA 1FF1A 1KFXL 3Q8IA 1NYAA 1H4BA 2KGRA 4MBEA 1M31A 5HLVA 3FWCA 1PVBA 4P5OE 1OOGA 1CM4A 1SYMA 1GJYA 1B8RA 1EXRA 2EC6B 1QLSA 2KAYA 4A4CA 2P71A 2JTZA 2NZ0A 3DVJA 2NXQA 4GFTA 1ALVA 1S5GY 3B87A 3NXAA 2FOTA 1DJHA 4GAOA 3NGVA 4C0KA 2AUCA 4I5LB 2OS8B 4BY4A 2ZFDA 2WCKA 4IL1A 1MF8B 2F2PA 1BMOA 1QXPA 2F3ZA 3NHTA 4MZKA 5AANA 5HYDA 2QEBA 1IH0A 4WQ2A 1F71A 5HKWA 3TUYC 3EK8A 1FPWA 3FIAA 1QWVA 4OCIA 3I5IC 1UHKA 5FI6A 2LANA 1UWOA 3NSOA 1QX2A 3PM8A 3A4UB 5F6TA 5AERA 2WCHA 1Y1AA 3I5GB 1A75B 1M63B 3D10A 1K94A 2CBLA 1XFRA 4HRHA 2BBNA 1IKUA 1J55A 1DELA 4M2PA 1DJYA 1S26D 1TN4A 2JNXA 2BE6A 2KI4C 1KK8C 4JKTA 3SG4A 4D1EA 4N1FA 3WHUB 1JC2A 5I94A 1ZMZA 2M97A 3BYAA 3DF0A 3DZTA 1CFDA 4CPVA 1YRUB 3H4SE 3KO0A 4MEWA 1YR5A 3D75A 1SBJA 2ZRSA 3PALA 1F55A 1B47A 1F70A 2KOTA 2KLDA 2JT8A 1A29A 1B4CA 3VB1A 1AVSA 5HKYA 3VRRA 4GGNA 4HSZA 2KNEA 5AEQA 4PHKA 1B7TZ 1K9KA 2O60A 3D76A 1B9AA 3K21A 3CR4X 3BFBA 2HQWA 1CLMA 1Y0VH 2KBMA 5I2QA 1AJ4A 1J7RA 4DIRA 1XVJA 2BE4A 1NCZA 1SY9A 2JOJA 3MSEB 4INXA 3WXAA 3OX5A 3AAKA 4PT1A 1UHNA 3EG5B 2AAOA 2COLB 2LP3A 2ZRTA 2NCPA 3S0EA 4A4BA 3CS1A 1IIOA 1BT6A 3SIAA 3B6XA 2BECA 4U8DA 1TNPA 5KSZA 2LMUA 2WC5A 1TNXA 3DVEA 4IJ7A 2JULA 2CXJA 1XFYO 4OR9B 2WCFA 1NIWA 3TDUA 1WRKA 3RM1A 3BUWB 3CZTX 2JTTA 1K90D 1N2DA 1TNWA 5GQQC 5IBWA 1DGVA 1FBVA 1GM0A 3B7AA 3PATA 4PE7A 4C0JA 1TRFA 1N65A 1JFKA 1NCXA 1DGUA 1SKTA 2GV5A 2KGBC 1G8IA 1YUTA 1Z4HA 1TWOA 2RGIA 1IJ6A 1DJWA 2KI6D 1D1OA 1H8BA 2K7BA 2F8PA 2MLEC 4AQJA 4PHNA 1DVIA 2EC6C 1TCOB 1Y6WA 3DY9A 5G08A 1FW4A 3D78A 1FI5A 4OZDA 1YURA 4ZCUA 4NDBA 2SCPA 3ZWHA 2K7CA 2OS8C 2NLNA 5DKQA 3S0AA 1CLBA 4YBHB 4DCKA 1QX5B 2CCMA 3UNWA 1JWDA 2Y4QA 5I2LA 3V2LA 1F54A 1XFZO 4CFRA 2IS9A 3HCMA 1JUOA 1LVCD 1A75A 1YVHA 1XO5A 2M7LA 3I5FB 1QV1A 4FQTA 1A2XA 2JRFA 1S5GZ 1SL7A 1IRJA 2WC8A 2QACA 1IQ5A 1CKKA 3I5GC 1ALWA 3BOWA 1HQVA 2JPOA 2LVKA 5AFPA 1SR6B 3C1VA 1TOPA 5EL2A 4BY5A 2L98A 2LV7A 2H2KA 2ZN9A 2M1KB 2M49B 2WCMA 2MHHA 5DKNA 1CFPA 3CR2A 4GPLB 1OSAA 5B8IB 1MHOA 1ORGA 2ZNDA 2KHNA 4YGCB 3SS4A 2M1UA 2P70A 1SCMB 1Y1UA 5TNCA 1K96A 2BKIB 1QASA 2JNFA 1B8CA 2LVJA 3FE9A 1KK7Y 1RJVA 2H61C 4GGFC 3SG7A 4YGEB 1DF0A 2M8UA 4PE0A 2F33A 4R1EA 5AXIA 4WRIA 2EGDA 4YGBB 5K89A 1EG3A 1S1EA 5CSIA 1OMVA 1WRLA 3BUXB 1BR1B 1LA3A 1LINA 1XFXO 4MN0A 3CYZA 1DEKA 2MBXA 2K7OA 1SCVA 2BCAA 5PALA 5I2OA 1SK6D 2ERBA 1NUBA 1OQPA 1A03A 2LUXA 1SSEB 2FJYA 3KEVA 3NHIA 1U5IB 3VGOA 1OZSA 2P6BB 3R1PA 1QIVA 2KFHA 1RWYA 4GUKA 1B8LA 2LHLA 1ODBA 1TNQA 2FCEA 1S3PA 1DC1A 3HX4A 2G9BA 1P28A 1XK4C 2LP2A 2Y1MA 3IVTA 4MZLA 1Z2CB 3D0YB 1JFJA 1ZFSA 4F0ZB 2M9GA 1SRAA 1BJFA 2G2BA 1V1GA 4OV2A 2KDHA 2L0PA 5CSNA 5HLOA 1F4OA 4C0LA 3SJSA 4XYNA 1W7IB 1C7WA 3O78A 1TCFA 4P2YB 2K2FA 2L2CA 5J3XA 2KBIA
chains in the Genus database with same CATH topology
3CTNA 2HF5A 3OP0A 3BXKA 1YUUA 2PASA 3AKBA 3IF7A 2BKHB 2PMYA 2K2AA 4JPZB 4XJKA 2LM5A 1AK8A 1NCYA 4PCWA 2OTGB 5D69A 4YGDB 2WNDA 1BLQA 3JTDB 2JT0A 4NDDA 2KFFA 2JXLA 1QJTA 1CDPA 3PN7B 2CNPA 3TS5B 1PK0D 1K9UA 3I5FC 3OB2B 4HRGA 3EKJA 1XFUO 1WDCB 2MA2A 2L4HA 2QPTA 1OMDA 2GGMA 5KTYA 4QJ3B 1R6PA 1SR6C 3GK1A 1BF5A 3SIBA 1UHHA 2OPOA 4OKHA 2D8NA 1DJZA 1NSHA 2WORA 1EJ3A 3GK4X 1JSAA 1CM1A 1QLKA 2GGZA 4PE1A 5HKZA 5BPJA 1KQMC 1SW8A 1UP5A 1QATA 2MRDA 2Q91A 4HREE 3BUMB 3EVUA 2TN4A 4AQIA 1L7ZA 3EVVA 3CR5X 1XA5A 1BR4B 3CLNA 2V53A 5KU1A 1SCMC 3O2PA 2KYCA 2LE9B 4NQGA 1PALA 4I5JA 4FQOA 2FCDA 2LC5A 1B1GA 1RECA 2E6WA 1RROA 3AKAA 3LCPC 2VRGA 3I5HB 1DMOA 4USLA 1CMFA 1K8UA 1NX0A 3DF0B 1LXFC 3PLFB 1KWOC 1CTRA 1KCYA 3BUOB 3SG3A 4CFQA 1MR8A 1K9PA 3KF9A 1KSMA 1IJ5A 1PULA 2Y1NA 3M0WA 4PHMA 1JBAA 1KK7Z 4PDZA 1BG1A 1PSBA 4PE4A 2KAVA 2LMTA 1UHJA 2LLUA 2SASA 2BL0B 4MRXA 3PSRA 1EG4A 3CGAA 1J7OA 1ZACA 3D0YA 4UPGA 1OE9B 3BUNB 1OOJA 1QIWA 1QVIY 4MSPA 1KQMB 3VRPA 1S36A 2F2OA 2Q4UA 1SL9A 3GK2A 2JWWA 2H61A 4GGFA 1BODA 5DKRA 1W7JB 3SG6A 3SG5A 1CDLA 1CLLA 2HQ8A 2E30A 3WHTB 2K0JA 1UHIA 3NSLA 2HETA 1YX7A 5JOLA 1JF2A 4N1GA 3VROA 3WNXB 1CDNA 1FI6A 1SL8A 2I2RE 3RLZA 2CT9A 1X02A 3EK7A 5FYXA 1SNLA 1CFCA 1GGZA 1RTP1 4L9MA 1J1DA 1UUSA 4OVNF 5D7FA 1KWOB 1MUXA 1K93D 4WQ3A 1J1EA 1KSOA 4ORBB 3KHEA 2OTGC 4GNKB 4Q04A 1CMGA 4DRWA 3ZNIA 3JTDC 1AHRA 1MXLC 3A8RA 3LK1A 2JQ6A 4CLNA 1J7PA 3DVKA 3KPXA 1YTZC 3LLEA 1K95A 1DJXA 1XK4A 4MRYA 4PALA 3FS7A 1XFWO 3PN7C 2WCEA 2AMIA 3TS5C 1NP8A 4M2QA 4MZJA 4N5XA 2K8MB 4AOMA 1WDCC 5I8NA 2K61A 1BU3A 2L2EA 1KFUS 2L4IA 1EH2A 2PRUA 1AP4A 1N0YA 4TNCA 1IGVA 1XYDA 4ETOA 2ZN8A 1C7VA 2FJUB 1NPQA 4QJ5B 1ZOTB 1PSRA 4QJ4B 1OZOA 2L5XB 2F3YA 1F8HA 1L2OB 4E68A 2LMVA 1TTXA 1RFJA 2K7DA 1MXEA 1E8AA 1LA0A 1F4QA 3JVTB 1HT9A 1VRKA 3IQQA 3E3RA 4FTGA 3BOWB 4ZCVA 1S6JA 1IG5A 4MLWA 1C07A 2O5GA 2WOSA 2JT3A 2B1UA 1G33A 2DOQA 3I5HC 1IWQA 1NX3A 1CB1A 1SMGA 1CNPA 1NX2A 3VRNA 1DJIA 2JC2A 2JZIA 1XFVO 1Y1XA 4I5KA 1WRZA 2MJWB 5CSFA 2KQYA 1SPYA 2LNKA 1KQVA 2ISDA 1KFXS 3OX6A 1LKJA 1WLZA 1CFFA 3FWBA 1DJGA 3IQOA 1DF0B 1QX7A 1AUIB 2KSPA 1EL4A 2BL0C 2LVVA 1MQ1A 4YI9A 3VRQA 3TUYB 1TIZA 4YRUA 5JJGA 2KFGA 1PVAA 3I5IB 1IQ3A 3DVMA 2I18A 5ER4X 4DUQA 1ZUZA 2M3WA 4DS7A 3OHMB 2KQ6A 4JQ0D 3SG2A 1DTLA 2I94A 2Y5IA 1QV0A 2LLTA 1YUSA 2PVBA 2BBMA 4PHJA 1S6CA 2PALA 1S6IA 3EK4A 2KI4B 1KK8B 3ICBA 1B7TY 1NWDA 2LAPA 1GQMA 3CWGA 2KI6C 2NCOA 2LLSA 4JWQA 2I7AA 1J7QA 1QS7A 1QVIZ 2A4JA 1UURA 2M0RA 4ICBA 1BOCA 2LVIA 2BCXA 1K2HA 4CIDA 3EKHA 3PFVA 2L51A 3GOFA 1WLMA 1U5IA 1Q80A 3AAJA 2KAXA 4I5NB 1M46A 3BQ3A 2JPTA 4MVFA 1PRWA 2KYFA 3OB1B 5CPVA 3QRXA 4GBAA 1MWNA 1OMRA 1YX8A 2MAZA 1KFUL 2M7NA 3TDIA 1YVLA 2LHIA 1M45A 2ZKMX 1WY9A 2R2IA 2CTNA 3DD4A 4M2OA 1DT7B 4XJKB 1YRTB 2LCPA 4YGAA 2WCBA 3LK0A 3LL8B 3TDZA 1A4PA 2BCBA 1V1FA 2L50A 4YI8A 1GGWA 2MLFC 3EVRA 5CSJA 2JU0A 3F45A 1RK9A 1R2UA 2LUCA 2HPSA 2JXCA 1CDMA 3O6BA 2EHBA 2M29A 1JF0A 2ZNEA 3NSKA 1QTXA 1G4YR 1L2OC 2PSRA 4NDCA 4ORAB 1M39A 3JVTC 4ORCB 1AJ5A 3NSIA 3O4YA 1NX1A 5ER5A 3TZ1A 1FF1A 1KFXL 1NYAA 1H4BA 2KGRA 4MBEA 1M31A 5HLVA 3FWCA 1PVBA 4P5OE 1CM4A 1SYMA 1GJYA 1B8RA 1EXRA 2EC6B 1QLSA 2KAYA 4A4CA 3DVJA 2JTZA 2NZ0A 4GFTA 2NXQA 1ALVA 1S5GY 3NXAA 2FOTA 1DJHA 4GAOA 4C0KA 2AUCA 4I5LB 2OS8B 4BY4A 2ZFDA 4IL1A 1MF8B 2F2PA 1BMOA 1QXPA 2F3ZA 4MZKA 5AANA 5HYDA 1IH0A 4WQ2A 1F71A 5HKWA 3TUYC 3EK8A 1FPWA 3FIAA 4OCIA 3I5IC 1UHKA 2LANA 1UWOA 3NSOA 1QX2A 3PM8A 3A4UB 5F6TA 5AERA 1Y1AA 3I5GB 1A75B 1M63B 3D10A 1K94A 2CBLA 4HRHA 2BBNA 1IKUA 1J55A 4M2PA 1DJYA 1S26D 1TN4A 2JNXA 2BE6A 2KI4C 1KK8C 3SG4A 4D1EA 1JC2A 4N1FA 3WHUB 1ZMZA 2M97A 3BYAA 3DF0A 4CPVA 1CFDA 1YRUB 3H4SE 3KO0A 4MEWA 1YR5A 1SBJA 2ZRSA 3PALA 1F55A 1B47A 1F70A 2KOTA 2JT8A 1A29A 1B4CA 1AVSA 5HKYA 3VRRA 4GGNA 4HSZA 2KNEA 5AEQA 4PHKA 1B7TZ 1K9KA 2O60A 1B9AA 3K21A 3CR4X 2HQWA 1CLMA 1Y0VH 2KBMA 5I2QA 1AJ4A 1J7RA 4DIRA 1XVJA 2BE4A 1NCZA 1SY9A 2JOJA 3MSEB 3WXAA 3OX5A 3AAKA 1UHNA 2AAOA 2COLB 2LP3A 2ZRTA 2NCPA 4A4BA 3CS1A 1BT6A 3SIAA 2BECA 4U8DA 1TNPA 5KSZA 2LMUA 3DVEA 1TNXA 2JULA 2CXJA 1XFYO 4OR9B 2WCFA 1NIWA 3TDUA 1WRKA 3RM1A 3BUWB 3CZTX 2JTTA 1K90D 1N2DA 1TNWA 5GQQC 5IBWA 1DGVA 1FBVA 3PATA 4PE7A 4C0JA 1TRFA 1N65A 1JFKA 1NCXA 1DGUA 1SKTA 2GV5A 2KGBC 1G8IA 1YUTA 2RGIA 1IJ6A 1DJWA 2KI6D 1D1OA 1H8BA 2K7BA 2F8PA 2MLEC 4AQJA 4PHNA 1DVIA 2EC6C 1TCOB 1Y6WA 5G08A 1FW4A 1FI5A 1YURA 4ZCUA 4NDBA 2SCPA 3ZWHA 2K7CA 2OS8C 2NLNA 5DKQA 1CLBA 4YBHB 4DCKA 1QX5B 2CCMA 1JWDA 2Y4QA 5I2LA 1F54A 1XFZO 4CFRA 2IS9A 3HCMA 1JUOA 1LVCD 1A75A 1YVHA 1XO5A 2M7LA 3I5FB 1QV1A 1A2XA 2JRFA 1S5GZ 1SL7A 1IRJA 2WC8A 2QACA 1IQ5A 1CKKA 3I5GC 1ALWA 3BOWA 1HQVA 2LVKA 5AFPA 1SR6B 3C1VA 1TOPA 4BY5A 2L98A 2LV7A 2H2KA 2ZN9A 2M1KB 2M49B 2MHHA 5DKNA 1CFPA 3CR2A 4GPLB 1OSAA 5B8IB 1MHOA 2ZNDA 2KHNA 4YGCB 2M1UA 1SCMB 1Y1UA 5TNCA 1K96A 2BKIB 1QASA 2JNFA 1B8CA 2LVJA 1KK7Y 1RJVA 2H61C 4GGFC 3SG7A 4YGEB 1DF0A 2M8UA 4PE0A 2F33A 4R1EA 5AXIA 4WRIA 2EGDA 4YGBB 5K89A 1EG3A 1S1EA 5CSIA 1OMVA 1WRLA 3BUXB 1BR1B 1LA3A 1LINA 1XFXO 4MN0A 2MBXA 2K7OA 1SCVA 2BCAA 5PALA 5I2OA 1SK6D 1NUBA 1OQPA 1A03A 2LUXA 3KEVA 1U5IB 3VGOA 1OZSA 2P6BB 4GUKA 1QIVA 2KFHA 1RWYA 1B8LA 2LHLA 1ODBA 1TNQA 2FCEA 1S3PA 3HX4A 2G9BA 1XK4C 2LP2A 2Y1MA 4MZLA 3D0YB 1JFJA 1ZFSA 4F0ZB 2M9GA 1SRAA 1BJFA 2G2BA 1V1GA 4OV2A 2KDHA 2L0PA 5CSNA 5HLOA 1F4OA 4C0LA 3SJSA 4XYNA 1W7IB 1C7WA 3O78A 1TCFA 4P2YB 2K2FA 5J3XA 2KBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTN A;  2HF5 A;  3OP0 A;  3BXK A;  1YUU A;  2PAS A;  3AKB A;  3IF7 A;  2BKH B;  2PMY A;  2K2A A;  4JPZ B;  4XJK A;  2LM5 A;  1AK8 A;  1NCY A;  4PCW A;  2OTG B;  5D69 A;  4YGD B;  2WND A;  1BLQ A;  3JTD B;  2JT0 A;  4NDD A;  2KFF A;  2JXL A;  1QJT A;  1CDP A;  3PN7 B;  2CNP A;  3TS5 B;  1PK0 D;  1K9U A;  3I5F C;  3OB2 B;  4HRG A;  3EKJ A;  1XFU O;  1WDC B;  2MA2 A;  2L4H A;  2QPT A;  1OMD A;  2GGM A;  5KTY A;  4QJ3 B;  1R6P A;  1SR6 C;  3GK1 A;  1BF5 A;  3SIB A;  1UHH A;  2OPO A;  4OKH A;  2D8N A;  1DJZ A;  1NSH A;  2WOR A;  1EJ3 A;  3GK4 X;  1JSA A;  1CM1 A;  1QLK A;  2GGZ A;  4PE1 A;  5HKZ A;  5BPJ A;  1KQM C;  1SW8 A;  1UP5 A;  1QAT A;  2MRD A;  2Q91 A;  4HRE E;  3BUM B;  3EVU A;  2TN4 A;  4AQI A;  1L7Z A;  3EVV A;  3CR5 X;  1XA5 A;  1BR4 B;  3CLN A;  2V53 A;  5KU1 A;  1SCM C;  3O2P A;  2KYC A;  2LE9 B;  4NQG A;  1PAL A;  4I5J A;  4FQO A;  2FCD A;  2LC5 A;  1B1G A;  1REC A;  2E6W A;  1RRO A;  3AKA A;  3LCP C;  2VRG A;  3I5H B;  1DMO A;  4USL A;  1CMF A;  1K8U A;  1NX0 A;  3DF0 B;  1LXF C;  3PLF B;  1KWO C;  1CTR A;  1KCY A;  3BUO B;  3SG3 A;  4CFQ A;  1MR8 A;  1K9P A;  3KF9 A;  1KSM A;  1IJ5 A;  1PUL A;  2Y1N A;  3M0W A;  4PHM A;  1JBA A;  1KK7 Z;  4PDZ A;  1BG1 A;  1PSB A;  4PE4 A;  2KAV A;  2LMT A;  1UHJ A;  2LLU A;  2SAS A;  2BL0 B;  4MRX A;  3PSR A;  1EG4 A;  3CGA A;  1J7O A;  1ZAC A;  3D0Y A;  4UPG A;  1OE9 B;  3BUN B;  1OOJ A;  1QIW A;  1QVI Y;  4MSP A;  1KQM B;  3VRP A;  1S36 A;  2F2O A;  2Q4U A;  1SL9 A;  3GK2 A;  2JWW A;  2H61 A;  4GGF A;  1BOD A;  5DKR A;  1W7J B;  3SG6 A;  3SG5 A;  1CDL A;  1CLL A;  2HQ8 A;  2E30 A;  3WHT B;  2K0J A;  1UHI A;  3NSL A;  2HET A;  1YX7 A;  5JOL A;  1JF2 A;  4N1G A;  3VRO A;  3WNX B;  1CDN A;  1FI6 A;  1SL8 A;  2I2R E;  3RLZ A;  2CT9 A;  1X02 A;  3EK7 A;  5FYX A;  1SNL A;  1CFC A;  1GGZ A;  1RTP 1;  4L9M A;  1J1D A;  1UUS A;  4OVN F;  5D7F A;  1KWO B;  1MUX A;  1K93 D;  4WQ3 A;  1J1E A;  1KSO A;  4ORB B;  3KHE A;  2OTG C;  4GNK B;  4Q04 A;  1CMG A;  4DRW A;  3ZNI A;  3JTD C;  1AHR A;  1MXL C;  3A8R A;  3LK1 A;  2JQ6 A;  4CLN A;  1J7P A;  3DVK A;  3KPX A;  1YTZ C;  3LLE A;  1K95 A;  1DJX A;  1XK4 A;  4MRY A;  4PAL A;  3FS7 A;  1XFW O;  3PN7 C;  2WCE A;  2AMI A;  3TS5 C;  1NP8 A;  4M2Q A;  4MZJ A;  4N5X A;  2K8M B;  4AOM A;  1WDC C;  5I8N A;  2K61 A;  1BU3 A;  2L2E A;  1KFU S;  2L4I A;  1EH2 A;  2PRU A;  1AP4 A;  1N0Y A;  4TNC A;  1IGV A;  1XYD A;  4ETO A;  2ZN8 A;  1C7V A;  2FJU B;  1NPQ A;  4QJ5 B;  1ZOT B;  1PSR A;  4QJ4 B;  1OZO A;  2L5X B;  2F3Y A;  1F8H A;  1L2O B;  4E68 A;  2LMV A;  1TTX A;  1RFJ A;  2K7D A;  1MXE A;  1E8A A;  1LA0 A;  1F4Q A;  3JVT B;  1HT9 A;  1VRK A;  3IQQ A;  3E3R A;  4FTG A;  3BOW B;  4ZCV A;  1S6J A;  1IG5 A;  4MLW A;  1C07 A;  2O5G A;  2WOS A;  2JT3 A;  2B1U A;  1G33 A;  2DOQ A;  3I5H C;  1IWQ A;  1NX3 A;  1CB1 A;  1SMG A;  1CNP A;  1NX2 A;  3VRN A;  1DJI A;  2JC2 A;  2JZI A;  1XFV O;  1Y1X A;  4I5K A;  1WRZ A;  2MJW B;  5CSF A;  2KQY A;  1SPY A;  2LNK A;  1KQV A;  2ISD A;  1KFX S;  3OX6 A;  1LKJ A;  1WLZ A;  1CFF A;  3FWB A;  1DJG A;  3IQO A;  1DF0 B;  1QX7 A;  1AUI B;  2KSP A;  1EL4 A;  2BL0 C;  2LVV A;  1MQ1 A;  4YI9 A;  3VRQ A;  3TUY B;  1TIZ A;  4YRU A;  5JJG A;  2KFG A;  1PVA A;  3I5I B;  1IQ3 A;  3DVM A;  2I18 A;  5ER4 X;  4DUQ A;  1ZUZ A;  2M3W A;  4DS7 A;  3OHM B;  2KQ6 A;  4JQ0 D;  3SG2 A;  1DTL A;  2I94 A;  2Y5I A;  1QV0 A;  2LLT A;  1YUS A;  2PVB A;  2BBM A;  4PHJ A;  1S6C A;  2PAL A;  1S6I A;  3EK4 A;  2KI4 B;  1KK8 B;  3ICB A;  1B7T Y;  1NWD A;  2LAP A;  1GQM A;  3CWG A;  2KI6 C;  2NCO A;  2LLS A;  4JWQ A;  2I7A A;  1J7Q A;  1QS7 A;  1QVI Z;  2A4J A;  1UUR A;  2M0R A;  4ICB A;  1BOC A;  2LVI A;  2BCX A;  1K2H A;  4CID A;  3EKH A;  3PFV A;  2L51 A;  3GOF A;  1WLM A;  1U5I A;  1Q80 A;  3AAJ A;  2KAX A;  4I5N B;  1M46 A;  3BQ3 A;  2JPT A;  4MVF A;  1PRW A;  2KYF A;  3OB1 B;  5CPV A;  3QRX A;  4GBA A;  1MWN A;  1OMR A;  1YX8 A;  2MAZ A;  1KFU L;  2M7N A;  3TDI A;  1YVL A;  2LHI A;  1M45 A;  2ZKM X;  1WY9 A;  2R2I A;  2CTN A;  3DD4 A;  4M2O A;  1DT7 B;  4XJK B;  1YRT B;  2LCP A;  4YGA A;  2WCB A;  3LK0 A;  3LL8 B;  3TDZ A;  1A4P A;  2BCB A;  1V1F A;  2L50 A;  4YI8 A;  1GGW A;  2MLF C;  3EVR A;  5CSJ A;  2JU0 A;  3F45 A;  1RK9 A;  1R2U A;  2LUC A;  2HPS A;  2JXC A;  1CDM A;  3O6B A;  2EHB A;  2M29 A;  1JF0 A;  2ZNE A;  3NSK A;  1QTX A;  1G4Y R;  1L2O C;  2PSR A;  4NDC A;  4ORA B;  1M39 A;  3JVT C;  4ORC B;  1AJ5 A;  3NSI A;  3O4Y A;  1NX1 A;  5ER5 A;  3TZ1 A;  1FF1 A;  1KFX L;  1NYA A;  1H4B A;  2KGR A;  4MBE A;  1M31 A;  5HLV A;  3FWC A;  1PVB A;  4P5O E;  1CM4 A;  1SYM A;  1GJY A;  1B8R A;  1EXR A;  2EC6 B;  1QLS A;  2KAY A;  4A4C A;  3DVJ A;  2JTZ A;  2NZ0 A;  4GFT A;  2NXQ A;  1ALV A;  1S5G Y;  3NXA A;  2FOT A;  1DJH A;  4GAO A;  4C0K A;  2AUC A;  4I5L B;  2OS8 B;  4BY4 A;  2ZFD A;  4IL1 A;  1MF8 B;  2F2P A;  1BMO A;  1QXP A;  2F3Z A;  4MZK A;  5AAN A;  5HYD A;  1IH0 A;  4WQ2 A;  1F71 A;  5HKW A;  3TUY C;  3EK8 A;  1FPW A;  3FIA A;  4OCI A;  3I5I C;  1UHK A;  2LAN A;  1UWO A;  3NSO A;  1QX2 A;  3PM8 A;  3A4U B;  5F6T A;  5AER A;  1Y1A A;  3I5G B;  1A75 B;  1M63 B;  3D10 A;  1K94 A;  2CBL A;  4HRH A;  2BBN A;  1IKU A;  1J55 A;  4M2P A;  1DJY A;  1S26 D;  1TN4 A;  2JNX A;  2BE6 A;  2KI4 C;  1KK8 C;  3SG4 A;  4D1E A;  1JC2 A;  4N1F A;  3WHU B;  1ZMZ A;  2M97 A;  3BYA A;  3DF0 A;  4CPV A;  1CFD A;  1YRU B;  3H4S E;  3KO0 A;  4MEW A;  1YR5 A;  1SBJ A;  2ZRS A;  3PAL A;  1F55 A;  1B47 A;  1F70 A;  2KOT A;  2JT8 A;  1A29 A;  1B4C A;  1AVS A;  5HKY A;  3VRR A;  4GGN A;  4HSZ A;  2KNE A;  5AEQ A;  4PHK A;  1B7T Z;  1K9K A;  2O60 A;  1B9A A;  3K21 A;  3CR4 X;  2HQW A;  1CLM A;  1Y0V H;  2KBM A;  5I2Q A;  1AJ4 A;  1J7R A;  4DIR A;  1XVJ A;  2BE4 A;  1NCZ A;  1SY9 A;  2JOJ A;  3MSE B;  3WXA A;  3OX5 A;  3AAK A;  1UHN A;  2AAO A;  2COL B;  2LP3 A;  2ZRT A;  2NCP A;  4A4B A;  3CS1 A;  1BT6 A;  3SIA A;  2BEC A;  4U8D A;  1TNP A;  5KSZ A;  2LMU A;  3DVE A;  1TNX A;  2JUL A;  2CXJ A;  1XFY O;  4OR9 B;  2WCF A;  1NIW A;  3TDU A;  1WRK A;  3RM1 A;  3BUW B;  3CZT X;  2JTT A;  1K90 D;  1N2D A;  1TNW A;  5GQQ C;  5IBW A;  1DGV A;  1FBV A;  3PAT A;  4PE7 A;  4C0J A;  1TRF A;  1N65 A;  1JFK A;  1NCX A;  1DGU A;  1SKT A;  2GV5 A;  2KGB C;  1G8I A;  1YUT A;  2RGI A;  1IJ6 A;  1DJW A;  2KI6 D;  1D1O A;  1H8B A;  2K7B A;  2F8P A;  2MLE C;  4AQJ A;  4PHN A;  1DVI A;  2EC6 C;  1TCO B;  1Y6W A;  5G08 A;  1FW4 A;  1FI5 A;  1YUR A;  4ZCU A;  4NDB A;  2SCP A;  3ZWH A;  2K7C A;  2OS8 C;  2NLN A;  5DKQ A;  1CLB A;  4YBH B;  4DCK A;  1QX5 B;  2CCM A;  1JWD A;  2Y4Q A;  5I2L A;  1F54 A;  1XFZ O;  4CFR A;  2IS9 A;  3HCM A;  1JUO A;  1LVC D;  1A75 A;  1YVH A;  1XO5 A;  2M7L A;  3I5F B;  1QV1 A;  1A2X A;  2JRF A;  1S5G Z;  1SL7 A;  1IRJ A;  2WC8 A;  2QAC A;  1IQ5 A;  1CKK A;  3I5G C;  1ALW A;  3BOW A;  1HQV A;  2LVK A;  5AFP A;  1SR6 B;  3C1V A;  1TOP A;  4BY5 A;  2L98 A;  2LV7 A;  2H2K A;  2ZN9 A;  2M1K B;  2M49 B;  2MHH A;  5DKN A;  1CFP A;  3CR2 A;  4GPL B;  1OSA A;  5B8I B;  1MHO A;  2ZND A;  2KHN A;  4YGC B;  2M1U A;  1SCM B;  1Y1U A;  5TNC A;  1K96 A;  2BKI B;  1QAS A;  2JNF A;  1B8C A;  2LVJ A;  1KK7 Y;  1RJV A;  2H61 C;  4GGF C;  3SG7 A;  4YGE B;  1DF0 A;  2M8U A;  4PE0 A;  2F33 A;  4R1E A;  5AXI A;  4WRI A;  2EGD A;  4YGB B;  5K89 A;  1EG3 A;  1S1E A;  5CSI A;  1OMV A;  1WRL A;  3BUX B;  1BR1 B;  1LA3 A;  1LIN A;  1XFX O;  4MN0 A;  2MBX A;  2K7O A;  1SCV A;  2BCA A;  5PAL A;  5I2O A;  1SK6 D;  1NUB A;  1OQP A;  1A03 A;  2LUX A;  3KEV A;  1U5I B;  3VGO A;  1OZS A;  2P6B B;  4GUK A;  1QIV A;  2KFH A;  1RWY A;  1B8L A;  2LHL A;  1ODB A;  1TNQ A;  2FCE A;  1S3P A;  3HX4 A;  2G9B A;  1XK4 C;  2LP2 A;  2Y1M A;  4MZL A;  3D0Y B;  1JFJ A;  1ZFS A;  4F0Z B;  2M9G A;  1SRA A;  1BJF A;  2G2B A;  1V1G A;  4OV2 A;  2KDH A;  2L0P A;  5CSN A;  5HLO A;  1F4O A;  4C0L A;  3SJS A;  4XYN A;  1W7I B;  1C7W A;  3O78 A;  1TCF A;  4P2Y B;  2K2F A;  5J3X A;  2KBI A; 
#chains in the Genus database with same CATH topology
 3CTN A;  2HF5 A;  2YGU A;  3OP0 A;  3D77 A;  3BXK A;  1YUU A;  2PAS A;  3AKB A;  3IF7 A;  2BKH B;  2PMY A;  2K2A A;  4JPZ B;  4XJK A;  2LM5 A;  1OW4 A;  1AK8 A;  1NCY A;  3K1E A;  2OTG B;  4PCW A;  5D69 A;  4YGD B;  2WND A;  1BLQ A;  2KPH A;  3JTD B;  2JT0 A;  3B86 A;  3R1O A;  4NDD A;  2KFF A;  2JXL A;  1QJT A;  1CDP A;  3PN7 B;  2CNP A;  3TS5 B;  1PK0 D;  1K9U A;  3I5F C;  3OB2 B;  3PM2 A;  4HRG A;  3EKJ A;  1XFU O;  1WDC B;  2MA2 A;  2L4H A;  2QPT A;  3RZS A;  1OMD A;  2GGM A;  5KTY A;  1C3Z A;  4QJ3 B;  1R6P A;  1SR6 C;  1TUZ A;  3BFA A;  3GK1 A;  1BF5 A;  1OOF A;  3SIB A;  1UHH A;  2OPO A;  4OKH A;  2D8N A;  1DJZ A;  1NSH A;  2WOR A;  1EJ3 A;  3GK4 X;  1JSA A;  1CM1 A;  1QLK A;  2GGZ A;  2H8V A;  4PE1 A;  5HKZ A;  4F7F A;  5BPJ A;  3R72 A;  1KQM C;  1SW8 A;  1UP5 A;  3R1V A;  1QAT A;  2MRD A;  2Q91 A;  4HRE E;  3BUM B;  3EVU A;  2TN4 A;  4AQI A;  1L7Z A;  3BJH A;  3EVV A;  3CR5 X;  5FI2 A;  1XA5 A;  1BR4 B;  3CLN A;  2V53 A;  3L4L A;  5KU1 A;  1SCM C;  3O2P A;  2KYC A;  2LE9 B;  4NQG A;  1PAL A;  4I5J A;  4FQO A;  2FCD A;  2LC5 A;  1B1G A;  1REC A;  2E6W A;  1RRO A;  3AKA A;  2WCL A;  2VRG A;  3LCP C;  3I5H B;  1DMO A;  4USL A;  1CMF A;  1K8U A;  1NX0 A;  3DF0 B;  1LXF C;  3PLF B;  3DYE A;  2BNX A;  1KWO C;  1CTR A;  1KCY A;  3BUO B;  3SG3 A;  4CFQ A;  1MR8 A;  1K9P A;  2PYQ A;  1KSM A;  1IJ5 A;  3KF9 A;  1PUL A;  2Y1N A;  2QEO A;  3M0W A;  4PHM A;  1JBA A;  1KK7 Z;  4PDZ A;  1BG1 A;  1PSB A;  3D74 A;  4PE4 A;  2KAV A;  2LMT A;  1UHJ A;  2LLU A;  2SAS A;  3S0F A;  2BL0 B;  4MRX A;  3PSR A;  1EG4 A;  3CGA A;  1J7O A;  1ZAC A;  3D0Y A;  4UPG A;  1OE9 B;  3BUN B;  4JD9 A;  1OOJ A;  1QIW A;  1QVI Y;  4MSP A;  1KQM B;  3VRP A;  1S36 A;  4KYN A;  2F2O A;  2Q4U A;  1LS8 A;  1SL9 A;  3GK2 A;  2JWW A;  2H61 A;  4GGF A;  1BOD A;  5DKR A;  1W7J B;  3SG6 A;  3SG5 A;  1CDL A;  1CLL A;  2HQ8 A;  2E30 A;  3WHT B;  2K0J A;  1UHI A;  3NSL A;  2HET A;  1YX7 A;  5JOL A;  1JF2 A;  4N1G A;  3VRO A;  3WNX B;  1CDN A;  1FI6 A;  1SL8 A;  2I2R E;  3RLZ A;  1X02 A;  2CT9 A;  3EK7 A;  5FYX A;  1SNL A;  1CFC A;  1GGZ A;  1RTP 1;  4L9M A;  1J1D A;  1UUS A;  2QDI A;  4OVN F;  5D7F A;  1KWO B;  1MUX A;  1K93 D;  2L5Y A;  4WQ3 A;  1J1E A;  1KSO A;  4ORB B;  3KHE A;  2OTG C;  4GNK B;  4Q04 A;  1CMG A;  4DRW A;  3ZNI A;  3JTD C;  1AHR A;  1MXL C;  3A8R A;  3LK1 A;  2JQ6 A;  4CLN A;  1J7P A;  3DVK A;  3KPX A;  1YTZ C;  3LLE A;  1K95 A;  1DJX A;  1XK4 A;  4MRY A;  4PAL A;  3FS7 A;  1XFW O;  3PN7 C;  2WCE A;  2AMI A;  3TS5 C;  1NP8 A;  4M2Q A;  4MZJ A;  2BAP A;  4N5X A;  3UO9 A;  2K8M B;  4AOM A;  1WDC C;  5I8N A;  2K61 A;  3S0G A;  1BU3 A;  2L2E A;  1KFU S;  3QME A;  2L4I A;  1EH2 A;  2PRU A;  1AP4 A;  1N0Y A;  3SS5 A;  4TNC A;  1IGV A;  1XYD A;  4ETO A;  3L47 A;  2ZN8 A;  2WCJ A;  3FE8 A;  1C7V A;  2FJU B;  1NPQ A;  4QJ5 B;  1ZOT B;  3CZ2 A;  1PSR A;  4QJ4 B;  1OZO A;  2L5X B;  2F3Y A;  2GTE A;  1L2O B;  3DXL A;  2LMV A;  4E68 A;  1F8H A;  1TTX A;  1RFJ A;  2K7D A;  1MXE A;  1E8A A;  1LA0 A;  1F4Q A;  3JVT B;  1HT9 A;  1VRK A;  3IQQ A;  3E3R A;  4FTG A;  3BOW B;  4ZCV A;  1S6J A;  1IG5 A;  4MLW A;  1C07 A;  2O5G A;  2WOS A;  2JT3 A;  3SS3 A;  2B1U A;  2KLE A;  1G33 A;  1C3Y A;  2DOQ A;  3I5H C;  1IWQ A;  3FE6 A;  1NX3 A;  1OOH A;  1CB1 A;  1SMG A;  1CNP A;  1NX2 A;  3VRN A;  1DJI A;  2JC2 A;  1W9Z A;  1XFV O;  1Y1X A;  2JZI A;  4I5K A;  1WRZ A;  5D3O A;  3CAB A;  2MJW B;  2WC6 A;  5CSF A;  2KQY A;  1SPY A;  2LNK A;  1KQV A;  2ISD A;  1KFX S;  3OGN A;  3OX6 A;  1LKJ A;  1WLZ A;  3O4X A;  3OBV A;  1DQE A;  3FWB A;  1DJG A;  3IQO A;  1CFF A;  1DF0 B;  1QX7 A;  1AUI B;  2KSP A;  1EL4 A;  2QEH A;  2BL0 C;  2LVV A;  1MQ1 A;  3D73 A;  4YI9 A;  3VRQ A;  3TUY B;  1TIZ A;  4YRU A;  5JJG A;  2KFG A;  1PVA A;  3I5I B;  1IQ3 A;  3DVM A;  2I18 A;  5ER4 X;  5FI7 A;  3CZ0 A;  4DUQ A;  1ZUZ A;  2M3W A;  4DS7 A;  3OHM B;  2KQ6 A;  4JQ0 D;  3SG2 A;  1DTL A;  2I94 A;  2Y5I A;  1QV0 A;  2K60 A;  2LLT A;  1YUS A;  2PVB A;  2BBM A;  4PHJ A;  1S6C A;  2PAL A;  1S6I A;  3EK4 A;  3N7H A;  2KI4 B;  1KK8 B;  3ICB A;  3S0B A;  1B7T Y;  1NWD A;  2LAP A;  1GQM A;  3BFH A;  3CDN A;  3CWG A;  2KI6 C;  3PJI A;  2NCO A;  3CZ1 A;  2LLS A;  4JWQ A;  2I7A A;  1J7Q A;  1QS7 A;  1QVI Z;  2A4J A;  1UUR A;  2M0R A;  4ICB A;  1BOC A;  2LVI A;  2BCX A;  1TUJ A;  4CID A;  1K2H A;  3EKH A;  2QEV A;  3PFV A;  2L51 A;  3GOF A;  1WLM A;  1U5I A;  1Q80 A;  3AAJ A;  2KAX A;  4I5N B;  1M46 A;  3BQ3 A;  2JPT A;  4MVF A;  1PRW A;  2KYF A;  3OB1 B;  5CPV A;  3QRX A;  4GBA A;  1MWN A;  1OMR A;  1YX8 A;  2MAZ A;  1KFU L;  2M7N A;  3TDI A;  1YVL A;  2LHI A;  1M45 A;  2ZKM X;  1WY9 A;  2R2I A;  2CTN A;  3DD4 A;  4M2O A;  5HL1 A;  1DT7 B;  5DIC A;  4XJK B;  1YRT B;  2LCP A;  2PQL A;  4YGA A;  2WCB A;  3LK0 A;  3LL8 B;  3TDZ A;  1A4P A;  2BCB A;  1V1F A;  2L50 A;  4YI8 A;  1GGW A;  2MLF C;  3EVR A;  5CSJ A;  2JU0 A;  3L4A A;  3F45 A;  1RK9 A;  1R2U A;  2LUC A;  2HPS A;  2JXC A;  1CDM A;  3B88 A;  3O6B A;  2EHB A;  2M29 A;  1JF0 A;  2ZNE A;  3NSK A;  1QTX A;  1G4Y R;  1L2O C;  2PSR A;  4NDC A;  4ORA B;  1T14 A;  1M39 A;  3S0D A;  3JVT C;  4ORC B;  1AJ5 A;  3NSI A;  3O4Y A;  1NX1 A;  5ER5 A;  3TZ1 A;  1OOI X;  4INW A;  1FF1 A;  1KFX L;  3Q8I A;  1NYA A;  1H4B A;  2KGR A;  4MBE A;  1M31 A;  5HLV A;  3FWC A;  1PVB A;  4P5O E;  1OOG A;  1CM4 A;  1SYM A;  1GJY A;  1B8R A;  1EXR A;  2EC6 B;  1QLS A;  2KAY A;  4A4C A;  2P71 A;  2JTZ A;  2NZ0 A;  3DVJ A;  2NXQ A;  4GFT A;  1ALV A;  1S5G Y;  3B87 A;  3NXA A;  2FOT A;  1DJH A;  4GAO A;  3NGV A;  4C0K A;  2AUC A;  4I5L B;  2OS8 B;  4BY4 A;  2ZFD A;  2WCK A;  4IL1 A;  1MF8 B;  2F2P A;  1BMO A;  1QXP A;  2F3Z A;  3NHT A;  4MZK A;  5AAN A;  5HYD A;  2QEB A;  1IH0 A;  4WQ2 A;  1F71 A;  5HKW A;  3TUY C;  3EK8 A;  1FPW A;  3FIA A;  1QWV A;  4OCI A;  3I5I C;  1UHK A;  5FI6 A;  2LAN A;  1UWO A;  3NSO A;  1QX2 A;  3PM8 A;  3A4U B;  5F6T A;  5AER A;  2WCH A;  1Y1A A;  3I5G B;  1A75 B;  1M63 B;  3D10 A;  1K94 A;  2CBL A;  1XFR A;  4HRH A;  2BBN A;  1IKU A;  1J55 A;  1DEL A;  4M2P A;  1DJY A;  1S26 D;  1TN4 A;  2JNX A;  2BE6 A;  2KI4 C;  1KK8 C;  4JKT A;  3SG4 A;  4D1E A;  4N1F A;  3WHU B;  1JC2 A;  5I94 A;  1ZMZ A;  2M97 A;  3BYA A;  3DF0 A;  3DZT A;  1CFD A;  4CPV A;  1YRU B;  3H4S E;  3KO0 A;  4MEW A;  1YR5 A;  3D75 A;  1SBJ A;  2ZRS A;  3PAL A;  1F55 A;  1B47 A;  1F70 A;  2KOT A;  2KLD A;  2JT8 A;  1A29 A;  1B4C A;  3VB1 A;  1AVS A;  5HKY A;  3VRR A;  4GGN A;  4HSZ A;  2KNE A;  5AEQ A;  4PHK A;  1B7T Z;  1K9K A;  2O60 A;  3D76 A;  1B9A A;  3K21 A;  3CR4 X;  3BFB A;  2HQW A;  1CLM A;  1Y0V H;  2KBM A;  5I2Q A;  1AJ4 A;  1J7R A;  4DIR A;  1XVJ A;  2BE4 A;  1NCZ A;  1SY9 A;  2JOJ A;  3MSE B;  4INX A;  3WXA A;  3OX5 A;  3AAK A;  4PT1 A;  1UHN A;  3EG5 B;  2AAO A;  2COL B;  2LP3 A;  2ZRT A;  2NCP A;  3S0E A;  4A4B A;  3CS1 A;  1IIO A;  1BT6 A;  3SIA A;  3B6X A;  2BEC A;  4U8D A;  1TNP A;  5KSZ A;  2LMU A;  2WC5 A;  1TNX A;  3DVE A;  4IJ7 A;  2JUL A;  2CXJ A;  1XFY O;  4OR9 B;  2WCF A;  1NIW A;  3TDU A;  1WRK A;  3RM1 A;  3BUW B;  3CZT X;  2JTT A;  1K90 D;  1N2D A;  1TNW A;  5GQQ C;  5IBW A;  1DGV A;  1FBV A;  1GM0 A;  3B7A A;  3PAT A;  4PE7 A;  4C0J A;  1TRF A;  1N65 A;  1JFK A;  1NCX A;  1DGU A;  1SKT A;  2GV5 A;  2KGB C;  1G8I A;  1YUT A;  1Z4H A;  1TWO A;  2RGI A;  1IJ6 A;  1DJW A;  2KI6 D;  1D1O A;  1H8B A;  2K7B A;  2F8P A;  2MLE C;  4AQJ A;  4PHN A;  1DVI A;  2EC6 C;  1TCO B;  1Y6W A;  3DY9 A;  5G08 A;  1FW4 A;  3D78 A;  1FI5 A;  4OZD A;  1YUR A;  4ZCU A;  4NDB A;  2SCP A;  3ZWH A;  2K7C A;  2OS8 C;  2NLN A;  5DKQ A;  3S0A A;  1CLB A;  4YBH B;  4DCK A;  1QX5 B;  2CCM A;  3UNW A;  1JWD A;  2Y4Q A;  5I2L A;  3V2L A;  1F54 A;  1XFZ O;  4CFR A;  2IS9 A;  3HCM A;  1JUO A;  1LVC D;  1A75 A;  1YVH A;  1XO5 A;  2M7L A;  3I5F B;  1QV1 A;  4FQT A;  1A2X A;  2JRF A;  1S5G Z;  1SL7 A;  1IRJ A;  2WC8 A;  2QAC A;  1IQ5 A;  1CKK A;  3I5G C;  1ALW A;  3BOW A;  1HQV A;  2JPO A;  2LVK A;  5AFP A;  1SR6 B;  3C1V A;  1TOP A;  5EL2 A;  4BY5 A;  2L98 A;  2LV7 A;  2H2K A;  2ZN9 A;  2M1K B;  2M49 B;  2WCM A;  2MHH A;  5DKN A;  1CFP A;  3CR2 A;  4GPL B;  1OSA A;  5B8I B;  1MHO A;  1ORG A;  2ZND A;  2KHN A;  4YGC B;  3SS4 A;  2M1U A;  2P70 A;  1SCM B;  1Y1U A;  5TNC A;  1K96 A;  2BKI B;  1QAS A;  2JNF A;  1B8C A;  2LVJ A;  3FE9 A;  1KK7 Y;  1RJV A;  2H61 C;  4GGF C;  3SG7 A;  4YGE B;  1DF0 A;  2M8U A;  4PE0 A;  2F33 A;  4R1E A;  5AXI A;  4WRI A;  2EGD A;  4YGB B;  5K89 A;  1EG3 A;  1S1E A;  5CSI A;  1OMV A;  1WRL A;  3BUX B;  1BR1 B;  1LA3 A;  1LIN A;  1XFX O;  4MN0 A;  3CYZ A;  1DEK A;  2MBX A;  2K7O A;  1SCV A;  2BCA A;  5PAL A;  5I2O A;  1SK6 D;  2ERB A;  1NUB A;  1OQP A;  1A03 A;  2LUX A;  1SSE B;  2FJY A;  3KEV A;  3NHI A;  1U5I B;  3VGO A;  1OZS A;  2P6B B;  3R1P A;  1QIV A;  2KFH A;  1RWY A;  4GUK A;  1B8L A;  2LHL A;  1ODB A;  1TNQ A;  2FCE A;  1S3P A;  1DC1 A;  3HX4 A;  2G9B A;  1P28 A;  1XK4 C;  2LP2 A;  2Y1M A;  3IVT A;  4MZL A;  1Z2C B;  3D0Y B;  1JFJ A;  1ZFS A;  4F0Z B;  2M9G A;  1SRA A;  1BJF A;  2G2B A;  1V1G A;  4OV2 A;  2KDH A;  2L0P A;  5CSN A;  5HLO A;  1F4O A;  4C0L A;  3SJS A;  4XYN A;  1W7I B;  1C7W A;  3O78 A;  1TCF A;  4P2Y B;  2K2F A;  2L2C A;  5J3X A;  2KBI A; 
#chains in the Genus database with same CATH homology
 3CTN A;  2HF5 A;  3OP0 A;  3BXK A;  1YUU A;  2PAS A;  3AKB A;  3IF7 A;  2BKH B;  2PMY A;  2K2A A;  4JPZ B;  4XJK A;  2LM5 A;  1AK8 A;  1NCY A;  4PCW A;  2OTG B;  5D69 A;  4YGD B;  2WND A;  1BLQ A;  3JTD B;  2JT0 A;  4NDD A;  2KFF A;  2JXL A;  1QJT A;  1CDP A;  3PN7 B;  2CNP A;  3TS5 B;  1PK0 D;  1K9U A;  3I5F C;  3OB2 B;  4HRG A;  3EKJ A;  1XFU O;  1WDC B;  2MA2 A;  2L4H A;  2QPT A;  1OMD A;  2GGM A;  5KTY A;  4QJ3 B;  1R6P A;  1SR6 C;  3GK1 A;  1BF5 A;  3SIB A;  1UHH A;  2OPO A;  4OKH A;  2D8N A;  1DJZ A;  1NSH A;  2WOR A;  1EJ3 A;  3GK4 X;  1JSA A;  1CM1 A;  1QLK A;  2GGZ A;  4PE1 A;  5HKZ A;  5BPJ A;  1KQM C;  1SW8 A;  1UP5 A;  1QAT A;  2MRD A;  2Q91 A;  4HRE E;  3BUM B;  3EVU A;  2TN4 A;  4AQI A;  1L7Z A;  3EVV A;  3CR5 X;  1XA5 A;  1BR4 B;  3CLN A;  2V53 A;  5KU1 A;  1SCM C;  3O2P A;  2KYC A;  2LE9 B;  4NQG A;  1PAL A;  4I5J A;  4FQO A;  2FCD A;  2LC5 A;  1B1G A;  1REC A;  2E6W A;  1RRO A;  3AKA A;  3LCP C;  2VRG A;  3I5H B;  1DMO A;  4USL A;  1CMF A;  1K8U A;  1NX0 A;  3DF0 B;  1LXF C;  3PLF B;  1KWO C;  1CTR A;  1KCY A;  3BUO B;  3SG3 A;  4CFQ A;  1MR8 A;  1K9P A;  3KF9 A;  1KSM A;  1IJ5 A;  1PUL A;  2Y1N A;  3M0W A;  4PHM A;  1JBA A;  1KK7 Z;  4PDZ A;  1BG1 A;  1PSB A;  4PE4 A;  2KAV A;  2LMT A;  1UHJ A;  2LLU A;  2SAS A;  2BL0 B;  4MRX A;  3PSR A;  1EG4 A;  3CGA A;  1J7O A;  1ZAC A;  3D0Y A;  4UPG A;  1OE9 B;  3BUN B;  1OOJ A;  1QIW A;  1QVI Y;  4MSP A;  1KQM B;  3VRP A;  1S36 A;  2F2O A;  2Q4U A;  1SL9 A;  3GK2 A;  2JWW A;  2H61 A;  4GGF A;  1BOD A;  5DKR A;  1W7J B;  3SG6 A;  3SG5 A;  1CDL A;  1CLL A;  2HQ8 A;  2E30 A;  3WHT B;  2K0J A;  1UHI A;  3NSL A;  2HET A;  1YX7 A;  5JOL A;  1JF2 A;  4N1G A;  3VRO A;  3WNX B;  1CDN A;  1FI6 A;  1SL8 A;  2I2R E;  3RLZ A;  2CT9 A;  1X02 A;  3EK7 A;  5FYX A;  1SNL A;  1CFC A;  1GGZ A;  1RTP 1;  4L9M A;  1J1D A;  1UUS A;  4OVN F;  5D7F A;  1KWO B;  1MUX A;  1K93 D;  4WQ3 A;  1J1E A;  1KSO A;  4ORB B;  3KHE A;  2OTG C;  4GNK B;  4Q04 A;  1CMG A;  4DRW A;  3ZNI A;  3JTD C;  1AHR A;  1MXL C;  3A8R A;  3LK1 A;  2JQ6 A;  4CLN A;  1J7P A;  3DVK A;  3KPX A;  1YTZ C;  3LLE A;  1K95 A;  1DJX A;  1XK4 A;  4MRY A;  4PAL A;  3FS7 A;  1XFW O;  3PN7 C;  2WCE A;  2AMI A;  3TS5 C;  1NP8 A;  4M2Q A;  4MZJ A;  4N5X A;  2K8M B;  4AOM A;  1WDC C;  5I8N A;  2K61 A;  1BU3 A;  2L2E A;  1KFU S;  2L4I A;  1EH2 A;  2PRU A;  1AP4 A;  1N0Y A;  4TNC A;  1IGV A;  1XYD A;  4ETO A;  2ZN8 A;  1C7V A;  2FJU B;  1NPQ A;  4QJ5 B;  1ZOT B;  1PSR A;  4QJ4 B;  1OZO A;  2L5X B;  2F3Y A;  1F8H A;  1L2O B;  4E68 A;  2LMV A;  1TTX A;  1RFJ A;  2K7D A;  1MXE A;  1E8A A;  1LA0 A;  1F4Q A;  3JVT B;  1HT9 A;  1VRK A;  3IQQ A;  3E3R A;  4FTG A;  3BOW B;  4ZCV A;  1S6J A;  1IG5 A;  4MLW A;  1C07 A;  2O5G A;  2WOS A;  2JT3 A;  2B1U A;  1G33 A;  2DOQ A;  3I5H C;  1IWQ A;  1NX3 A;  1CB1 A;  1SMG A;  1CNP A;  1NX2 A;  3VRN A;  1DJI A;  2JC2 A;  2JZI A;  1XFV O;  1Y1X A;  4I5K A;  1WRZ A;  2MJW B;  5CSF A;  2KQY A;  1SPY A;  2LNK A;  1KQV A;  2ISD A;  1KFX S;  3OX6 A;  1LKJ A;  1WLZ A;  1CFF A;  3FWB A;  1DJG A;  3IQO A;  1DF0 B;  1QX7 A;  1AUI B;  2KSP A;  1EL4 A;  2BL0 C;  2LVV A;  1MQ1 A;  4YI9 A;  3VRQ A;  3TUY B;  1TIZ A;  4YRU A;  5JJG A;  2KFG A;  1PVA A;  3I5I B;  1IQ3 A;  3DVM A;  2I18 A;  5ER4 X;  4DUQ A;  1ZUZ A;  2M3W A;  4DS7 A;  3OHM B;  2KQ6 A;  4JQ0 D;  3SG2 A;  1DTL A;  2I94 A;  2Y5I A;  1QV0 A;  2LLT A;  1YUS A;  2PVB A;  2BBM A;  4PHJ A;  1S6C A;  2PAL A;  1S6I A;  3EK4 A;  2KI4 B;  1KK8 B;  3ICB A;  1B7T Y;  1NWD A;  2LAP A;  1GQM A;  3CWG A;  2KI6 C;  2NCO A;  2LLS A;  4JWQ A;  2I7A A;  1J7Q A;  1QS7 A;  1QVI Z;  2A4J A;  1UUR A;  2M0R A;  4ICB A;  1BOC A;  2LVI A;  2BCX A;  1K2H A;  4CID A;  3EKH A;  3PFV A;  2L51 A;  3GOF A;  1WLM A;  1U5I A;  1Q80 A;  3AAJ A;  2KAX A;  4I5N B;  1M46 A;  3BQ3 A;  2JPT A;  4MVF A;  1PRW A;  2KYF A;  3OB1 B;  5CPV A;  3QRX A;  4GBA A;  1MWN A;  1OMR A;  1YX8 A;  2MAZ A;  1KFU L;  2M7N A;  3TDI A;  1YVL A;  2LHI A;  1M45 A;  2ZKM X;  1WY9 A;  2R2I A;  2CTN A;  3DD4 A;  4M2O A;  1DT7 B;  4XJK B;  1YRT B;  2LCP A;  4YGA A;  2WCB A;  3LK0 A;  3LL8 B;  3TDZ A;  1A4P A;  2BCB A;  1V1F A;  2L50 A;  4YI8 A;  1GGW A;  2MLF C;  3EVR A;  5CSJ A;  2JU0 A;  3F45 A;  1RK9 A;  1R2U A;  2LUC A;  2HPS A;  2JXC A;  1CDM A;  3O6B A;  2EHB A;  2M29 A;  1JF0 A;  2ZNE A;  3NSK A;  1QTX A;  1G4Y R;  1L2O C;  2PSR A;  4NDC A;  4ORA B;  1M39 A;  3JVT C;  4ORC B;  1AJ5 A;  3NSI A;  3O4Y A;  1NX1 A;  5ER5 A;  3TZ1 A;  1FF1 A;  1KFX L;  1NYA A;  1H4B A;  2KGR A;  4MBE A;  1M31 A;  5HLV A;  3FWC A;  1PVB A;  4P5O E;  1CM4 A;  1SYM A;  1GJY A;  1B8R A;  1EXR A;  2EC6 B;  1QLS A;  2KAY A;  4A4C A;  3DVJ A;  2JTZ A;  2NZ0 A;  4GFT A;  2NXQ A;  1ALV A;  1S5G Y;  3NXA A;  2FOT A;  1DJH A;  4GAO A;  4C0K A;  2AUC A;  4I5L B;  2OS8 B;  4BY4 A;  2ZFD A;  4IL1 A;  1MF8 B;  2F2P A;  1BMO A;  1QXP A;  2F3Z A;  4MZK A;  5AAN A;  5HYD A;  1IH0 A;  4WQ2 A;  1F71 A;  5HKW A;  3TUY C;  3EK8 A;  1FPW A;  3FIA A;  4OCI A;  3I5I C;  1UHK A;  2LAN A;  1UWO A;  3NSO A;  1QX2 A;  3PM8 A;  3A4U B;  5F6T A;  5AER A;  1Y1A A;  3I5G B;  1A75 B;  1M63 B;  3D10 A;  1K94 A;  2CBL A;  4HRH A;  2BBN A;  1IKU A;  1J55 A;  4M2P A;  1DJY A;  1S26 D;  1TN4 A;  2JNX A;  2BE6 A;  2KI4 C;  1KK8 C;  3SG4 A;  4D1E A;  1JC2 A;  4N1F A;  3WHU B;  1ZMZ A;  2M97 A;  3BYA A;  3DF0 A;  4CPV A;  1CFD A;  1YRU B;  3H4S E;  3KO0 A;  4MEW A;  1YR5 A;  1SBJ A;  2ZRS A;  3PAL A;  1F55 A;  1B47 A;  1F70 A;  2KOT A;  2JT8 A;  1A29 A;  1B4C A;  1AVS A;  5HKY A;  3VRR A;  4GGN A;  4HSZ A;  2KNE A;  5AEQ A;  4PHK A;  1B7T Z;  1K9K A;  2O60 A;  1B9A A;  3K21 A;  3CR4 X;  2HQW A;  1CLM A;  1Y0V H;  2KBM A;  5I2Q A;  1AJ4 A;  1J7R A;  4DIR A;  1XVJ A;  2BE4 A;  1NCZ A;  1SY9 A;  2JOJ A;  3MSE B;  3WXA A;  3OX5 A;  3AAK A;  1UHN A;  2AAO A;  2COL B;  2LP3 A;  2ZRT A;  2NCP A;  4A4B A;  3CS1 A;  1BT6 A;  3SIA A;  2BEC A;  4U8D A;  1TNP A;  5KSZ A;  2LMU A;  3DVE A;  1TNX A;  2JUL A;  2CXJ A;  1XFY O;  4OR9 B;  2WCF A;  1NIW A;  3TDU A;  1WRK A;  3RM1 A;  3BUW B;  3CZT X;  2JTT A;  1K90 D;  1N2D A;  1TNW A;  5GQQ C;  5IBW A;  1DGV A;  1FBV A;  3PAT A;  4PE7 A;  4C0J A;  1TRF A;  1N65 A;  1JFK A;  1NCX A;  1DGU A;  1SKT A;  2GV5 A;  2KGB C;  1G8I A;  1YUT A;  2RGI A;  1IJ6 A;  1DJW A;  2KI6 D;  1D1O A;  1H8B A;  2K7B A;  2F8P A;  2MLE C;  4AQJ A;  4PHN A;  1DVI A;  2EC6 C;  1TCO B;  1Y6W A;  5G08 A;  1FW4 A;  1FI5 A;  1YUR A;  4ZCU A;  4NDB A;  2SCP A;  3ZWH A;  2K7C A;  2OS8 C;  2NLN A;  5DKQ A;  1CLB A;  4YBH B;  4DCK A;  1QX5 B;  2CCM A;  1JWD A;  2Y4Q A;  5I2L A;  1F54 A;  1XFZ O;  4CFR A;  2IS9 A;  3HCM A;  1JUO A;  1LVC D;  1A75 A;  1YVH A;  1XO5 A;  2M7L A;  3I5F B;  1QV1 A;  1A2X A;  2JRF A;  1S5G Z;  1SL7 A;  1IRJ A;  2WC8 A;  2QAC A;  1IQ5 A;  1CKK A;  3I5G C;  1ALW A;  3BOW A;  1HQV A;  2LVK A;  5AFP A;  1SR6 B;  3C1V A;  1TOP A;  4BY5 A;  2L98 A;  2LV7 A;  2H2K A;  2ZN9 A;  2M1K B;  2M49 B;  2MHH A;  5DKN A;  1CFP A;  3CR2 A;  4GPL B;  1OSA A;  5B8I B;  1MHO A;  2ZND A;  2KHN A;  4YGC B;  2M1U A;  1SCM B;  1Y1U A;  5TNC A;  1K96 A;  2BKI B;  1QAS A;  2JNF A;  1B8C A;  2LVJ A;  1KK7 Y;  1RJV A;  2H61 C;  4GGF C;  3SG7 A;  4YGE B;  1DF0 A;  2M8U A;  4PE0 A;  2F33 A;  4R1E A;  5AXI A;  4WRI A;  2EGD A;  4YGB B;  5K89 A;  1EG3 A;  1S1E A;  5CSI A;  1OMV A;  1WRL A;  3BUX B;  1BR1 B;  1LA3 A;  1LIN A;  1XFX O;  4MN0 A;  2MBX A;  2K7O A;  1SCV A;  2BCA A;  5PAL A;  5I2O A;  1SK6 D;  1NUB A;  1OQP A;  1A03 A;  2LUX A;  3KEV A;  1U5I B;  3VGO A;  1OZS A;  2P6B B;  4GUK A;  1QIV A;  2KFH A;  1RWY A;  1B8L A;  2LHL A;  1ODB A;  1TNQ A;  2FCE A;  1S3P A;  3HX4 A;  2G9B A;  1XK4 C;  2LP2 A;  2Y1M A;  4MZL A;  3D0Y B;  1JFJ A;  1ZFS A;  4F0Z B;  2M9G A;  1SRA A;  1BJF A;  2G2B A;  1V1G A;  4OV2 A;  2KDH A;  2L0P A;  5CSN A;  5HLO A;  1F4O A;  4C0L A;  3SJS A;  4XYN A;  1W7I B;  1C7W A;  3O78 A;  1TCF A;  4P2Y B;  2K2F A;  5J3X A;  2KBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...