2LMTA

Nmr structure of androcam
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calmodulin-related protein 97A
publication title Structure of androcam supports specialized interactions with myosin VI.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Metal binding protein
total genus 38
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2lmtA01
3I5GB 5ER4X 1UHHA 1SRAA 3SJSA 3EVRA 1DT7B 3BUWB 1IWQA 1OE9B 2JC2A 2OS8C 3JVTC 2LCPA 1JSAA 1UURA 3D0YB 1JC2A 2KHNA 2BCXA 1B8CA 1FW4A 3BUNB 5HKYA 3O2PA 5HYDA 4QJ4B 1BOCA 3WXAA 5K89A 1XFYO 4A4BA 2L50A 5CSIA 3LCPC 2EGDA 4GGNA 3DD4A 2ZRTA 1WDCC 1SNLA 3WHTB 4CIDA 3RM1A 5I2OA 1MHOA 2K7DA 1DVIA 3HCMA 3SIAA 1QS7A 2M3WA 1PK0D 2L2EA 3ZNIA 2MA2A 1MXEA 5KTYA 1GGZA 2L4HA 4A4CA 2WC8A 3EK7A 3EVUA 1EL4A 1OQPA 1S36A 1K94A 1PVAA 1M63B 4MVFA 5DKNA 1S5GZ 5CSJA 1K93D 1KK7Y 1KWOB 3H4SE 5F6TA 5CSNA 4JWQA 2OTGB 1B7TY 3KPXA 2JT8A 4CLNA 1G4YR 1Y6WA 1ZACA 4AQIA 5AFPA 1DJYA 4OVNF 2JULA 1K96A 4HRHA 5CSFA 4NDCA 5AERA 3OHMB 1AP4A 5KSZA 1XFXO 1AHRA 2Y1NA 2Y4QA 4ETOA 1PVBA 1TNWA 1CNPA 3CR4X 1IQ3A 4MBEA 1CDMA 5HLVA 5B8IB 2M7NA 2WORA 4I5KA 3JTDC 3GK1A 2WCFA 1RK9A 4F0ZB 2BL0B 2KDHA 3MSEB 2SASA 2P6BB 4I5JA 4PE4A 2PALA 3KHEA 2GGMA 2E30A 2MJWB 1KSMA 3PN7C 1NYAA 3TUYB 1RROA 3PLFB 2PASA 4GFTA 3O4YA 2I2RE 1Y0VH 3O6BA 1JFKA 4MZJA 1K9KA 1NWDA 2M9GA 2FCEA 1F4OA 1N0YA 1PRWA 1WLMA 2M0RA 5IBWA 1C07A 2F3YA 4PHKA 2KBMA 3KF9A 1KCYA 3DF0B 5I2QA 3IQOA 1XO5A 1C7VA 2BKHB 1SBJA 2PMYA 3IF7A 2KFFA 4YI8A 3I5HC 4YRUA 1S6CA 2LP3A 2M1KB 3EK8A 1SCMB 1RTP1 4M2OA 1KSOA 2K7CA 2RGIA 1HQVA 4OV2A 4XYNA 1BR1B 4AOMA 1KFUL 1WRLA 4P5OE 1Y1XA 3PFVA 1RECA 2KFHA 1MXLC 1JBAA 3WNXB 1A75A 4ORCB 4I5NB 1IGVA 2LAPA 1IQ5A 1Y1UA 3LLEA 4DUQA 1B4CA 1J7PA 2IS9A 1NX3A 1UWOA 3RLZA 3A4UB 3I5FB 1K90D 3VRQA 2KGRA 2ZRSA 4IL1A 4GBAA 3IQQA 2B1UA 4JPZB 5FYXA 1VRKA 1KK8B 2H2KA 3PATA 1MUXA 2KFGA 2LLUA 1OSAA 1F55A 1JWDA 1LINA 4N1FA 2BL0C 3GK2A 1G33A 3WHUB 1WLZA 4AQJA 1YRTB 1IKUA 2O60A 1YX7A 1DGVA 3AKAA 4C0LA 2KGBC 4FQOA 4OKHA 1CFPA 1OZOA 1UHJA 4ZCUA 4N1GA 1J55A 1Q80A 4ICBA 2CT9A 1F71A 1ZMZA 2FCDA 1F54A 4OCIA 4PHMA 1CLMA 1K9PA 2LVKA 1U5IB 4FTGA 2BE4A 5ER5A 1QLSA 1NUBA 4GAOA 2E6WA 1R6PA 4GGFA 1CFFA 1J7OA 1CB1A 3E3RA 4HREE 4MZKA 1YVHA 2O5GA 3BUOB 1ALWA 4Q04A 1DF0A 1QX7A 4YI9A 2L5XB 3SG3A 1FF1A 1KFXL 2LMVA 2JZIA 1DJWA 1CLLA 4OR9B 1SCMC 1QVIZ 4DS7A 1H4BA 1XYDA 1YUTA 1Y1AA 2I18A 1BLQA 2LVJA 1YTZC 1GQMA 3LK0A 3D10A 1F70A 4E68A 1W7IB 1K9UA 4PDZA 1A03A 1M39A 1WRKA 1CM1A 4MZLA 2K2AA 1CTRA 2BCBA 2CTNA 1FI6A 3TDZA 2M49B 1MR8A 4CFQA 5G08A 2M1UA 3BQ3A 2LHLA 2CBLA 2LC5A 3I5FC 2NZ0A 1TIZA 2LLSA 4CFRA 1M31A 1OMVA 2BBNA 1BJFA 2M8UA 1A4PA 1TNXA 1AUIB 1LA0A 1UHNA 4BY5A 1FPWA 2FJUB 2KNEA 2ZFDA 2BECA 5AEQA 1QIVA 1L2OB 3CR5X 1K8UA 3M0WA 2KBIA 2JQ6A 2CXJA 2KI4B 2LNKA 3KEVA 2KYFA 3LL8B 2LVVA 3FIAA 1QASA 5D69A 2KQYA 3OP0A 2JNXA 2F8PA 2LV7A 2G9BA 4XJKA 3OX6A 3CR2A 2JRFA 4NQGA 2MRDA 4YGCB 2JNFA 1IRJA 1WY9A 1CLBA 3BOWA 3I5GC 2WCEA 4MRXA 1W7JB 3SG6A 2ZNEA 3AKBA 3CWGA 1LKJA 1FI5A 1JUOA 1JF2A 2K2FA 3VGOA 2EC6B 4WRIA 3F45A 1BMOA 1TCOB 1TCFA 2L98A 1MWNA 4M2QA 2ZN9A 2BCAA 5JJGA 5J3XA 4MEWA 4QJ3B 1BF5A 1J7RA 1EG4A 1R2UA 3SIBA 1BR4B 1MQ1A 2LUXA 3NSOA 5CPVA 4DRWA 1BG1A 2F2PA 2HQWA 2SCPA 3O78A 1J7QA 1QIWA 1ALVA 1C7WA 1KK7Z 1SR6B 3BXKA 1KWOC 3DVJA 3SG5A 2KI6C 2OTGC 1NPQA 1XFUO 2JTTA 3VROA 4NDDA 2JT0A 1DJZA 1NIWA 3BUXB 4YGDB 2NCOA 1B47A 1QX2A 2AUCA 1LXFC 1SY9A 1ZUZA 1DGUA 1RJVA 4NDBA 5GQQC 2LE9B 3GOFA 2KAVA 4PHJA 1WDCB 1ZFSA 3BYAA 2JXCA 1S3PA 1IJ5A 1XFZO 1B8RA 2FOTA 1KFUS 4MLWA 2ZN8A 4GNKB 3I5IB 1QX5B 3TUYC 1QTXA 4YGBB 1AVSA 1BODA 2M29A 1DJGA 1TRFA 4N5XA 4YGAA 1QV1A 1H8BA 5DKRA 1S5GY 1DTLA 4YBHB 3TS5B 4U8DA 1EH2A 2JTZA 2K8MB 2PRUA 1TN4A 2QPTA 3PM8A 1XFVO 4BY4A 4CPVA 5DKQA 1QXPA 3TDIA 4DCKA 4D1EA 4YGEB 3TDUA 2JPTA 2NLNA 2A4JA 2LP2A 2JOJA 2K61A 2KI6D 2Q91A 4UPGA 2HQ8A 4JQ0D 1M45A 4XJKB 1IG5A 1NX2A 1S26D 1FBVA 3JTDB 1SYMA 1XFWO 3FWCA 1NCZA 1YX8A 1EJ3A 1CMFA 1D1OA 4PHNA 1CDPA 1YUSA 4L9MA 2JWWA 3PN7B 1AK8A 2WOSA 4PE1A 2LM5A 5I2LA 2ZKMX 1E8AA 5AANA 5PALA 2CCMA 2Q4UA 1J1DA 2Y1MA 1SL8A 2L0PA 3VRNA 1KFXS 1LA3A 1CKKA 1KK8C 1NX1A 1TNQA 1TTXA 2KOTA 2PSRA 3ZWHA 4C0JA 2I94A 4MRYA 2K7BA 2K7OA 1KQMB 4ORBB 1QLKA 2VRGA 1UHIA 1DJHA 2KYCA 3EKHA 1CFCA 1YURA 1XA5A 5D7FA 2D8NA 2G2BA 3I5HB 3PALA 3I5IC 2ISDA 2HETA 1CMGA 5JOLA 2L4IA 2QACA 1PULA 1PSRA 1A75B 2LLTA 3A8RA 3CS1A 5HKWA 2LMTA 4DIRA 4I5LB 3TS5C 1SCVA 3GK4X 3C1VA 3EK4A 2NCPA 1AJ5A 1K95A 1S6IA 1V1FA 1HT9A 1OMRA 1U5IA 1ODBA 3NSIA 3NXAA 4WQ3A 3K21A 1SPYA 2DOQA 2MAZA 4R1EA 3FS7A 1B8LA 1UP5A 4USLA 4PE7A 2Y5IA 1B9AA 3D0YA 2JT3A 1YUUA 3OB1B 2MBXA 1A2XA 2I7AA 3OB2B 2TN4A 2ZNDA 2M97A 1UHKA 1XK4C 2L51A 1J1EA 1NP8A 1RWYA 2NXQA 1UUSA 2H61C 1XK4A 1OZSA 2K0JA 2LVIA 2BE6A 3ICBA 3OX5A 2H61A 4ZCVA 5HKZA 1JFJA 2KAYA 2LHIA 3KO0A 1A29A 2GGZA 4WQ2A 1K2HA 1GJYA 1NX0A 5BPJA 2HPSA 3SG4A 1TOPA 4GPLB 1XVJA 2M7LA 1B7TZ 1MF8B 1LVCD 1BU3A 1SL9A 3AAJA 2GV5A 5HLOA 1EG3A 1DF0B 1KQMC 1IH0A 1JF0A 2LMUA 1WRZA 1L2OC 2OS8B 1N2DA 1NCXA 1YRUB 2KAXA 3JVTB 1PSBA 3LK1A 1EXRA 2HF5A 4ORAB 3CLNA 4MN0A 3EKJA 5KU1A 5I8NA 3EVVA 2KI4C 1RFJA 2CNPA 4PCWA 4HRGA 2MLFC 3DVMA 5AXIA 4QJ5B 1IJ6A 2COLB 1SMGA 3BUMB 2WCBA 1QVIY 2F33A 3PSRA 1F4QA 1OOJA 1QATA 1CM4A 2AAOA 3CZTX 3FWBA 3NSKA 1CDNA 1OMDA 1SL7A 3HX4A 1S6JA 1YR5A 1SKTA 2JXLA 2F3ZA 2EHBA 2R2IA 1G8IA 1DMOA 3SG7A 4MSPA 2LANA 4P2YB 3DVKA 2MLEC 2JU0A 1CFDA 2OPOA 1GGWA 4M2PA 1X02A 1DJXA 2EC6C 2F2OA 1SK6D 3DVEA 1AJ4A 2V53A 1S1EA 2PVBA 1BT6A 2KQ6A 2WNDA 1NCYA 4PALA 5TNCA 1YVLA 2AMIA 1M46A 2MHHA 4C0KA 3NSLA 3VRRA 2BKIB 1B1GA 3DF0A 1KQVA 1PALA 4GUKA 3AAKA 1NSHA 1CDLA 4TNCA 3SG2A 3TZ1A 1N65A 1SW8A 1V1GA 1ZOTB 2BBMA 3CGAA 3QRXA 3CTNA 1QJTA 4PE0A 1TNPA 1QV0A 3BOWB 4GGFC 3VRPA 2LUCA 4HSZA 1SR6C 1F8HA 1L7ZA 2KSPA 1DJIA
chains in the Genus database with same CATH superfamily
3I5GB 5ER4X 1UHHA 1SRAA 3SJSA 3EVRA 1DT7B 3BUWB 1IWQA 1OE9B 2JC2A 2OS8C 3JVTC 2LCPA 1JSAA 1UURA 3D0YB 1JC2A 2KHNA 2BCXA 1B8CA 1FW4A 3BUNB 3R72A 5HKYA 3O2PA 5HYDA 4QJ4B 1BOCA 3WXAA 5K89A 1XFYO 4A4BA 2L50A 5CSIA 3LCPC 2EGDA 4GGNA 3DD4A 2ZRTA 1WDCC 1SNLA 3WHTB 4CIDA 3RM1A 5I2OA 1MHOA 2FJYA 2K7DA 1DVIA 3HCMA 3SIAA 1QS7A 2M3WA 1PK0D 3D77A 2L2EA 3ZNIA 2MA2A 1MXEA 5KTYA 1GGZA 2L4HA 4A4CA 3S0GA 2WC8A 3EK7A 3EVUA 1EL4A 1OQPA 1S36A 1K94A 1PVAA 1M63B 4MVFA 5DKNA 1S5GZ 5CSJA 1K93D 1KK7Y 1KWOB 3H4SE 1OOHA 5F6TA 5CSNA 4JWQA 2OTGB 1B7TY 3KPXA 2JT8A 4CLNA 1G4YR 1Y6WA 1ZACA 4AQIA 5AFPA 1DJYA 4OVNF 2JULA 1K96A 2QEBA 4HRHA 5CSFA 4NDCA 5AERA 3OHMB 1AP4A 5KSZA 1XFXO 1AHRA 2Y1NA 2Y4QA 3NHIA 4ETOA 1PVBA 1TNWA 1CNPA 3CR4X 1IQ3A 4MBEA 3L47A 1CDMA 5HLVA 5B8IB 2M7NA 2PYQA 2WORA 3JTDC 4I5KA 3GK1A 2WCFA 1RK9A 4F0ZB 2BL0B 2KDHA 3MSEB 2WCHA 2SASA 2P6BB 4I5JA 4PE4A 2PALA 3S0FA 3KHEA 2GGMA 2E30A 2MJWB 1KSMA 3R1VA 3PN7C 1NYAA 3TUYB 1RROA 3PLFB 2PASA 3B7AA 3BFAA 4GFTA 3O4YA 3S0EA 2I2RE 1Y0VH 3O6BA 1JFKA 4MZJA 1K9KA 1NWDA 2M9GA 2FCEA 1F4OA 1N0YA 1PRWA 1WLMA 2M0RA 3S0AA 5IBWA 1C07A 2F3YA 4PHKA 2KBMA 3KF9A 1KCYA 3DF0B 5I2QA 3IQOA 1XO5A 1C7VA 2BKHB 1SBJA 2PMYA 3L4AA 3IF7A 2KFFA 4YI8A 3I5HC 3UO9A 4YRUA 1S6CA 2LP3A 2M1KB 3EK8A 1SCMB 1RTP1 4M2OA 1KSOA 2K7CA 2RGIA 1HQVA 4OV2A 4XYNA 1BR1B 3VB1A 1KFUL 4AOMA 1WRLA 3B87A 4P5OE 1Y1XA 3PFVA 1RECA 2KFHA 1MXLC 1JBAA 3WNXB 3NGVA 1DEKA 1A75A 4ORCB 4I5NB 3SS3A 1IGVA 2LAPA 1IQ5A 1Y1UA 2WCKA 3LLEA 4DUQA 1B4CA 1J7PA 2IS9A 1NX3A 1UWOA 3RLZA 2K60A 3A4UB 3FE6A 1K90D 3I5FB 2KGRA 2ZRSA 4IL1A 3VRQA 4GBAA 3IQQA 2B1UA 4JPZB 2ERBA 3S0DA 5FYXA 1VRKA 1KK8B 2H2KA 3PATA 1MUXA 1F8HA 2GTEA 2KFGA 2LLUA 1OSAA 1F55A 1JWDA 3D76A 1LINA 4N1FA 2BL0C 3GK2A 1G33A 3WHUB 1WLZA 3L4LA 4AQJA 1YRTB 1IKUA 2O60A 1YX7A 1DGVA 3AKAA 4C0LA 2KGBC 4FQOA 4OKHA 1CFPA 1OZOA 1UHJA 4ZCUA 2QEHA 4N1GA 1IIOA 1J55A 1Q80A 4ICBA 2CT9A 5FI7A 1F71A 1ZMZA 2FCDA 1F54A 3DY9A 4OCIA 1CLMA 4PHMA 1K9PA 2LVKA 1U5IB 4FTGA 2BE4A 5ER5A 1QLSA 1NUBA 4GAOA 2E6WA 1R6PA 4GGFA 1CFFA 1J7OA 1CB1A 3E3RA 4HREE 4MZKA 1Z4HA 1YVHA 2O5GA 3BUOB 3SS4A 5EL2A 1ALWA 4Q04A 1DF0A 1QX7A 4YI9A 2L5XB 3SG3A 1FF1A 1KFXL 2LMVA 2JZIA 1DJWA 1CLLA 4OR9B 1SCMC 1QVIZ 4DS7A 1H4BA 4KYNA 1XYDA 1YUTA 1DC1A 1Y1AA 2I18A 1BLQA 2LVJA 1YTZC 1GQMA 3LK0A 3D10A 1F70A 4E68A 1W7IB 1P28A 3SS5A 4IJ7A 1K9UA 4PDZA 3D74A 1A03A 3QMEA 1M39A 1WRKA 1CM1A 4MZLA 2K2AA 1CTRA 2BCBA 2CTNA 1FI6A 3TDZA 2M49B 1MR8A 4CFQA 5G08A 2M1UA 3BQ3A 5I94A 2LHLA 2CBLA 2LC5A 3I5FC 1QWVA 2NZ0A 1LS8A 1TIZA 2LLSA 4CFRA 1M31A 1OMVA 2BBNA 1BJFA 2M8UA 1A4PA 1TNXA 1AUIB 1LA0A 1UHNA 4BY5A 1FPWA 2FJUB 2KNEA 2ZFDA 2BECA 5AEQA 1QIVA 5FI2A 1L2OB 3CR5X 1K8UA 3B6XA 3M0WA 2KBIA 2JQ6A 2CXJA 2KI4B 4INXA 2LNKA 3KEVA 2KYFA 3LL8B 2LVVA 3FIAA 1QASA 2L5YA 5D69A 2KQYA 3NHTA 2BAPA 3OP0A 2JNXA 2F8PA 2LV7A 2G9BA 4XJKA 3OX6A 3CDNA 3CR2A 2JRFA 3D78A 2MRDA 4NQGA 4YGCB 2JNFA 1IRJA 1WY9A 1CLBA 3BOWA 3I5GC 2WCEA 4MRXA 1W7JB 3SG6A 2ZNEA 3AKBA 3CWGA 1LKJA 1FI5A 1TWOA 1JUOA 2KPHA 1JF2A 2K2FA 3VGOA 2EC6B 4WRIA 3F45A 3R1PA 1BMOA 1TCOB 1TCFA 2QEVA 2L98A 2QEOA 1MWNA 4M2QA 2ZN9A 2BCAA 5JJGA 3FE8A 5J3XA 4MEWA 2WCJA 4QJ3B 1J7RA 1BF5A 1EG4A 1R2UA 5D3OA 4F7FA 1DELA 3SIBA 1BR4B 1MQ1A 4FQTA 2LUXA 3NSOA 5CPVA 4DRWA 1BG1A 3PJIA 2F2PA 2HQWA 2SCPA 4OZDA 1OOIX 3CZ1A 3Q8IA 3O78A 1J7QA 1QIWA 3IVTA 1ALVA 1C7WA 1KK7Z 1SR6B 3BXKA 1KWOC 3DVJA 3SG5A 2KI6C 2OTGC 1NPQA 3N7HA 1XFUO 2JTTA 3VROA 4NDDA 2JT0A 1DJZA 1NIWA 3BUXB 4YGDB 2NCOA 1B47A 1QX2A 2AUCA 1LXFC 2L2CA 1SY9A 1ZUZA 3UNWA 1DGUA 1RJVA 4NDBA 3FE9A 2LE9B 5GQQC 3GOFA 2KAVA 4PHJA 1WDCB 1ZFSA 3BYAA 2JXCA 1OW4A 1SSEB 1S3PA 1IJ5A 1XFZO 1B8RA 2FOTA 1KFUS 4MLWA 3RZSA 2ZN8A 3O4XA 4GNKB 3CZ2A 3B88A 1QX5B 3I5IB 3TUYC 1QTXA 3OGNA 4YGBB 1AVSA 1BODA 2M29A 1DJGA 1TRFA 4N5XA 4YGAA 1QV1A 3CYZA 1H8BA 3BJHA 5DKRA 1S5GY 2H8VA 1C3ZA 1DTLA 4YBHB 3TS5B 4U8DA 1EH2A 2JTZA 2K8MB 2PRUA 1TN4A 2QPTA 3PM8A 1XFVO 4BY4A 4CPVA 5DKQA 1QXPA 3TDIA 4DCKA 4JD9A 4D1EA 2BNXA 4YGEB 3TDUA 3CABA 2JPTA 2NLNA 2A4JA 2LP2A 2JOJA 2K61A 2KI6D 3DXLA 2Q91A 4UPGA 2HQ8A 2WCLA 4JQ0D 1M45A 4XJKB 1IG5A 1NX2A 1S26D 1FBVA 3JTDB 1SYMA 1XFWO 2JPOA 3FWCA 5DICA 1NCZA 1YX8A 1EJ3A 1CMFA 1GM0A 1D1OA 4PHNA 1CDPA 1YUSA 4L9MA 2JWWA 3PN7B 1AK8A 2WOSA 3BFHA 4PE1A 2LM5A 3CZ0A 5I2LA 2ZKMX 1E8AA 5AANA 5PALA 3V2LA 2CCMA 2Q4UA 1J1DA 2Y1MA 3DZTA 4JKTA 1SL8A 2L0PA 3VRNA 2KLEA 2WC6A 1KFXS 1LA3A 3PM2A 1CKKA 1KK8C 1NX1A 1TNQA 1OOGA 1TTXA 1TUJA 1W9ZA 2KOTA 2I94A 2PSRA 4MRYA 3ZWHA 4C0JA 2K7BA 2K7OA 1KQMB 4ORBB 1QLKA 2VRGA 1UHIA 1DJHA 2KYCA 3EKHA 1CFCA 1YURA 1XA5A 5D7FA 2D8NA 2G2BA 3I5HB 3PALA 2QDIA 3I5IC 2ISDA 2HETA 1CMGA 3R1OA 5JOLA 2L4IA 2QACA 2WCMA 1XFRA 1PULA 1PSRA 1A75B 2LLTA 3A8RA 3CS1A 5HKWA 2LMTA 4DIRA 4I5LB 3TS5C 1SCVA 3GK4X 3C1VA 3EK4A 2NCPA 1AJ5A 1K95A 1S6IA 1V1FA 1HT9A 2P70A 3D75A 1OMRA 1U5IA 1ODBA 3NSIA 3NXAA 4WQ3A 3K21A 1SPYA 2DOQA 2MAZA 4R1EA 3FS7A 1B8LA 1UP5A 4USLA 4PE7A 2Y5IA 1B9AA 3D0YA 2JT3A 1YUUA 3OB1B 5FI6A 1A2XA 2MBXA 2I7AA 3OB2B 2TN4A 2ZNDA 2M97A 1UHKA 1XK4C 2L51A 1J1EA 1NP8A 1RWYA 2NXQA 1UUSA 2H61C 1XK4A 2P71A 1OZSA 2K0JA 2LVIA 2BE6A 3ICBA 3OX5A 2H61A 4ZCVA 5HKZA 1JFJA 1Z2CB 2KAYA 2LHIA 3KO0A 4INWA 1A29A 2GGZA 4WQ2A 1K2HA 1GJYA 1NX0A 5BPJA 2HPSA 3S0BA 3SG4A 1DQEA 1TOPA 4GPLB 1XVJA 1ORGA 1B7TZ 1MF8B 1LVCD 1BU3A 1SL9A 3AAJA 3BFBA 3DYEA 2GV5A 5HLOA 1EG3A 1DF0B 1KQMC 1IH0A 2KLDA 1JF0A 2LMUA 1WRZA 1L2OC 2OS8B 1N2DA 1NCXA 1YRUB 2KAXA 3JVTB 1PSBA 3LK1A 1EXRA 2HF5A 4ORAB 3CLNA 4MN0A 3EKJA 5KU1A 5I8NA 3EVVA 2KI4C 1RFJA 2CNPA 4PCWA 3EG5B 4HRGA 2MLFC 3DVMA 5AXIA 4QJ5B 1IJ6A 2COLB 1SMGA 3BUMB 2WCBA 3D73A 1QVIY 2F33A 3OBVA 3PSRA 1F4QA 1OOJA 1QATA 1CM4A 2AAOA 3CZTX 3FWBA 3NSKA 2YGUA 1CDNA 1OMDA 2M7LA 1SL7A 3HX4A 1S6JA 1YR5A 1SKTA 2JXLA 2F3ZA 1OOFA 2EHBA 2R2IA 1G8IA 1DMOA 3SG7A 4MSPA 2LANA 4P2YB 3DVKA 2MLEC 2JU0A 1CFDA 3K1EA 2OPOA 1GGWA 4M2PA 1X02A 1DJXA 2EC6C 2F2OA 1SK6D 3DVEA 1AJ4A 2V53A 1T14A 1S1EA 2PVBA 1BT6A 2KQ6A 2WNDA 1NCYA 4PALA 5TNCA 1YVLA 2AMIA 1M46A 2MHHA 4C0KA 3NSLA 3B86A 3VRRA 2BKIB 1B1GA 3DF0A 1KQVA 1PALA 2PQLA 4GUKA 3AAKA 1NSHA 1CDLA 4TNCA 3SG2A 3TZ1A 1N65A 4PT1A 5HL1A 2WC5A 1SW8A 1V1GA 1ZOTB 2BBMA 3CGAA 3QRXA 3CTNA 1QJTA 4PE0A 1TNPA 1QV0A 3BOWB 4GGFC 3VRPA 2LUCA 4HSZA 1SR6C 1C3YA 1L7ZA 2KSPA 1DJIA 1TUZA
chains in the Genus database with same CATH topology
3I5GB 5ER4X 1UHHA 1SRAA 3SJSA 3EVRA 1DT7B 3BUWB 1IWQA 1OE9B 2JC2A 2OS8C 3JVTC 2LCPA 1JSAA 1UURA 3D0YB 1JC2A 2KHNA 2BCXA 1B8CA 1FW4A 3BUNB 5HKYA 3O2PA 5HYDA 4QJ4B 1BOCA 3WXAA 5K89A 1XFYO 4A4BA 2L50A 5CSIA 3LCPC 2EGDA 4GGNA 3DD4A 2ZRTA 1WDCC 1SNLA 3WHTB 4CIDA 3RM1A 5I2OA 1MHOA 2K7DA 1DVIA 3HCMA 3SIAA 1QS7A 2M3WA 1PK0D 2L2EA 3ZNIA 2MA2A 1MXEA 5KTYA 1GGZA 2L4HA 4A4CA 2WC8A 3EK7A 3EVUA 1EL4A 1OQPA 1S36A 1K94A 1PVAA 1M63B 4MVFA 5DKNA 1S5GZ 5CSJA 1K93D 1KK7Y 1KWOB 3H4SE 5F6TA 5CSNA 4JWQA 2OTGB 1B7TY 3KPXA 2JT8A 4CLNA 1G4YR 1Y6WA 1ZACA 4AQIA 5AFPA 1DJYA 4OVNF 2JULA 1K96A 4HRHA 5CSFA 4NDCA 5AERA 3OHMB 1AP4A 5KSZA 1XFXO 1AHRA 2Y1NA 2Y4QA 4ETOA 1PVBA 1TNWA 1CNPA 3CR4X 1IQ3A 4MBEA 1CDMA 5HLVA 5B8IB 2M7NA 2WORA 4I5KA 3JTDC 3GK1A 2WCFA 1RK9A 4F0ZB 2BL0B 2KDHA 3MSEB 2SASA 2P6BB 4I5JA 4PE4A 2PALA 3KHEA 2GGMA 2E30A 2MJWB 1KSMA 3PN7C 1NYAA 3TUYB 1RROA 3PLFB 2PASA 4GFTA 3O4YA 2I2RE 1Y0VH 3O6BA 1JFKA 4MZJA 1K9KA 1NWDA 2M9GA 2FCEA 1F4OA 1N0YA 1PRWA 1WLMA 2M0RA 5IBWA 1C07A 2F3YA 4PHKA 2KBMA 3KF9A 1KCYA 3DF0B 5I2QA 3IQOA 1XO5A 1C7VA 2BKHB 1SBJA 2PMYA 3IF7A 2KFFA 4YI8A 3I5HC 4YRUA 1S6CA 2LP3A 2M1KB 3EK8A 1SCMB 1RTP1 4M2OA 1KSOA 2K7CA 2RGIA 1HQVA 4OV2A 4XYNA 1BR1B 4AOMA 1KFUL 1WRLA 4P5OE 1Y1XA 3PFVA 1RECA 2KFHA 1MXLC 1JBAA 3WNXB 1A75A 4ORCB 4I5NB 1IGVA 2LAPA 1IQ5A 1Y1UA 3LLEA 4DUQA 1B4CA 1J7PA 2IS9A 1NX3A 1UWOA 3RLZA 3A4UB 3I5FB 1K90D 3VRQA 2KGRA 2ZRSA 4IL1A 4GBAA 3IQQA 2B1UA 4JPZB 5FYXA 1VRKA 1KK8B 2H2KA 3PATA 1MUXA 2KFGA 2LLUA 1OSAA 1F55A 1JWDA 1LINA 4N1FA 2BL0C 3GK2A 1G33A 3WHUB 1WLZA 4AQJA 1YRTB 1IKUA 2O60A 1YX7A 1DGVA 3AKAA 4C0LA 2KGBC 4FQOA 4OKHA 1CFPA 1OZOA 1UHJA 4ZCUA 4N1GA 1J55A 1Q80A 4ICBA 2CT9A 1F71A 1ZMZA 2FCDA 1F54A 4OCIA 4PHMA 1CLMA 1K9PA 2LVKA 1U5IB 4FTGA 2BE4A 5ER5A 1QLSA 1NUBA 4GAOA 2E6WA 1R6PA 4GGFA 1CFFA 1J7OA 1CB1A 3E3RA 4HREE 4MZKA 1YVHA 2O5GA 3BUOB 1ALWA 4Q04A 1DF0A 1QX7A 4YI9A 2L5XB 3SG3A 1FF1A 1KFXL 2LMVA 2JZIA 1DJWA 1CLLA 4OR9B 1SCMC 1QVIZ 4DS7A 1H4BA 1XYDA 1YUTA 1Y1AA 2I18A 1BLQA 2LVJA 1YTZC 1GQMA 3LK0A 3D10A 1F70A 4E68A 1W7IB 1K9UA 4PDZA 1A03A 1M39A 1WRKA 1CM1A 4MZLA 2K2AA 1CTRA 2BCBA 2CTNA 1FI6A 3TDZA 2M49B 1MR8A 4CFQA 5G08A 2M1UA 3BQ3A 2LHLA 2CBLA 2LC5A 3I5FC 2NZ0A 1TIZA 2LLSA 4CFRA 1M31A 1OMVA 2BBNA 1BJFA 2M8UA 1A4PA 1TNXA 1AUIB 1LA0A 1UHNA 4BY5A 1FPWA 2FJUB 2KNEA 2ZFDA 2BECA 5AEQA 1QIVA 1L2OB 3CR5X 1K8UA 3M0WA 2KBIA 2JQ6A 2CXJA 2KI4B 2LNKA 3KEVA 2KYFA 3LL8B 2LVVA 3FIAA 1QASA 5D69A 2KQYA 3OP0A 2JNXA 2F8PA 2LV7A 2G9BA 4XJKA 3OX6A 3CR2A 2JRFA 4NQGA 2MRDA 4YGCB 2JNFA 1IRJA 1WY9A 1CLBA 3BOWA 3I5GC 2WCEA 4MRXA 1W7JB 3SG6A 2ZNEA 3AKBA 3CWGA 1LKJA 1FI5A 1JUOA 1JF2A 2K2FA 3VGOA 2EC6B 4WRIA 3F45A 1BMOA 1TCOB 1TCFA 2L98A 1MWNA 4M2QA 2ZN9A 2BCAA 5JJGA 5J3XA 4MEWA 4QJ3B 1BF5A 1J7RA 1EG4A 1R2UA 3SIBA 1BR4B 1MQ1A 2LUXA 3NSOA 5CPVA 4DRWA 1BG1A 2F2PA 2HQWA 2SCPA 3O78A 1J7QA 1QIWA 1ALVA 1C7WA 1KK7Z 1SR6B 3BXKA 1KWOC 3DVJA 3SG5A 2KI6C 2OTGC 1NPQA 1XFUO 2JTTA 3VROA 4NDDA 2JT0A 1DJZA 1NIWA 3BUXB 4YGDB 2NCOA 1B47A 1QX2A 2AUCA 1LXFC 1SY9A 1ZUZA 1DGUA 1RJVA 4NDBA 5GQQC 2LE9B 3GOFA 2KAVA 4PHJA 1WDCB 1ZFSA 3BYAA 2JXCA 1S3PA 1IJ5A 1XFZO 1B8RA 2FOTA 1KFUS 4MLWA 2ZN8A 4GNKB 3I5IB 1QX5B 3TUYC 1QTXA 4YGBB 1AVSA 1BODA 2M29A 1DJGA 1TRFA 4N5XA 4YGAA 1QV1A 1H8BA 5DKRA 1S5GY 1DTLA 4YBHB 3TS5B 4U8DA 1EH2A 2JTZA 2K8MB 2PRUA 1TN4A 2QPTA 3PM8A 1XFVO 4BY4A 4CPVA 5DKQA 1QXPA 3TDIA 4DCKA 4D1EA 4YGEB 3TDUA 2JPTA 2NLNA 2A4JA 2LP2A 2JOJA 2K61A 2KI6D 2Q91A 4UPGA 2HQ8A 4JQ0D 1M45A 4XJKB 1IG5A 1NX2A 1S26D 1FBVA 3JTDB 1SYMA 1XFWO 3FWCA 1NCZA 1YX8A 1EJ3A 1CMFA 1D1OA 4PHNA 1CDPA 1YUSA 4L9MA 2JWWA 3PN7B 1AK8A 2WOSA 4PE1A 2LM5A 5I2LA 2ZKMX 1E8AA 5AANA 5PALA 2CCMA 2Q4UA 1J1DA 2Y1MA 1SL8A 2L0PA 3VRNA 1KFXS 1LA3A 1CKKA 1KK8C 1NX1A 1TNQA 1TTXA 2KOTA 2PSRA 3ZWHA 4C0JA 2I94A 4MRYA 2K7BA 2K7OA 1KQMB 4ORBB 1QLKA 2VRGA 1UHIA 1DJHA 2KYCA 3EKHA 1CFCA 1YURA 1XA5A 5D7FA 2D8NA 2G2BA 3I5HB 3PALA 3I5IC 2ISDA 2HETA 1CMGA 5JOLA 2L4IA 2QACA 1PULA 1PSRA 1A75B 2LLTA 3A8RA 3CS1A 5HKWA 2LMTA 4DIRA 4I5LB 3TS5C 1SCVA 3GK4X 3C1VA 3EK4A 2NCPA 1AJ5A 1K95A 1S6IA 1V1FA 1HT9A 1OMRA 1U5IA 1ODBA 3NSIA 3NXAA 4WQ3A 3K21A 1SPYA 2DOQA 2MAZA 4R1EA 3FS7A 1B8LA 1UP5A 4USLA 4PE7A 2Y5IA 1B9AA 3D0YA 2JT3A 1YUUA 3OB1B 2MBXA 1A2XA 2I7AA 3OB2B 2TN4A 2ZNDA 2M97A 1UHKA 1XK4C 2L51A 1J1EA 1NP8A 1RWYA 2NXQA 1UUSA 2H61C 1XK4A 1OZSA 2K0JA 2LVIA 2BE6A 3ICBA 3OX5A 2H61A 4ZCVA 5HKZA 1JFJA 2KAYA 2LHIA 3KO0A 1A29A 2GGZA 4WQ2A 1K2HA 1GJYA 1NX0A 5BPJA 2HPSA 3SG4A 1TOPA 4GPLB 1XVJA 2M7LA 1B7TZ 1MF8B 1LVCD 1BU3A 1SL9A 3AAJA 2GV5A 5HLOA 1EG3A 1DF0B 1KQMC 1IH0A 1JF0A 2LMUA 1WRZA 1L2OC 2OS8B 1N2DA 1NCXA 1YRUB 2KAXA 3JVTB 1PSBA 3LK1A 1EXRA 2HF5A 4ORAB 3CLNA 4MN0A 3EKJA 5KU1A 5I8NA 3EVVA 2KI4C 1RFJA 2CNPA 4PCWA 4HRGA 2MLFC 3DVMA 5AXIA 4QJ5B 1IJ6A 2COLB 1SMGA 3BUMB 2WCBA 1QVIY 2F33A 3PSRA 1F4QA 1OOJA 1QATA 1CM4A 2AAOA 3CZTX 3FWBA 3NSKA 1CDNA 1OMDA 1SL7A 3HX4A 1S6JA 1YR5A 1SKTA 2JXLA 2F3ZA 2EHBA 2R2IA 1G8IA 1DMOA 3SG7A 4MSPA 2LANA 4P2YB 3DVKA 2MLEC 2JU0A 1CFDA 2OPOA 1GGWA 4M2PA 1X02A 1DJXA 2EC6C 2F2OA 1SK6D 3DVEA 1AJ4A 2V53A 1S1EA 2PVBA 1BT6A 2KQ6A 2WNDA 1NCYA 4PALA 5TNCA 1YVLA 2AMIA 1M46A 2MHHA 4C0KA 3NSLA 3VRRA 2BKIB 1B1GA 3DF0A 1KQVA 1PALA 4GUKA 3AAKA 1NSHA 1CDLA 4TNCA 3SG2A 3TZ1A 1N65A 1SW8A 1V1GA 1ZOTB 2BBMA 3CGAA 3QRXA 3CTNA 1QJTA 4PE0A 1TNPA 1QV0A 3BOWB 4GGFC 3VRPA 2LUCA 4HSZA 1SR6C 1F8HA 1L7ZA 2KSPA 1DJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5G B;  5ER4 X;  1UHH A;  1SRA A;  3SJS A;  3EVR A;  1DT7 B;  3BUW B;  1IWQ A;  1OE9 B;  2JC2 A;  2OS8 C;  3JVT C;  2LCP A;  1JSA A;  1UUR A;  3D0Y B;  1JC2 A;  2KHN A;  2BCX A;  1B8C A;  1FW4 A;  3BUN B;  5HKY A;  3O2P A;  5HYD A;  4QJ4 B;  1BOC A;  3WXA A;  5K89 A;  1XFY O;  4A4B A;  2L50 A;  5CSI A;  3LCP C;  2EGD A;  4GGN A;  3DD4 A;  2ZRT A;  1WDC C;  1SNL A;  3WHT B;  4CID A;  3RM1 A;  5I2O A;  1MHO A;  2K7D A;  1DVI A;  3HCM A;  3SIA A;  1QS7 A;  2M3W A;  1PK0 D;  2L2E A;  3ZNI A;  2MA2 A;  1MXE A;  5KTY A;  1GGZ A;  2L4H A;  4A4C A;  2WC8 A;  3EK7 A;  3EVU A;  1EL4 A;  1OQP A;  1S36 A;  1K94 A;  1PVA A;  1M63 B;  4MVF A;  5DKN A;  1S5G Z;  5CSJ A;  1K93 D;  1KK7 Y;  1KWO B;  3H4S E;  5F6T A;  5CSN A;  4JWQ A;  2OTG B;  1B7T Y;  3KPX A;  2JT8 A;  4CLN A;  1G4Y R;  1Y6W A;  1ZAC A;  4AQI A;  5AFP A;  1DJY A;  4OVN F;  2JUL A;  1K96 A;  4HRH A;  5CSF A;  4NDC A;  5AER A;  3OHM B;  1AP4 A;  5KSZ A;  1XFX O;  1AHR A;  2Y1N A;  2Y4Q A;  4ETO A;  1PVB A;  1TNW A;  1CNP A;  3CR4 X;  1IQ3 A;  4MBE A;  1CDM A;  5HLV A;  5B8I B;  2M7N A;  2WOR A;  4I5K A;  3JTD C;  3GK1 A;  2WCF A;  1RK9 A;  4F0Z B;  2BL0 B;  2KDH A;  3MSE B;  2SAS A;  2P6B B;  4I5J A;  4PE4 A;  2PAL A;  3KHE A;  2GGM A;  2E30 A;  2MJW B;  1KSM A;  3PN7 C;  1NYA A;  3TUY B;  1RRO A;  3PLF B;  2PAS A;  4GFT A;  3O4Y A;  2I2R E;  1Y0V H;  3O6B A;  1JFK A;  4MZJ A;  1K9K A;  1NWD A;  2M9G A;  2FCE A;  1F4O A;  1N0Y A;  1PRW A;  1WLM A;  2M0R A;  5IBW A;  1C07 A;  2F3Y A;  4PHK A;  2KBM A;  3KF9 A;  1KCY A;  3DF0 B;  5I2Q A;  3IQO A;  1XO5 A;  1C7V A;  2BKH B;  1SBJ A;  2PMY A;  3IF7 A;  2KFF A;  4YI8 A;  3I5H C;  4YRU A;  1S6C A;  2LP3 A;  2M1K B;  3EK8 A;  1SCM B;  1RTP 1;  4M2O A;  1KSO A;  2K7C A;  2RGI A;  1HQV A;  4OV2 A;  4XYN A;  1BR1 B;  4AOM A;  1KFU L;  1WRL A;  4P5O E;  1Y1X A;  3PFV A;  1REC A;  2KFH A;  1MXL C;  1JBA A;  3WNX B;  1A75 A;  4ORC B;  4I5N B;  1IGV A;  2LAP A;  1IQ5 A;  1Y1U A;  3LLE A;  4DUQ A;  1B4C A;  1J7P A;  2IS9 A;  1NX3 A;  1UWO A;  3RLZ A;  3A4U B;  3I5F B;  1K90 D;  3VRQ A;  2KGR A;  2ZRS A;  4IL1 A;  4GBA A;  3IQQ A;  2B1U A;  4JPZ B;  5FYX A;  1VRK A;  1KK8 B;  2H2K A;  3PAT A;  1MUX A;  2KFG A;  2LLU A;  1OSA A;  1F55 A;  1JWD A;  1LIN A;  4N1F A;  2BL0 C;  3GK2 A;  1G33 A;  3WHU B;  1WLZ A;  4AQJ A;  1YRT B;  1IKU A;  2O60 A;  1YX7 A;  1DGV A;  3AKA A;  4C0L A;  2KGB C;  4FQO A;  4OKH A;  1CFP A;  1OZO A;  1UHJ A;  4ZCU A;  4N1G A;  1J55 A;  1Q80 A;  4ICB A;  2CT9 A;  1F71 A;  1ZMZ A;  2FCD A;  1F54 A;  4OCI A;  4PHM A;  1CLM A;  1K9P A;  2LVK A;  1U5I B;  4FTG A;  2BE4 A;  5ER5 A;  1QLS A;  1NUB A;  4GAO A;  2E6W A;  1R6P A;  4GGF A;  1CFF A;  1J7O A;  1CB1 A;  3E3R A;  4HRE E;  4MZK A;  1YVH A;  2O5G A;  3BUO B;  1ALW A;  4Q04 A;  1DF0 A;  1QX7 A;  4YI9 A;  2L5X B;  3SG3 A;  1FF1 A;  1KFX L;  2LMV A;  2JZI A;  1DJW A;  1CLL A;  4OR9 B;  1SCM C;  1QVI Z;  4DS7 A;  1H4B A;  1XYD A;  1YUT A;  1Y1A A;  2I18 A;  1BLQ A;  2LVJ A;  1YTZ C;  1GQM A;  3LK0 A;  3D10 A;  1F70 A;  4E68 A;  1W7I B;  1K9U A;  4PDZ A;  1A03 A;  1M39 A;  1WRK A;  1CM1 A;  4MZL A;  2K2A A;  1CTR A;  2BCB A;  2CTN A;  1FI6 A;  3TDZ A;  2M49 B;  1MR8 A;  4CFQ A;  5G08 A;  2M1U A;  3BQ3 A;  2LHL A;  2CBL A;  2LC5 A;  3I5F C;  2NZ0 A;  1TIZ A;  2LLS A;  4CFR A;  1M31 A;  1OMV A;  2BBN A;  1BJF A;  2M8U A;  1A4P A;  1TNX A;  1AUI B;  1LA0 A;  1UHN A;  4BY5 A;  1FPW A;  2FJU B;  2KNE A;  2ZFD A;  2BEC A;  5AEQ A;  1QIV A;  1L2O B;  3CR5 X;  1K8U A;  3M0W A;  2KBI A;  2JQ6 A;  2CXJ A;  2KI4 B;  2LNK A;  3KEV A;  2KYF A;  3LL8 B;  2LVV A;  3FIA A;  1QAS A;  5D69 A;  2KQY A;  3OP0 A;  2JNX A;  2F8P A;  2LV7 A;  2G9B A;  4XJK A;  3OX6 A;  3CR2 A;  2JRF A;  4NQG A;  2MRD A;  4YGC B;  2JNF A;  1IRJ A;  1WY9 A;  1CLB A;  3BOW A;  3I5G C;  2WCE A;  4MRX A;  1W7J B;  3SG6 A;  2ZNE A;  3AKB A;  3CWG A;  1LKJ A;  1FI5 A;  1JUO A;  1JF2 A;  2K2F A;  3VGO A;  2EC6 B;  4WRI A;  3F45 A;  1BMO A;  1TCO B;  1TCF A;  2L98 A;  1MWN A;  4M2Q A;  2ZN9 A;  2BCA A;  5JJG A;  5J3X A;  4MEW A;  4QJ3 B;  1BF5 A;  1J7R A;  1EG4 A;  1R2U A;  3SIB A;  1BR4 B;  1MQ1 A;  2LUX A;  3NSO A;  5CPV A;  4DRW A;  1BG1 A;  2F2P A;  2HQW A;  2SCP A;  3O78 A;  1J7Q A;  1QIW A;  1ALV A;  1C7W A;  1KK7 Z;  1SR6 B;  3BXK A;  1KWO C;  3DVJ A;  3SG5 A;  2KI6 C;  2OTG C;  1NPQ A;  1XFU O;  2JTT A;  3VRO A;  4NDD A;  2JT0 A;  1DJZ A;  1NIW A;  3BUX B;  4YGD B;  2NCO A;  1B47 A;  1QX2 A;  2AUC A;  1LXF C;  1SY9 A;  1ZUZ A;  1DGU A;  1RJV A;  4NDB A;  5GQQ C;  2LE9 B;  3GOF A;  2KAV A;  4PHJ A;  1WDC B;  1ZFS A;  3BYA A;  2JXC A;  1S3P A;  1IJ5 A;  1XFZ O;  1B8R A;  2FOT A;  1KFU S;  4MLW A;  2ZN8 A;  4GNK B;  3I5I B;  1QX5 B;  3TUY C;  1QTX A;  4YGB B;  1AVS A;  1BOD A;  2M29 A;  1DJG A;  1TRF A;  4N5X A;  4YGA A;  1QV1 A;  1H8B A;  5DKR A;  1S5G Y;  1DTL A;  4YBH B;  3TS5 B;  4U8D A;  1EH2 A;  2JTZ A;  2K8M B;  2PRU A;  1TN4 A;  2QPT A;  3PM8 A;  1XFV O;  4BY4 A;  4CPV A;  5DKQ A;  1QXP A;  3TDI A;  4DCK A;  4D1E A;  4YGE B;  3TDU A;  2JPT A;  2NLN A;  2A4J A;  2LP2 A;  2JOJ A;  2K61 A;  2KI6 D;  2Q91 A;  4UPG A;  2HQ8 A;  4JQ0 D;  1M45 A;  4XJK B;  1IG5 A;  1NX2 A;  1S26 D;  1FBV A;  3JTD B;  1SYM A;  1XFW O;  3FWC A;  1NCZ A;  1YX8 A;  1EJ3 A;  1CMF A;  1D1O A;  4PHN A;  1CDP A;  1YUS A;  4L9M A;  2JWW A;  3PN7 B;  1AK8 A;  2WOS A;  4PE1 A;  2LM5 A;  5I2L A;  2ZKM X;  1E8A A;  5AAN A;  5PAL A;  2CCM A;  2Q4U A;  1J1D A;  2Y1M A;  1SL8 A;  2L0P A;  3VRN A;  1KFX S;  1LA3 A;  1CKK A;  1KK8 C;  1NX1 A;  1TNQ A;  1TTX A;  2KOT A;  2PSR A;  3ZWH A;  4C0J A;  2I94 A;  4MRY A;  2K7B A;  2K7O A;  1KQM B;  4ORB B;  1QLK A;  2VRG A;  1UHI A;  1DJH A;  2KYC A;  3EKH A;  1CFC A;  1YUR A;  1XA5 A;  5D7F A;  2D8N A;  2G2B A;  3I5H B;  3PAL A;  3I5I C;  2ISD A;  2HET A;  1CMG A;  5JOL A;  2L4I A;  2QAC A;  1PUL A;  1PSR A;  1A75 B;  2LLT A;  3A8R A;  3CS1 A;  5HKW A;  2LMT A;  4DIR A;  4I5L B;  3TS5 C;  1SCV A;  3GK4 X;  3C1V A;  3EK4 A;  2NCP A;  1AJ5 A;  1K95 A;  1S6I A;  1V1F A;  1HT9 A;  1OMR A;  1U5I A;  1ODB A;  3NSI A;  3NXA A;  4WQ3 A;  3K21 A;  1SPY A;  2DOQ A;  2MAZ A;  4R1E A;  3FS7 A;  1B8L A;  1UP5 A;  4USL A;  4PE7 A;  2Y5I A;  1B9A A;  3D0Y A;  2JT3 A;  1YUU A;  3OB1 B;  2MBX A;  1A2X A;  2I7A A;  3OB2 B;  2TN4 A;  2ZND A;  2M97 A;  1UHK A;  1XK4 C;  2L51 A;  1J1E A;  1NP8 A;  1RWY A;  2NXQ A;  1UUS A;  2H61 C;  1XK4 A;  1OZS A;  2K0J A;  2LVI A;  2BE6 A;  3ICB A;  3OX5 A;  2H61 A;  4ZCV A;  5HKZ A;  1JFJ A;  2KAY A;  2LHI A;  3KO0 A;  1A29 A;  2GGZ A;  4WQ2 A;  1K2H A;  1GJY A;  1NX0 A;  5BPJ A;  2HPS A;  3SG4 A;  1TOP A;  4GPL B;  1XVJ A;  2M7L A;  1B7T Z;  1MF8 B;  1LVC D;  1BU3 A;  1SL9 A;  3AAJ A;  2GV5 A;  5HLO A;  1EG3 A;  1DF0 B;  1KQM C;  1IH0 A;  1JF0 A;  2LMU A;  1WRZ A;  1L2O C;  2OS8 B;  1N2D A;  1NCX A;  1YRU B;  2KAX A;  3JVT B;  1PSB A;  3LK1 A;  1EXR A;  2HF5 A;  4ORA B;  3CLN A;  4MN0 A;  3EKJ A;  5KU1 A;  5I8N A;  3EVV A;  2KI4 C;  1RFJ A;  2CNP A;  4PCW A;  4HRG A;  2MLF C;  3DVM A;  5AXI A;  4QJ5 B;  1IJ6 A;  2COL B;  1SMG A;  3BUM B;  2WCB A;  1QVI Y;  2F33 A;  3PSR A;  1F4Q A;  1OOJ A;  1QAT A;  1CM4 A;  2AAO A;  3CZT X;  3FWB A;  3NSK A;  1CDN A;  1OMD A;  1SL7 A;  3HX4 A;  1S6J A;  1YR5 A;  1SKT A;  2JXL A;  2F3Z A;  2EHB A;  2R2I A;  1G8I A;  1DMO A;  3SG7 A;  4MSP A;  2LAN A;  4P2Y B;  3DVK A;  2MLE C;  2JU0 A;  1CFD A;  2OPO A;  1GGW A;  4M2P A;  1X02 A;  1DJX A;  2EC6 C;  2F2O A;  1SK6 D;  3DVE A;  1AJ4 A;  2V53 A;  1S1E A;  2PVB A;  1BT6 A;  2KQ6 A;  2WND A;  1NCY A;  4PAL A;  5TNC A;  1YVL A;  2AMI A;  1M46 A;  2MHH A;  4C0K A;  3NSL A;  3VRR A;  2BKI B;  1B1G A;  3DF0 A;  1KQV A;  1PAL A;  4GUK A;  3AAK A;  1NSH A;  1CDL A;  4TNC A;  3SG2 A;  3TZ1 A;  1N65 A;  1SW8 A;  1V1G A;  1ZOT B;  2BBM A;  3CGA A;  3QRX A;  3CTN A;  1QJT A;  4PE0 A;  1TNP A;  1QV0 A;  3BOW B;  4GGF C;  3VRP A;  2LUC A;  4HSZ A;  1SR6 C;  1F8H A;  1L7Z A;  2KSP A;  1DJI A; 
#chains in the Genus database with same CATH topology
 3I5G B;  5ER4 X;  1UHH A;  1SRA A;  3SJS A;  3EVR A;  1DT7 B;  3BUW B;  1IWQ A;  1OE9 B;  2JC2 A;  2OS8 C;  3JVT C;  2LCP A;  1JSA A;  1UUR A;  3D0Y B;  1JC2 A;  2KHN A;  2BCX A;  1B8C A;  1FW4 A;  3BUN B;  3R72 A;  5HKY A;  3O2P A;  5HYD A;  4QJ4 B;  1BOC A;  3WXA A;  5K89 A;  1XFY O;  4A4B A;  2L50 A;  5CSI A;  3LCP C;  2EGD A;  4GGN A;  3DD4 A;  2ZRT A;  1WDC C;  1SNL A;  3WHT B;  4CID A;  3RM1 A;  5I2O A;  1MHO A;  2FJY A;  2K7D A;  1DVI A;  3HCM A;  3SIA A;  1QS7 A;  2M3W A;  1PK0 D;  3D77 A;  2L2E A;  3ZNI A;  2MA2 A;  1MXE A;  5KTY A;  1GGZ A;  2L4H A;  4A4C A;  3S0G A;  2WC8 A;  3EK7 A;  3EVU A;  1EL4 A;  1OQP A;  1S36 A;  1K94 A;  1PVA A;  1M63 B;  4MVF A;  5DKN A;  1S5G Z;  5CSJ A;  1K93 D;  1KK7 Y;  1KWO B;  3H4S E;  1OOH A;  5F6T A;  5CSN A;  4JWQ A;  2OTG B;  1B7T Y;  3KPX A;  2JT8 A;  4CLN A;  1G4Y R;  1Y6W A;  1ZAC A;  4AQI A;  5AFP A;  1DJY A;  4OVN F;  2JUL A;  1K96 A;  2QEB A;  4HRH A;  5CSF A;  4NDC A;  5AER A;  3OHM B;  1AP4 A;  5KSZ A;  1XFX O;  1AHR A;  2Y1N A;  2Y4Q A;  3NHI A;  4ETO A;  1PVB A;  1TNW A;  1CNP A;  3CR4 X;  1IQ3 A;  4MBE A;  3L47 A;  1CDM A;  5HLV A;  5B8I B;  2M7N A;  2PYQ A;  2WOR A;  3JTD C;  4I5K A;  3GK1 A;  2WCF A;  1RK9 A;  4F0Z B;  2BL0 B;  2KDH A;  3MSE B;  2WCH A;  2SAS A;  2P6B B;  4I5J A;  4PE4 A;  2PAL A;  3S0F A;  3KHE A;  2GGM A;  2E30 A;  2MJW B;  1KSM A;  3R1V A;  3PN7 C;  1NYA A;  3TUY B;  1RRO A;  3PLF B;  2PAS A;  3B7A A;  3BFA A;  4GFT A;  3O4Y A;  3S0E A;  2I2R E;  1Y0V H;  3O6B A;  1JFK A;  4MZJ A;  1K9K A;  1NWD A;  2M9G A;  2FCE A;  1F4O A;  1N0Y A;  1PRW A;  1WLM A;  2M0R A;  3S0A A;  5IBW A;  1C07 A;  2F3Y A;  4PHK A;  2KBM A;  3KF9 A;  1KCY A;  3DF0 B;  5I2Q A;  3IQO A;  1XO5 A;  1C7V A;  2BKH B;  1SBJ A;  2PMY A;  3L4A A;  3IF7 A;  2KFF A;  4YI8 A;  3I5H C;  3UO9 A;  4YRU A;  1S6C A;  2LP3 A;  2M1K B;  3EK8 A;  1SCM B;  1RTP 1;  4M2O A;  1KSO A;  2K7C A;  2RGI A;  1HQV A;  4OV2 A;  4XYN A;  1BR1 B;  3VB1 A;  1KFU L;  4AOM A;  1WRL A;  3B87 A;  4P5O E;  1Y1X A;  3PFV A;  1REC A;  2KFH A;  1MXL C;  1JBA A;  3WNX B;  3NGV A;  1DEK A;  1A75 A;  4ORC B;  4I5N B;  3SS3 A;  1IGV A;  2LAP A;  1IQ5 A;  1Y1U A;  2WCK A;  3LLE A;  4DUQ A;  1B4C A;  1J7P A;  2IS9 A;  1NX3 A;  1UWO A;  3RLZ A;  2K60 A;  3A4U B;  3FE6 A;  1K90 D;  3I5F B;  2KGR A;  2ZRS A;  4IL1 A;  3VRQ A;  4GBA A;  3IQQ A;  2B1U A;  4JPZ B;  2ERB A;  3S0D A;  5FYX A;  1VRK A;  1KK8 B;  2H2K A;  3PAT A;  1MUX A;  1F8H A;  2GTE A;  2KFG A;  2LLU A;  1OSA A;  1F55 A;  1JWD A;  3D76 A;  1LIN A;  4N1F A;  2BL0 C;  3GK2 A;  1G33 A;  3WHU B;  1WLZ A;  3L4L A;  4AQJ A;  1YRT B;  1IKU A;  2O60 A;  1YX7 A;  1DGV A;  3AKA A;  4C0L A;  2KGB C;  4FQO A;  4OKH A;  1CFP A;  1OZO A;  1UHJ A;  4ZCU A;  2QEH A;  4N1G A;  1IIO A;  1J55 A;  1Q80 A;  4ICB A;  2CT9 A;  5FI7 A;  1F71 A;  1ZMZ A;  2FCD A;  1F54 A;  3DY9 A;  4OCI A;  1CLM A;  4PHM A;  1K9P A;  2LVK A;  1U5I B;  4FTG A;  2BE4 A;  5ER5 A;  1QLS A;  1NUB A;  4GAO A;  2E6W A;  1R6P A;  4GGF A;  1CFF A;  1J7O A;  1CB1 A;  3E3R A;  4HRE E;  4MZK A;  1Z4H A;  1YVH A;  2O5G A;  3BUO B;  3SS4 A;  5EL2 A;  1ALW A;  4Q04 A;  1DF0 A;  1QX7 A;  4YI9 A;  2L5X B;  3SG3 A;  1FF1 A;  1KFX L;  2LMV A;  2JZI A;  1DJW A;  1CLL A;  4OR9 B;  1SCM C;  1QVI Z;  4DS7 A;  1H4B A;  4KYN A;  1XYD A;  1YUT A;  1DC1 A;  1Y1A A;  2I18 A;  1BLQ A;  2LVJ A;  1YTZ C;  1GQM A;  3LK0 A;  3D10 A;  1F70 A;  4E68 A;  1W7I B;  1P28 A;  3SS5 A;  4IJ7 A;  1K9U A;  4PDZ A;  3D74 A;  1A03 A;  3QME A;  1M39 A;  1WRK A;  1CM1 A;  4MZL A;  2K2A A;  1CTR A;  2BCB A;  2CTN A;  1FI6 A;  3TDZ A;  2M49 B;  1MR8 A;  4CFQ A;  5G08 A;  2M1U A;  3BQ3 A;  5I94 A;  2LHL A;  2CBL A;  2LC5 A;  3I5F C;  1QWV A;  2NZ0 A;  1LS8 A;  1TIZ A;  2LLS A;  4CFR A;  1M31 A;  1OMV A;  2BBN A;  1BJF A;  2M8U A;  1A4P A;  1TNX A;  1AUI B;  1LA0 A;  1UHN A;  4BY5 A;  1FPW A;  2FJU B;  2KNE A;  2ZFD A;  2BEC A;  5AEQ A;  1QIV A;  5FI2 A;  1L2O B;  3CR5 X;  1K8U A;  3B6X A;  3M0W A;  2KBI A;  2JQ6 A;  2CXJ A;  2KI4 B;  4INX A;  2LNK A;  3KEV A;  2KYF A;  3LL8 B;  2LVV A;  3FIA A;  1QAS A;  2L5Y A;  5D69 A;  2KQY A;  3NHT A;  2BAP A;  3OP0 A;  2JNX A;  2F8P A;  2LV7 A;  2G9B A;  4XJK A;  3OX6 A;  3CDN A;  3CR2 A;  2JRF A;  3D78 A;  2MRD A;  4NQG A;  4YGC B;  2JNF A;  1IRJ A;  1WY9 A;  1CLB A;  3BOW A;  3I5G C;  2WCE A;  4MRX A;  1W7J B;  3SG6 A;  2ZNE A;  3AKB A;  3CWG A;  1LKJ A;  1FI5 A;  1TWO A;  1JUO A;  2KPH A;  1JF2 A;  2K2F A;  3VGO A;  2EC6 B;  4WRI A;  3F45 A;  3R1P A;  1BMO A;  1TCO B;  1TCF A;  2QEV A;  2L98 A;  2QEO A;  1MWN A;  4M2Q A;  2ZN9 A;  2BCA A;  5JJG A;  3FE8 A;  5J3X A;  4MEW A;  2WCJ A;  4QJ3 B;  1J7R A;  1BF5 A;  1EG4 A;  1R2U A;  5D3O A;  4F7F A;  1DEL A;  3SIB A;  1BR4 B;  1MQ1 A;  4FQT A;  2LUX A;  3NSO A;  5CPV A;  4DRW A;  1BG1 A;  3PJI A;  2F2P A;  2HQW A;  2SCP A;  4OZD A;  1OOI X;  3CZ1 A;  3Q8I A;  3O78 A;  1J7Q A;  1QIW A;  3IVT A;  1ALV A;  1C7W A;  1KK7 Z;  1SR6 B;  3BXK A;  1KWO C;  3DVJ A;  3SG5 A;  2KI6 C;  2OTG C;  1NPQ A;  3N7H A;  1XFU O;  2JTT A;  3VRO A;  4NDD A;  2JT0 A;  1DJZ A;  1NIW A;  3BUX B;  4YGD B;  2NCO A;  1B47 A;  1QX2 A;  2AUC A;  1LXF C;  2L2C A;  1SY9 A;  1ZUZ A;  3UNW A;  1DGU A;  1RJV A;  4NDB A;  3FE9 A;  2LE9 B;  5GQQ C;  3GOF A;  2KAV A;  4PHJ A;  1WDC B;  1ZFS A;  3BYA A;  2JXC A;  1OW4 A;  1SSE B;  1S3P A;  1IJ5 A;  1XFZ O;  1B8R A;  2FOT A;  1KFU S;  4MLW A;  3RZS A;  2ZN8 A;  3O4X A;  4GNK B;  3CZ2 A;  3B88 A;  1QX5 B;  3I5I B;  3TUY C;  1QTX A;  3OGN A;  4YGB B;  1AVS A;  1BOD A;  2M29 A;  1DJG A;  1TRF A;  4N5X A;  4YGA A;  1QV1 A;  3CYZ A;  1H8B A;  3BJH A;  5DKR A;  1S5G Y;  2H8V A;  1C3Z A;  1DTL A;  4YBH B;  3TS5 B;  4U8D A;  1EH2 A;  2JTZ A;  2K8M B;  2PRU A;  1TN4 A;  2QPT A;  3PM8 A;  1XFV O;  4BY4 A;  4CPV A;  5DKQ A;  1QXP A;  3TDI A;  4DCK A;  4JD9 A;  4D1E A;  2BNX A;  4YGE B;  3TDU A;  3CAB A;  2JPT A;  2NLN A;  2A4J A;  2LP2 A;  2JOJ A;  2K61 A;  2KI6 D;  3DXL A;  2Q91 A;  4UPG A;  2HQ8 A;  2WCL A;  4JQ0 D;  1M45 A;  4XJK B;  1IG5 A;  1NX2 A;  1S26 D;  1FBV A;  3JTD B;  1SYM A;  1XFW O;  2JPO A;  3FWC A;  5DIC A;  1NCZ A;  1YX8 A;  1EJ3 A;  1CMF A;  1GM0 A;  1D1O A;  4PHN A;  1CDP A;  1YUS A;  4L9M A;  2JWW A;  3PN7 B;  1AK8 A;  2WOS A;  3BFH A;  4PE1 A;  2LM5 A;  3CZ0 A;  5I2L A;  2ZKM X;  1E8A A;  5AAN A;  5PAL A;  3V2L A;  2CCM A;  2Q4U A;  1J1D A;  2Y1M A;  3DZT A;  4JKT A;  1SL8 A;  2L0P A;  3VRN A;  2KLE A;  2WC6 A;  1KFX S;  1LA3 A;  3PM2 A;  1CKK A;  1KK8 C;  1NX1 A;  1TNQ A;  1OOG A;  1TTX A;  1TUJ A;  1W9Z A;  2KOT A;  2I94 A;  2PSR A;  4MRY A;  3ZWH A;  4C0J A;  2K7B A;  2K7O A;  1KQM B;  4ORB B;  1QLK A;  2VRG A;  1UHI A;  1DJH A;  2KYC A;  3EKH A;  1CFC A;  1YUR A;  1XA5 A;  5D7F A;  2D8N A;  2G2B A;  3I5H B;  3PAL A;  2QDI A;  3I5I C;  2ISD A;  2HET A;  1CMG A;  3R1O A;  5JOL A;  2L4I A;  2QAC A;  2WCM A;  1XFR A;  1PUL A;  1PSR A;  1A75 B;  2LLT A;  3A8R A;  3CS1 A;  5HKW A;  2LMT A;  4DIR A;  4I5L B;  3TS5 C;  1SCV A;  3GK4 X;  3C1V A;  3EK4 A;  2NCP A;  1AJ5 A;  1K95 A;  1S6I A;  1V1F A;  1HT9 A;  2P70 A;  3D75 A;  1OMR A;  1U5I A;  1ODB A;  3NSI A;  3NXA A;  4WQ3 A;  3K21 A;  1SPY A;  2DOQ A;  2MAZ A;  4R1E A;  3FS7 A;  1B8L A;  1UP5 A;  4USL A;  4PE7 A;  2Y5I A;  1B9A A;  3D0Y A;  2JT3 A;  1YUU A;  3OB1 B;  5FI6 A;  1A2X A;  2MBX A;  2I7A A;  3OB2 B;  2TN4 A;  2ZND A;  2M97 A;  1UHK A;  1XK4 C;  2L51 A;  1J1E A;  1NP8 A;  1RWY A;  2NXQ A;  1UUS A;  2H61 C;  1XK4 A;  2P71 A;  1OZS A;  2K0J A;  2LVI A;  2BE6 A;  3ICB A;  3OX5 A;  2H61 A;  4ZCV A;  5HKZ A;  1JFJ A;  1Z2C B;  2KAY A;  2LHI A;  3KO0 A;  4INW A;  1A29 A;  2GGZ A;  4WQ2 A;  1K2H A;  1GJY A;  1NX0 A;  5BPJ A;  2HPS A;  3S0B A;  3SG4 A;  1DQE A;  1TOP A;  4GPL B;  1XVJ A;  1ORG A;  1B7T Z;  1MF8 B;  1LVC D;  1BU3 A;  1SL9 A;  3AAJ A;  3BFB A;  3DYE A;  2GV5 A;  5HLO A;  1EG3 A;  1DF0 B;  1KQM C;  1IH0 A;  2KLD A;  1JF0 A;  2LMU A;  1WRZ A;  1L2O C;  2OS8 B;  1N2D A;  1NCX A;  1YRU B;  2KAX A;  3JVT B;  1PSB A;  3LK1 A;  1EXR A;  2HF5 A;  4ORA B;  3CLN A;  4MN0 A;  3EKJ A;  5KU1 A;  5I8N A;  3EVV A;  2KI4 C;  1RFJ A;  2CNP A;  4PCW A;  3EG5 B;  4HRG A;  2MLF C;  3DVM A;  5AXI A;  4QJ5 B;  1IJ6 A;  2COL B;  1SMG A;  3BUM B;  2WCB A;  3D73 A;  1QVI Y;  2F33 A;  3OBV A;  3PSR A;  1F4Q A;  1OOJ A;  1QAT A;  1CM4 A;  2AAO A;  3CZT X;  3FWB A;  3NSK A;  2YGU A;  1CDN A;  1OMD A;  2M7L A;  1SL7 A;  3HX4 A;  1S6J A;  1YR5 A;  1SKT A;  2JXL A;  2F3Z A;  1OOF A;  2EHB A;  2R2I A;  1G8I A;  1DMO A;  3SG7 A;  4MSP A;  2LAN A;  4P2Y B;  3DVK A;  2MLE C;  2JU0 A;  1CFD A;  3K1E A;  2OPO A;  1GGW A;  4M2P A;  1X02 A;  1DJX A;  2EC6 C;  2F2O A;  1SK6 D;  3DVE A;  1AJ4 A;  2V53 A;  1T14 A;  1S1E A;  2PVB A;  1BT6 A;  2KQ6 A;  2WND A;  1NCY A;  4PAL A;  5TNC A;  1YVL A;  2AMI A;  1M46 A;  2MHH A;  4C0K A;  3NSL A;  3B86 A;  3VRR A;  2BKI B;  1B1G A;  3DF0 A;  1KQV A;  1PAL A;  2PQL A;  4GUK A;  3AAK A;  1NSH A;  1CDL A;  4TNC A;  3SG2 A;  3TZ1 A;  1N65 A;  4PT1 A;  5HL1 A;  2WC5 A;  1SW8 A;  1V1G A;  1ZOT B;  2BBM A;  3CGA A;  3QRX A;  3CTN A;  1QJT A;  4PE0 A;  1TNP A;  1QV0 A;  3BOW B;  4GGF C;  3VRP A;  2LUC A;  4HSZ A;  1SR6 C;  1C3Y A;  1L7Z A;  2KSP A;  1DJI A;  1TUZ A; 
#chains in the Genus database with same CATH homology
 3I5G B;  5ER4 X;  1UHH A;  1SRA A;  3SJS A;  3EVR A;  1DT7 B;  3BUW B;  1IWQ A;  1OE9 B;  2JC2 A;  2OS8 C;  3JVT C;  2LCP A;  1JSA A;  1UUR A;  3D0Y B;  1JC2 A;  2KHN A;  2BCX A;  1B8C A;  1FW4 A;  3BUN B;  5HKY A;  3O2P A;  5HYD A;  4QJ4 B;  1BOC A;  3WXA A;  5K89 A;  1XFY O;  4A4B A;  2L50 A;  5CSI A;  3LCP C;  2EGD A;  4GGN A;  3DD4 A;  2ZRT A;  1WDC C;  1SNL A;  3WHT B;  4CID A;  3RM1 A;  5I2O A;  1MHO A;  2K7D A;  1DVI A;  3HCM A;  3SIA A;  1QS7 A;  2M3W A;  1PK0 D;  2L2E A;  3ZNI A;  2MA2 A;  1MXE A;  5KTY A;  1GGZ A;  2L4H A;  4A4C A;  2WC8 A;  3EK7 A;  3EVU A;  1EL4 A;  1OQP A;  1S36 A;  1K94 A;  1PVA A;  1M63 B;  4MVF A;  5DKN A;  1S5G Z;  5CSJ A;  1K93 D;  1KK7 Y;  1KWO B;  3H4S E;  5F6T A;  5CSN A;  4JWQ A;  2OTG B;  1B7T Y;  3KPX A;  2JT8 A;  4CLN A;  1G4Y R;  1Y6W A;  1ZAC A;  4AQI A;  5AFP A;  1DJY A;  4OVN F;  2JUL A;  1K96 A;  4HRH A;  5CSF A;  4NDC A;  5AER A;  3OHM B;  1AP4 A;  5KSZ A;  1XFX O;  1AHR A;  2Y1N A;  2Y4Q A;  4ETO A;  1PVB A;  1TNW A;  1CNP A;  3CR4 X;  1IQ3 A;  4MBE A;  1CDM A;  5HLV A;  5B8I B;  2M7N A;  2WOR A;  4I5K A;  3JTD C;  3GK1 A;  2WCF A;  1RK9 A;  4F0Z B;  2BL0 B;  2KDH A;  3MSE B;  2SAS A;  2P6B B;  4I5J A;  4PE4 A;  2PAL A;  3KHE A;  2GGM A;  2E30 A;  2MJW B;  1KSM A;  3PN7 C;  1NYA A;  3TUY B;  1RRO A;  3PLF B;  2PAS A;  4GFT A;  3O4Y A;  2I2R E;  1Y0V H;  3O6B A;  1JFK A;  4MZJ A;  1K9K A;  1NWD A;  2M9G A;  2FCE A;  1F4O A;  1N0Y A;  1PRW A;  1WLM A;  2M0R A;  5IBW A;  1C07 A;  2F3Y A;  4PHK A;  2KBM A;  3KF9 A;  1KCY A;  3DF0 B;  5I2Q A;  3IQO A;  1XO5 A;  1C7V A;  2BKH B;  1SBJ A;  2PMY A;  3IF7 A;  2KFF A;  4YI8 A;  3I5H C;  4YRU A;  1S6C A;  2LP3 A;  2M1K B;  3EK8 A;  1SCM B;  1RTP 1;  4M2O A;  1KSO A;  2K7C A;  2RGI A;  1HQV A;  4OV2 A;  4XYN A;  1BR1 B;  4AOM A;  1KFU L;  1WRL A;  4P5O E;  1Y1X A;  3PFV A;  1REC A;  2KFH A;  1MXL C;  1JBA A;  3WNX B;  1A75 A;  4ORC B;  4I5N B;  1IGV A;  2LAP A;  1IQ5 A;  1Y1U A;  3LLE A;  4DUQ A;  1B4C A;  1J7P A;  2IS9 A;  1NX3 A;  1UWO A;  3RLZ A;  3A4U B;  3I5F B;  1K90 D;  3VRQ A;  2KGR A;  2ZRS A;  4IL1 A;  4GBA A;  3IQQ A;  2B1U A;  4JPZ B;  5FYX A;  1VRK A;  1KK8 B;  2H2K A;  3PAT A;  1MUX A;  2KFG A;  2LLU A;  1OSA A;  1F55 A;  1JWD A;  1LIN A;  4N1F A;  2BL0 C;  3GK2 A;  1G33 A;  3WHU B;  1WLZ A;  4AQJ A;  1YRT B;  1IKU A;  2O60 A;  1YX7 A;  1DGV A;  3AKA A;  4C0L A;  2KGB C;  4FQO A;  4OKH A;  1CFP A;  1OZO A;  1UHJ A;  4ZCU A;  4N1G A;  1J55 A;  1Q80 A;  4ICB A;  2CT9 A;  1F71 A;  1ZMZ A;  2FCD A;  1F54 A;  4OCI A;  4PHM A;  1CLM A;  1K9P A;  2LVK A;  1U5I B;  4FTG A;  2BE4 A;  5ER5 A;  1QLS A;  1NUB A;  4GAO A;  2E6W A;  1R6P A;  4GGF A;  1CFF A;  1J7O A;  1CB1 A;  3E3R A;  4HRE E;  4MZK A;  1YVH A;  2O5G A;  3BUO B;  1ALW A;  4Q04 A;  1DF0 A;  1QX7 A;  4YI9 A;  2L5X B;  3SG3 A;  1FF1 A;  1KFX L;  2LMV A;  2JZI A;  1DJW A;  1CLL A;  4OR9 B;  1SCM C;  1QVI Z;  4DS7 A;  1H4B A;  1XYD A;  1YUT A;  1Y1A A;  2I18 A;  1BLQ A;  2LVJ A;  1YTZ C;  1GQM A;  3LK0 A;  3D10 A;  1F70 A;  4E68 A;  1W7I B;  1K9U A;  4PDZ A;  1A03 A;  1M39 A;  1WRK A;  1CM1 A;  4MZL A;  2K2A A;  1CTR A;  2BCB A;  2CTN A;  1FI6 A;  3TDZ A;  2M49 B;  1MR8 A;  4CFQ A;  5G08 A;  2M1U A;  3BQ3 A;  2LHL A;  2CBL A;  2LC5 A;  3I5F C;  2NZ0 A;  1TIZ A;  2LLS A;  4CFR A;  1M31 A;  1OMV A;  2BBN A;  1BJF A;  2M8U A;  1A4P A;  1TNX A;  1AUI B;  1LA0 A;  1UHN A;  4BY5 A;  1FPW A;  2FJU B;  2KNE A;  2ZFD A;  2BEC A;  5AEQ A;  1QIV A;  1L2O B;  3CR5 X;  1K8U A;  3M0W A;  2KBI A;  2JQ6 A;  2CXJ A;  2KI4 B;  2LNK A;  3KEV A;  2KYF A;  3LL8 B;  2LVV A;  3FIA A;  1QAS A;  5D69 A;  2KQY A;  3OP0 A;  2JNX A;  2F8P A;  2LV7 A;  2G9B A;  4XJK A;  3OX6 A;  3CR2 A;  2JRF A;  4NQG A;  2MRD A;  4YGC B;  2JNF A;  1IRJ A;  1WY9 A;  1CLB A;  3BOW A;  3I5G C;  2WCE A;  4MRX A;  1W7J B;  3SG6 A;  2ZNE A;  3AKB A;  3CWG A;  1LKJ A;  1FI5 A;  1JUO A;  1JF2 A;  2K2F A;  3VGO A;  2EC6 B;  4WRI A;  3F45 A;  1BMO A;  1TCO B;  1TCF A;  2L98 A;  1MWN A;  4M2Q A;  2ZN9 A;  2BCA A;  5JJG A;  5J3X A;  4MEW A;  4QJ3 B;  1BF5 A;  1J7R A;  1EG4 A;  1R2U A;  3SIB A;  1BR4 B;  1MQ1 A;  2LUX A;  3NSO A;  5CPV A;  4DRW A;  1BG1 A;  2F2P A;  2HQW A;  2SCP A;  3O78 A;  1J7Q A;  1QIW A;  1ALV A;  1C7W A;  1KK7 Z;  1SR6 B;  3BXK A;  1KWO C;  3DVJ A;  3SG5 A;  2KI6 C;  2OTG C;  1NPQ A;  1XFU O;  2JTT A;  3VRO A;  4NDD A;  2JT0 A;  1DJZ A;  1NIW A;  3BUX B;  4YGD B;  2NCO A;  1B47 A;  1QX2 A;  2AUC A;  1LXF C;  1SY9 A;  1ZUZ A;  1DGU A;  1RJV A;  4NDB A;  5GQQ C;  2LE9 B;  3GOF A;  2KAV A;  4PHJ A;  1WDC B;  1ZFS A;  3BYA A;  2JXC A;  1S3P A;  1IJ5 A;  1XFZ O;  1B8R A;  2FOT A;  1KFU S;  4MLW A;  2ZN8 A;  4GNK B;  3I5I B;  1QX5 B;  3TUY C;  1QTX A;  4YGB B;  1AVS A;  1BOD A;  2M29 A;  1DJG A;  1TRF A;  4N5X A;  4YGA A;  1QV1 A;  1H8B A;  5DKR A;  1S5G Y;  1DTL A;  4YBH B;  3TS5 B;  4U8D A;  1EH2 A;  2JTZ A;  2K8M B;  2PRU A;  1TN4 A;  2QPT A;  3PM8 A;  1XFV O;  4BY4 A;  4CPV A;  5DKQ A;  1QXP A;  3TDI A;  4DCK A;  4D1E A;  4YGE B;  3TDU A;  2JPT A;  2NLN A;  2A4J A;  2LP2 A;  2JOJ A;  2K61 A;  2KI6 D;  2Q91 A;  4UPG A;  2HQ8 A;  4JQ0 D;  1M45 A;  4XJK B;  1IG5 A;  1NX2 A;  1S26 D;  1FBV A;  3JTD B;  1SYM A;  1XFW O;  3FWC A;  1NCZ A;  1YX8 A;  1EJ3 A;  1CMF A;  1D1O A;  4PHN A;  1CDP A;  1YUS A;  4L9M A;  2JWW A;  3PN7 B;  1AK8 A;  2WOS A;  4PE1 A;  2LM5 A;  5I2L A;  2ZKM X;  1E8A A;  5AAN A;  5PAL A;  2CCM A;  2Q4U A;  1J1D A;  2Y1M A;  1SL8 A;  2L0P A;  3VRN A;  1KFX S;  1LA3 A;  1CKK A;  1KK8 C;  1NX1 A;  1TNQ A;  1TTX A;  2KOT A;  2PSR A;  3ZWH A;  4C0J A;  2I94 A;  4MRY A;  2K7B A;  2K7O A;  1KQM B;  4ORB B;  1QLK A;  2VRG A;  1UHI A;  1DJH A;  2KYC A;  3EKH A;  1CFC A;  1YUR A;  1XA5 A;  5D7F A;  2D8N A;  2G2B A;  3I5H B;  3PAL A;  3I5I C;  2ISD A;  2HET A;  1CMG A;  5JOL A;  2L4I A;  2QAC A;  1PUL A;  1PSR A;  1A75 B;  2LLT A;  3A8R A;  3CS1 A;  5HKW A;  2LMT A;  4DIR A;  4I5L B;  3TS5 C;  1SCV A;  3GK4 X;  3C1V A;  3EK4 A;  2NCP A;  1AJ5 A;  1K95 A;  1S6I A;  1V1F A;  1HT9 A;  1OMR A;  1U5I A;  1ODB A;  3NSI A;  3NXA A;  4WQ3 A;  3K21 A;  1SPY A;  2DOQ A;  2MAZ A;  4R1E A;  3FS7 A;  1B8L A;  1UP5 A;  4USL A;  4PE7 A;  2Y5I A;  1B9A A;  3D0Y A;  2JT3 A;  1YUU A;  3OB1 B;  2MBX A;  1A2X A;  2I7A A;  3OB2 B;  2TN4 A;  2ZND A;  2M97 A;  1UHK A;  1XK4 C;  2L51 A;  1J1E A;  1NP8 A;  1RWY A;  2NXQ A;  1UUS A;  2H61 C;  1XK4 A;  1OZS A;  2K0J A;  2LVI A;  2BE6 A;  3ICB A;  3OX5 A;  2H61 A;  4ZCV A;  5HKZ A;  1JFJ A;  2KAY A;  2LHI A;  3KO0 A;  1A29 A;  2GGZ A;  4WQ2 A;  1K2H A;  1GJY A;  1NX0 A;  5BPJ A;  2HPS A;  3SG4 A;  1TOP A;  4GPL B;  1XVJ A;  2M7L A;  1B7T Z;  1MF8 B;  1LVC D;  1BU3 A;  1SL9 A;  3AAJ A;  2GV5 A;  5HLO A;  1EG3 A;  1DF0 B;  1KQM C;  1IH0 A;  1JF0 A;  2LMU A;  1WRZ A;  1L2O C;  2OS8 B;  1N2D A;  1NCX A;  1YRU B;  2KAX A;  3JVT B;  1PSB A;  3LK1 A;  1EXR A;  2HF5 A;  4ORA B;  3CLN A;  4MN0 A;  3EKJ A;  5KU1 A;  5I8N A;  3EVV A;  2KI4 C;  1RFJ A;  2CNP A;  4PCW A;  4HRG A;  2MLF C;  3DVM A;  5AXI A;  4QJ5 B;  1IJ6 A;  2COL B;  1SMG A;  3BUM B;  2WCB A;  1QVI Y;  2F33 A;  3PSR A;  1F4Q A;  1OOJ A;  1QAT A;  1CM4 A;  2AAO A;  3CZT X;  3FWB A;  3NSK A;  1CDN A;  1OMD A;  1SL7 A;  3HX4 A;  1S6J A;  1YR5 A;  1SKT A;  2JXL A;  2F3Z A;  2EHB A;  2R2I A;  1G8I A;  1DMO A;  3SG7 A;  4MSP A;  2LAN A;  4P2Y B;  3DVK A;  2MLE C;  2JU0 A;  1CFD A;  2OPO A;  1GGW A;  4M2P A;  1X02 A;  1DJX A;  2EC6 C;  2F2O A;  1SK6 D;  3DVE A;  1AJ4 A;  2V53 A;  1S1E A;  2PVB A;  1BT6 A;  2KQ6 A;  2WND A;  1NCY A;  4PAL A;  5TNC A;  1YVL A;  2AMI A;  1M46 A;  2MHH A;  4C0K A;  3NSL A;  3VRR A;  2BKI B;  1B1G A;  3DF0 A;  1KQV A;  1PAL A;  4GUK A;  3AAK A;  1NSH A;  1CDL A;  4TNC A;  3SG2 A;  3TZ1 A;  1N65 A;  1SW8 A;  1V1G A;  1ZOT B;  2BBM A;  3CGA A;  3QRX A;  3CTN A;  1QJT A;  4PE0 A;  1TNP A;  1QV0 A;  3BOW B;  4GGF C;  3VRP A;  2LUC A;  4HSZ A;  1SR6 C;  1F8H A;  1L7Z A;  2KSP A;  1DJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...