2JNXA

Nmr derived solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
MAEALFKQLDANGDGSVSYEEVKAFVSSKRPIKNEQLLQLIFKAIDIDGNGEIDLAEFTKFAAAVKEQDLSDEKVGLKILYKLMDADGDGKLTKEEVTTFFKKFGYEKVVDQIMKADANGDGYITLEEFLAFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium binding protein 2
publication title Structure, dynamics, and physiological properties of a Calcium Binding Protein from Entamoeba Histolytica (EhCaBP2)
rcsb
source organism Entamoeba histolytica
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnxA02
1CM1A 1KSMA 3AKBA 5HKWA 4CLNA 1ZUZA 1CDNA 2O60A 2M8UA 1QJTA 1E8AA 4M2OA 1MF8B 3GK2A 1QX7A 2AUCA 1N2DA 1FPWA 4YBHB 2JWWA 2JXCA 1YUTA 2LVVA 3F45A 2ZRSA 4CFRA 1A29A 1L2OC 3D10A 1IH0A 1ALVA 1R2UA 2JZIA 2KFFA 1K95A 1TNWA 4HRHA 4PALA 1F4OA 1WDCB 1OZOA 5G08A 3EKHA 2NLNA 3I5GC 2L50A 2WCFA 1IQ3A 1SL7A 2FCEA 5CSIA 4NDCA 1G33A 4FTGA 3SIBA 4AQJA 1YTZC 2E30A 3OX6A 4PE1A 2KAXA 1MQ1A 1G4YR 4ETOA 1EG3A 5ER4X 2QPTA 2K8MB 2LVKA 1SCMC 2LM5A 2IS9A 3BUNB 1DJZA 4N1GA 3WHTB 2LHLA 3JTDB 1LA0A 3NSKA 3MSEB 1NCXA 2MA2A 1QVIZ 1X02A 4MVFA 1YUSA 2EC6C 1PRWA 5DKNA 3PSRA 1FBVA 1TIZA 3EK7A 1YX7A 1QV0A 3LCPC 4GPLB 2QACA 1KK7Z 3VROA 1LVCD 1AJ5A 5D7FA 1PK0D 4XJKB 4M2QA 4A4CA 2PASA 3DVEA 1OOJA 1QTXA 1WRZA 1G8IA 1BLQA 3LL8B 2KFGA 3ZWHA 1M39A 1SNLA 2PSRA 4NDDA 2LLSA 4YGDB 1TTXA 5PALA 1YR5A 3RM1A 2MLEC 1CLLA 1IQ5A 1B8CA 3I5GB 2F3YA 3BYAA 1Y1AA 4PCWA 4JQ0D 3SJSA 2JNFA 3ZNIA 1DT7B 3DVKA 4GNKB 1WLZA 4QJ4B 1FF1A 1K9UA 2L4IA 2ZNEA 1XK4C 2LVIA 1DGUA 2K7CA 4ORCB 1K2HA 3OB1B 3NSIA 1DJIA 1DJHA 5AANA 1BR1B 1K93D 1YRUB 1MHOA 3TZ1A 2K61A 1S1EA 1EL4A 3TS5C 4R1EA 1QX2A 2KFHA 1B4CA 4ORAB 1OMDA 2BCXA 4ORBB 1PULA 1HQVA 2LUXA 2NCOA 1V1FA 2K2AA 2LMUA 1A75A 1MUXA 2OPOA 4MRXA 3DF0A 4YI9A 2G9BA 2Q91A 4XJKA 1RECA 1SRAA 2CNPA 2L2EA 2O5GA 1NP8A 2OS8C 1DJXA 3TDIA 4PE0A 2ISDA 1C07A 3KHEA 1LINA 4YRUA 2I2RE 3A8RA 3CZTX 1KCYA 1IJ6A 1KSOA 2PALA 3BOWB 2LC5A 4CPVA 3AKAA 1VRKA 1AUIB 1K94A 3PATA 1B47A 4OR9B 3GK4X 2F2OA 1FW4A 1S6CA 5HYDA 1W7IB 4FQOA 1OSAA 2ZN9A 3SIAA 1NX1A 1XFYO 1JF0A 1K9KA 1DMOA 1K8UA 2JTTA 1CMFA 3PN7B 1CTRA 1XVJA 3TS5B 1FI5A 1DJGA 2LP2A 1CM4A 3GK1A 1MR8A 4PE4A 1QASA 1F70A 2BE6A 3BQ3A 3DVMA 3E3RA 1YVHA 4GBAA 1EH2A 1UHKA 4A4BA 1CFPA 2JU0A 1BR4B 3CR2A 3KPXA 1AK8A 3OX5A 1SBJA 1WRLA 4P5OE 2LMVA 3CTNA 4I5NB 2OS8B 3VRNA 2KSPA 1WRKA 2HQ8A 1JWDA 3VRRA 1RROA 2KQ6A 2NXQA 5DKQA 2SASA 1KFXL 2GV5A 2MJWB 2H2KA 1L7ZA 1KFXS 2ZRTA 1A03A 1UHIA 3KF9A 1JSAA 2I18A 1JFKA 3LLEA 2M3WA 2LAPA 2GGZA 2MBXA 4YGBB 1H4BA 3FWBA 3WNXB 2L5XB 4Q04A 4MBEA 3CR4X 1Q80A 1WLMA 2FCDA 3BOWA 1JFJA 2BBMA 5JJGA 4PHKA 2KBMA 2I7AA 1QV1A 1YRTB 1TCOB 1U5IB 2Y4QA 1WY9A 1F4QA 3CR5X 3I5IC 4DCKA 3EVRA 1SW8A 1IWQA 1S5GY 2JQ6A 3H4SE 1IJ5A 3PM8A 4MRYA 4I5LB 1CKKA 4E68A 4MZKA 1KQMC 4BY4A 2R2IA 2KAVA 1F8HA 2L98A 1IGVA 5I8NA 1UP5A 3DVJA 1BG1A 2PRUA 2KI6D 5TNCA 1SR6C 3I5HC 3SG4A 5IBWA 1BF5A 1GJYA 5K89A 2KBIA 2LMTA 4OCIA 3SG6A 1CDPA 4JPZB 5KTYA 1L2OB 1TNXA 1YURA 1ZMZA 2SCPA 3SG2A 1J7PA 4L9MA 2ZN8A 1CFCA 4PHNA 4MN0A 3IQQA 1TNQA 1XFXO 2G2BA 3IQOA 3I5FC 4I5KA 2KAYA 3OHMB 5FYXA 1XFWO 1QS7A 3FWCA 1BT6A 1NX3A 1KK8C 4GUKA 2KYFA 4DRWA 4MLWA 2LE9B 4GFTA 1QXPA 1SL8A 1C7VA 3I5IB 1CMGA 1SCMB 4YGAA 1Y1UA 3D0YB 4NQGA 2FOTA 3BUXB 2NZ0A 1IKUA 1EG4A 4OV2A 1NPQA 1YVLA 2EC6B 1KFUL 1NX2A 3NSLA 5AXIA 2Q4UA 3NSOA 3O4YA 4ZCUA 1SR6B 3I5HB 1J55A 1U5IA 2A4JA 2OTGC 4HRGA 1BU3A 3EK8A 1CB1A 1EXRA 4D1EA 1KWOC 3CLNA 1UWOA 1QATA 3HX4A 4AQIA 1FI6A 4OVNF 5B8IB 1SYMA 5BPJA 2CBLA 2JT8A 1TCFA 3VGOA 1AP4A 1XO5A 4QJ5B 2F2PA 2JULA 2AMIA 3JVTC 2JTZA 1JBAA 4MEWA 1QIWA 2B1UA 1S3PA 3TDUA 2H61C 2JNXA 1GQMA 2WNDA 1RWYA 5I2QA 2LANA 2LNKA 2LVJA 3ICBA 1HT9A 4GAOA 3O2PA 2KNEA 2P6BB 1XFZO 1PSRA 2LHIA 4PHMA 4C0LA 4WRIA 1B7TY 1LA3A 1S5GZ 3BUMB 4CFQA 2KQYA 2RGIA 1ALWA 2I94A 2ZFDA 4ZCVA 1GGWA 1DVIA 2M49B 2CXJA 4YGCB 5CSJA 1NYAA 2KDHA 2BE4A 1M46A 1TNPA 1TRFA 4TNCA 2HQWA 2LLUA 4HSZA 2AAOA 1YX8A 1M45A 2OTGB 3D0YA 4OKHA 1KWOB 3WXAA 1XYDA 2JT0A 2HPSA 1DJWA 4F0ZB 4GGNA 1BMOA 1CDLA 1N0YA 1SMGA 2F3ZA 1AVSA 2BBNA 3JVTB 4N5XA 4PHJA 5D69A 1Y1XA 5KU1A 2K7OA 4JWQA 1W7JB 4AOMA 2M1KB 2F8PA 1WDCC 2BCAA 1SKTA 4DIRA 1BODA 4I5JA 1D1OA 2KOTA 3CGAA 4M2PA 1SY9A 2LLTA 2WCBA 2KGRA 3M0WA 1RJVA 1CFDA 2KHNA 2KI4C 3LK1A 1B8LA 2HETA 1J7QA 2BKHB 2JXLA 1B1GA 1AHRA 3RLZA 2HF5A 3OP0A 1PVAA 4XYNA 1ZOTB 3TUYC 3CWGA 2M0RA 1TOPA 1F71A 2KI6C 4MZJA 1UHHA 2MRDA 1A2XA 1MXLC 4PE7A 1GGZA 2V53A 2F33A 1XK4A 1SCVA 1YUUA 2BECA 3EVVA 5KSZA 1K9PA 3EKJA 4MZLA 3BUOB 3WHUB 2L0PA 2M7LA 2MHHA 2WOSA 1RFJA 2Y5IA 1K90D 3PFVA 4P2YB 1JF2A 1A4PA 3QRXA 1NIWA 1UHNA 5CPVA 5GQQC 3SG3A 1C7WA 2CCMA 3EK4A 4HREE 3SG7A 1R6PA 1DGVA 3FIAA 1RK9A 1CDMA 2KI4B 2M97A 1B8RA 4GGFC 1B7TZ 3PLFB 1SK6D 1NUBA 1IG5A 2H61A 2L4HA 4CIDA 2NCPA 1IRJA 2LCPA 2WC8A 1J7RA 4WQ3A 3TUYB 1JUOA 2E6WA 1H8BA 4QJ3B 4DUQA 5AFPA 1NWDA 4YI8A 3LK0A 5CSNA 1A75B 1BJFA 1CLMA 3DF0B 3EVUA 5HKZA 5JOLA 1ZACA 1OE9B 2WCEA 1EJ3A 2JPTA 2M7NA 2PVBA 3AAJA 4YGEB 1QLSA 5I2LA 1CNPA 1NX0A 1B9AA 2ZKMX 1F55A 2LUCA 2BL0C 4C0JA 2PMYA 2K0JA 2MAZA 1KQMB 1S26D 1XFUO 4DS7A 2L51A 3DD4A 3SG5A 3O6BA 3C1VA 1UURA 2JC2A 2K2FA 1S6IA 1KFUS 4USLA 5AEQA 2BCBA 1MWNA 1QX5B 1UUSA 3CS1A 3GOFA 4IL1A 2Y1MA 3IF7A 1KQVA 1OMRA 2JOJA 4C0KA 2M1UA 1ZFSA 4BY5A 1DTLA 1DF0B 2COLB 2KYCA 2ZNDA 5HLVA 1ODBA 1QIVA 2CTNA 3K21A 2JT3A 1S36A 3BXKA 1JC2A 3I5FB 1XFVO 5HKYA 2BKIB 2K7BA 5I2OA 1BOCA 2WORA 1OZSA 2EGDA 3PN7C 1M31A 5CSFA 1KK8B 1OQPA 4ICBA 2M29A 5AERA 1PSBA 1QLKA 3NXAA 5F6TA 3TDZA 3KEVA 1K96A 2FJUB 5J3XA 1N65A 2LV7A 3PALA 2D8NA 2BL0B 2MLFC 1QVIY 1TN4A 3BUWB 3FS7A 4UPGA 5ER5A 1V1GA 2VRGA 4PDZA 2CT9A 1J7OA 1J1EA 3A4UB 1NSHA 1CFFA 2EHBA 1KK7Y 2M9GA 3HCMA 1J1DA 2GGMA 2TN4A 1DJYA 1M63B 1AJ4A 1NCZA 2JRFA 2LP3A 1NCYA 1MXEA 5DKRA 2KGBC 5HLOA 1UHJA 4U8DA 1LKJA 1SPYA 2Y1NA 3AAKA 3VRPA 3KO0A 3VRQA 1S6JA 1OMVA 4MSPA 1XA5A 1DF0A 1LXFC 4GGFA 3O78A 1CLBA 3OB2B 4N1FA 1PALA 4WQ2A 1RTP1 4NDBA 2K7DA 2DOQA 1Y0VH 3JTDC 1PVBA 1F54A 1Y6WA 1SL9A
chains in the Genus database with same CATH superfamily
1CM1A 1KSMA 4FQTA 3AKBA 5HKWA 4CLNA 1ZUZA 1CDNA 2O60A 2M8UA 1QJTA 3BFBA 1E8AA 4M2OA 1MF8B 3GK2A 1QX7A 2AUCA 1N2DA 1FPWA 4YBHB 2JWWA 2JXCA 1YUTA 2LVVA 3F45A 3NHIA 2ZRSA 4CFRA 1A29A 1L2OC 3D10A 5HL1A 1ALVA 1R2UA 2JZIA 2KFFA 1IH0A 1K95A 1TNWA 4HRHA 4PALA 1F4OA 1WDCB 1OZOA 5G08A 3EKHA 2NLNA 3I5GC 4INWA 2L50A 2WCFA 1IQ3A 1SL7A 2FCEA 5CSIA 4NDCA 1G33A 4FTGA 3SIBA 4AQJA 1YTZC 2E30A 3OX6A 4PE1A 1Z2CB 2KAXA 1MQ1A 1G4YR 4ETOA 1EG3A 5ER4X 2QPTA 2K8MB 2LVKA 1SCMC 2KLEA 2LM5A 2IS9A 3BUNB 1DJZA 4N1GA 3WHTB 2LHLA 2PQLA 3JTDB 1LA0A 3NSKA 2K60A 3MSEB 1NCXA 3CDNA 2MA2A 1QVIZ 1X02A 4MVFA 1W9ZA 1YUSA 2EC6C 1PRWA 5DKNA 3PSRA 1FBVA 1TIZA 3EK7A 1YX7A 1QV0A 3LCPC 3SS3A 4GPLB 2QACA 1KK7Z 3VROA 1LVCD 1AJ5A 5D7FA 1PK0D 4XJKB 4M2QA 4A4CA 2PASA 3DVEA 1OOJA 1QTXA 1WRZA 1G8IA 1BLQA 3LL8B 2KFGA 3ZWHA 1M39A 1SNLA 2PSRA 4NDDA 2LLSA 4YGDB 1TTXA 5PALA 1YR5A 3RM1A 3OGNA 3NHTA 2MLEC 1CLLA 1IQ5A 1B8CA 3I5GB 2F3YA 3BYAA 1Y1AA 4PCWA 4JQ0D 3SJSA 2FJYA 1Z4HA 2JNFA 4JKTA 3ZNIA 1DT7B 3DVKA 2KPHA 2QEBA 4GNKB 1WLZA 2KLDA 4QJ4B 1FF1A 1K9UA 2L4IA 1GM0A 2ZNEA 1XK4C 2LVIA 1DGUA 2K7CA 4ORCB 4IJ7A 1K2HA 3OB1B 3NSIA 1DJIA 1DJHA 5AANA 3N7HA 1BR1B 1K93D 1YRUB 1MHOA 3TZ1A 2K61A 1S1EA 1EL4A 5I94A 3TS5C 4R1EA 1QX2A 2KFHA 3R1VA 1B4CA 4ORAB 1OMDA 2BCXA 1OW4A 4ORBB 1PULA 1HQVA 2LUXA 2NCOA 1V1FA 5FI2A 2K2AA 2LMUA 1A75A 3B6XA 1MUXA 3BFHA 2OPOA 4MRXA 3DF0A 4YI9A 2G9BA 2Q91A 4XJKA 1RECA 1SRAA 2CNPA 2L2EA 2O5GA 1NP8A 2L5YA 2OS8C 1DJXA 3TDIA 4PE0A 2ISDA 1C07A 3KHEA 1LINA 2WC5A 2I2RE 4YRUA 3A8RA 3CZTX 1KCYA 1IJ6A 1KSOA 2PALA 1C3ZA 3BOWB 2LC5A 4CPVA 3AKAA 1VRKA 1AUIB 1K94A 3PATA 1B47A 4OR9B 3GK4X 2F2OA 1FW4A 1S6CA 5HYDA 1W7IB 4FQOA 1OSAA 2ZN9A 3SIAA 1NX1A 1XFYO 1JF0A 1K9KA 1DMOA 1K8UA 2JTTA 1CMFA 3PN7B 1CTRA 1XVJA 3TS5B 1FI5A 1DJGA 2LP2A 1CM4A 3GK1A 1MR8A 4PE4A 1QASA 3S0DA 1F70A 3L47A 2BE6A 3BQ3A 3DVMA 3E3RA 1YVHA 4GBAA 1EH2A 1UHKA 4A4BA 1CFPA 2JU0A 1BR4B 3CR2A 3KPXA 3D73A 1AK8A 3OX5A 1SBJA 3B86A 1WRLA 4P5OE 2LMVA 3CTNA 4I5NB 2OS8B 3VRNA 2KSPA 1WRKA 2HQ8A 1JWDA 3VRRA 1RROA 2KQ6A 2NXQA 5DKQA 2SASA 3UO9A 1KFXL 2GV5A 2MJWB 2H2KA 2YGUA 1L7ZA 1KFXS 2ZRTA 1A03A 1OOGA 1UHIA 1TWOA 3KF9A 1JSAA 2I18A 1JFKA 3LLEA 2M3WA 2LAPA 2QEVA 2GGZA 2MBXA 4YGBB 1H4BA 3FWBA 3WNXB 2L5XB 4Q04A 4MBEA 3CR4X 1Q80A 1WLMA 2FCDA 3BOWA 1JFJA 2BBMA 5JJGA 4PHKA 2KBMA 2I7AA 3CYZA 1QV1A 1YRTB 1TCOB 1U5IB 2Y4QA 1WY9A 1F4QA 3CR5X 3I5IC 4DCKA 3EVRA 1SW8A 1IWQA 1S5GY 2JQ6A 3H4SE 1IJ5A 3PM8A 4MRYA 4I5LB 1CKKA 4E68A 1TUZA 4MZKA 1KQMC 4BY4A 2R2IA 2KAVA 1F8HA 2L98A 1IGVA 1BG1A 2WCLA 1OOIX 5I8NA 1QWVA 1UP5A 3CABA 2PRUA 2KI6D 3DVJA 1SR6C 1XFRA 3I5HC 5TNCA 3SG4A 5IBWA 1BF5A 1GJYA 5K89A 2KBIA 2LMTA 4OCIA 3SG6A 1CDPA 4JPZB 5KTYA 3DXLA 1L2OB 1TNXA 1YURA 1ZMZA 2SCPA 3SG2A 1J7PA 4L9MA 2ZN8A 1CFCA 4PHNA 4MN0A 3RZSA 3IQQA 1TNQA 3V2LA 1XFXO 2G2BA 3IQOA 3I5FC 3L4LA 4I5KA 2KAYA 3FE8A 3OHMB 5FYXA 1XFWO 1QS7A 2QEOA 3FWCA 1BT6A 1NX3A 1KK8C 1OOFA 4GUKA 2KYFA 4DRWA 2WCKA 4MLWA 2LE9B 4GFTA 1QXPA 1SL8A 1C7VA 3I5IB 1CMGA 2P70A 1SCMB 4YGAA 1Y1UA 3D0YB 4NQGA 2FOTA 3BUXB 2NZ0A 1IKUA 1EG4A 4OV2A 1NPQA 1YVLA 2EC6B 1KFUL 1NX2A 3BJHA 3DZTA 3NSLA 2BNXA 5AXIA 2Q4UA 3NSOA 3O4YA 1C3YA 4ZCUA 1SR6B 3I5HB 3CZ1A 4OZDA 1J55A 1U5IA 2A4JA 2OTGC 4HRGA 1BU3A 3EK8A 3S0AA 1EXRA 5EL2A 4D1EA 1KWOC 3CLNA 1UWOA 1QATA 3HX4A 3OBVA 4AQIA 4OVNF 1FI6A 5B8IB 1SYMA 5BPJA 2CBLA 2JT8A 1TCFA 3VGOA 1AP4A 1XO5A 4QJ5B 2F2PA 2JULA 2WC6A 2AMIA 3JVTC 2JTZA 1JBAA 2P71A 4MEWA 1QIWA 3SS4A 2B1UA 1S3PA 3TDUA 1DEKA 2H61C 2JNXA 1GQMA 2WNDA 1RWYA 5I2QA 2LANA 4INXA 2LNKA 2LVJA 2WCJA 3ICBA 1HT9A 4GAOA 3O2PA 2KNEA 2P6BB 1XFZO 1PSRA 2LHIA 3L4AA 4PHMA 4C0LA 4WRIA 1B7TY 1LA3A 3VB1A 1S5GZ 3BUMB 4CFQA 2KQYA 2RGIA 1ALWA 2I94A 2WCMA 2ZFDA 4ZCVA 1GGWA 5D3OA 1DVIA 3K1EA 2M49B 2CXJA 3DY9A 5CSJA 4YGCB 1NYAA 2KDHA 3D76A 2BE4A 1M46A 1TNPA 1TRFA 4TNCA 2HQWA 2LLUA 4HSZA 2AAOA 1YX8A 1M45A 2OTGB 2PYQA 3D0YA 4OKHA 1KWOB 3WXAA 1XYDA 2JT0A 3EG5B 2ERBA 1DJWA 2HPSA 4F0ZB 4GGNA 1BMOA 1CDLA 1N0YA 1SMGA 2F3ZA 1AVSA 2BBNA 3JVTB 4N5XA 4PHJA 5D69A 1Y1XA 5KU1A 3CZ2A 1DELA 2K7OA 1W7JB 4JWQA 2M1KB 2F8PA 4AOMA 1WDCC 2BCAA 1SKTA 4DIRA 1BODA 4I5JA 1D1OA 3CZ0A 2KOTA 3CGAA 3FE9A 4M2PA 1SY9A 2LLTA 2WCBA 2KGRA 3M0WA 1RJVA 1CFDA 3S0GA 2KHNA 2KI4C 3LK1A 1B8LA 2HETA 3B88A 1J7QA 3D75A 2BKHB 2JXLA 1TUJA 1AHRA 1B1GA 3RLZA 2HF5A 3OP0A 1PVAA 4XYNA 1ZOTB 3TUYC 3CWGA 2M0RA 1TOPA 1F71A 2KI6C 4MZJA 1UHHA 2MRDA 1A2XA 1MXLC 4PE7A 1GGZA 1T14A 2V53A 2F33A 1XK4A 1SCVA 1YUUA 2BECA 3EVVA 5KSZA 1K9PA 3EKJA 4MZLA 3BUOB 3WHUB 3FE6A 2L0PA 2M7LA 2MHHA 2WOSA 1RFJA 2Y5IA 1K90D 1P28A 1ORGA 3R1PA 3PFVA 3S0BA 4P2YB 1JF2A 2QDIA 1A4PA 3QRXA 1NIWA 1UHNA 1SSEB 5CPVA 5GQQC 3R72A 3SG3A 4F7FA 1C7WA 2CCMA 2L2CA 3EK4A 4HREE 1R6PA 3SG7A 3S0FA 1DGVA 3FIAA 1RK9A 1CDMA 2KI4B 3UNWA 2M97A 1B8RA 4GGFC 1B7TZ 3PLFB 1SK6D 1NUBA 1IG5A 2H61A 2L4HA 4CIDA 2NCPA 1IRJA 2LCPA 2WC8A 1J7RA 4WQ3A 3PM2A 1JUOA 2H8VA 5FI6A 2E6WA 3TUYB 1H8BA 4QJ3B 4DUQA 5AFPA 1NWDA 4YI8A 3LK0A 5CSNA 1A75B 1BJFA 3BFAA 1CLMA 3DF0B 1IIOA 3EVUA 5HKZA 5JOLA 1ZACA 1OE9B 2WCEA 1EJ3A 2JPTA 2M7NA 2PVBA 3AAJA 4YGEB 1QLSA 2WCHA 3D77A 5I2LA 1CNPA 1NX0A 1B9AA 2ZKMX 1F55A 2LUCA 2BL0C 4C0JA 2PMYA 2K0JA 2MAZA 1KQMB 1S26D 1XFUO 4DS7A 2L51A 3B87A 3DD4A 3SG5A 3D78A 3O6BA 3C1VA 1UURA 2JC2A 2K2FA 1S6IA 1KFUS 3Q8IA 4USLA 2BCBA 1MWNA 1QX5B 1UUSA 3CS1A 3GOFA 5AEQA 4IL1A 2Y1MA 3IF7A 2QEHA 1KQVA 1OMRA 2JOJA 3B7AA 4C0KA 2M1UA 1ZFSA 4PT1A 4BY5A 1DTLA 1DF0B 2BAPA 2COLB 3PJIA 2KYCA 1DQEA 2ZNDA 5HLVA 1ODBA 1QIVA 2CTNA 3K21A 2JT3A 1S36A 3BXKA 4KYNA 1JC2A 3IVTA 3I5FB 1XFVO 5HKYA 2BKIB 2K7BA 5I2OA 1BOCA 2WORA 1OZSA 2EGDA 3PN7C 1M31A 5CSFA 1KK8B 1OQPA 4ICBA 2M29A 5AERA 1PSBA 1QLKA 3NXAA 5FI7A 5F6TA 3TDZA 3KEVA 1K96A 2FJUB 5J3XA 1N65A 2LV7A 2GTEA 2D8NA 2BL0B 2MLFC 3PALA 1QVIY 1TN4A 3BUWB 3R1OA 3FS7A 4UPGA 4JD9A 5ER5A 1V1GA 2VRGA 3D74A 4PDZA 2CT9A 1J7OA 1J1EA 3A4UB 1LS8A 1NSHA 1CFFA 2EHBA 1KK7Y 3QMEA 2M9GA 3HCMA 1J1DA 2GGMA 2JPOA 2TN4A 1DJYA 1M63B 1AJ4A 1NCZA 2JRFA 2LP3A 1NCYA 1MXEA 3NGVA 5DKRA 2KGBC 1CB1A 1OOHA 5HLOA 1UHJA 5DICA 4U8DA 1LKJA 1SPYA 2Y1NA 3AAKA 3VRPA 3KO0A 3VRQA 1S6JA 1OMVA 4MSPA 1XA5A 1DF0A 1LXFC 4GGFA 3O78A 3O4XA 1CLBA 3OB2B 3SS5A 4N1FA 1PALA 4WQ2A 3DYEA 1RTP1 4NDBA 2K7DA 3S0EA 2DOQA 1Y0VH 3JTDC 1DC1A 1PVBA 1F54A 1Y6WA 1SL9A
chains in the Genus database with same CATH topology
1CM1A 1KSMA 3AKBA 5HKWA 4CLNA 1ZUZA 1CDNA 2O60A 2M8UA 1QJTA 1E8AA 4M2OA 1MF8B 3GK2A 1QX7A 2AUCA 1N2DA 1FPWA 4YBHB 2JWWA 2JXCA 1YUTA 2LVVA 3F45A 2ZRSA 4CFRA 1A29A 1L2OC 3D10A 1IH0A 1ALVA 1R2UA 2JZIA 2KFFA 1K95A 1TNWA 4HRHA 4PALA 1F4OA 1WDCB 1OZOA 5G08A 3EKHA 2NLNA 3I5GC 2L50A 2WCFA 1IQ3A 1SL7A 2FCEA 5CSIA 4NDCA 1G33A 4FTGA 3SIBA 4AQJA 1YTZC 2E30A 3OX6A 4PE1A 2KAXA 1MQ1A 1G4YR 4ETOA 1EG3A 5ER4X 2QPTA 2K8MB 2LVKA 1SCMC 2LM5A 2IS9A 3BUNB 1DJZA 4N1GA 3WHTB 2LHLA 3JTDB 1LA0A 3NSKA 3MSEB 1NCXA 2MA2A 1QVIZ 1X02A 4MVFA 1YUSA 2EC6C 1PRWA 5DKNA 3PSRA 1FBVA 1TIZA 3EK7A 1YX7A 1QV0A 3LCPC 4GPLB 2QACA 1KK7Z 3VROA 1LVCD 1AJ5A 5D7FA 1PK0D 4XJKB 4M2QA 4A4CA 2PASA 3DVEA 1OOJA 1QTXA 1WRZA 1G8IA 1BLQA 3LL8B 2KFGA 3ZWHA 1M39A 1SNLA 2PSRA 4NDDA 2LLSA 4YGDB 1TTXA 5PALA 1YR5A 3RM1A 2MLEC 1CLLA 1IQ5A 1B8CA 3I5GB 2F3YA 3BYAA 1Y1AA 4PCWA 4JQ0D 3SJSA 2JNFA 3ZNIA 1DT7B 3DVKA 4GNKB 1WLZA 4QJ4B 1FF1A 1K9UA 2L4IA 2ZNEA 1XK4C 2LVIA 1DGUA 2K7CA 4ORCB 1K2HA 3OB1B 3NSIA 1DJIA 1DJHA 5AANA 1BR1B 1K93D 1YRUB 1MHOA 3TZ1A 2K61A 1S1EA 1EL4A 3TS5C 4R1EA 1QX2A 2KFHA 1B4CA 4ORAB 1OMDA 2BCXA 4ORBB 1PULA 1HQVA 2LUXA 2NCOA 1V1FA 2K2AA 2LMUA 1A75A 1MUXA 2OPOA 4MRXA 3DF0A 4YI9A 2G9BA 2Q91A 4XJKA 1RECA 1SRAA 2CNPA 2L2EA 2O5GA 1NP8A 2OS8C 1DJXA 3TDIA 4PE0A 2ISDA 1C07A 3KHEA 1LINA 4YRUA 2I2RE 3A8RA 3CZTX 1KCYA 1IJ6A 1KSOA 2PALA 3BOWB 2LC5A 4CPVA 3AKAA 1VRKA 1AUIB 1K94A 3PATA 1B47A 4OR9B 3GK4X 2F2OA 1FW4A 1S6CA 5HYDA 1W7IB 4FQOA 1OSAA 2ZN9A 3SIAA 1NX1A 1XFYO 1JF0A 1K9KA 1DMOA 1K8UA 2JTTA 1CMFA 3PN7B 1CTRA 1XVJA 3TS5B 1FI5A 1DJGA 2LP2A 1CM4A 3GK1A 1MR8A 4PE4A 1QASA 1F70A 2BE6A 3BQ3A 3DVMA 3E3RA 1YVHA 4GBAA 1EH2A 1UHKA 4A4BA 1CFPA 2JU0A 1BR4B 3CR2A 3KPXA 1AK8A 3OX5A 1SBJA 1WRLA 4P5OE 2LMVA 3CTNA 4I5NB 2OS8B 3VRNA 2KSPA 1WRKA 2HQ8A 1JWDA 3VRRA 1RROA 2KQ6A 2NXQA 5DKQA 2SASA 1KFXL 2GV5A 2MJWB 2H2KA 1L7ZA 1KFXS 2ZRTA 1A03A 1UHIA 3KF9A 1JSAA 2I18A 1JFKA 3LLEA 2M3WA 2LAPA 2GGZA 2MBXA 4YGBB 1H4BA 3FWBA 3WNXB 2L5XB 4Q04A 4MBEA 3CR4X 1Q80A 1WLMA 2FCDA 3BOWA 1JFJA 2BBMA 5JJGA 4PHKA 2KBMA 2I7AA 1QV1A 1YRTB 1TCOB 1U5IB 2Y4QA 1WY9A 1F4QA 3CR5X 3I5IC 4DCKA 3EVRA 1SW8A 1IWQA 1S5GY 2JQ6A 3H4SE 1IJ5A 3PM8A 4MRYA 4I5LB 1CKKA 4E68A 4MZKA 1KQMC 4BY4A 2R2IA 2KAVA 1F8HA 2L98A 1IGVA 5I8NA 1UP5A 3DVJA 1BG1A 2PRUA 2KI6D 5TNCA 1SR6C 3I5HC 3SG4A 5IBWA 1BF5A 1GJYA 5K89A 2KBIA 2LMTA 4OCIA 3SG6A 1CDPA 4JPZB 5KTYA 1L2OB 1TNXA 1YURA 1ZMZA 2SCPA 3SG2A 1J7PA 4L9MA 2ZN8A 1CFCA 4PHNA 4MN0A 3IQQA 1TNQA 1XFXO 2G2BA 3IQOA 3I5FC 4I5KA 2KAYA 3OHMB 5FYXA 1XFWO 1QS7A 3FWCA 1BT6A 1NX3A 1KK8C 4GUKA 2KYFA 4DRWA 4MLWA 2LE9B 4GFTA 1QXPA 1SL8A 1C7VA 3I5IB 1CMGA 1SCMB 4YGAA 1Y1UA 3D0YB 4NQGA 2FOTA 3BUXB 2NZ0A 1IKUA 1EG4A 4OV2A 1NPQA 1YVLA 2EC6B 1KFUL 1NX2A 3NSLA 5AXIA 2Q4UA 3NSOA 3O4YA 4ZCUA 1SR6B 3I5HB 1J55A 1U5IA 2A4JA 2OTGC 4HRGA 1BU3A 3EK8A 1CB1A 1EXRA 4D1EA 1KWOC 3CLNA 1UWOA 1QATA 3HX4A 4AQIA 1FI6A 4OVNF 5B8IB 1SYMA 5BPJA 2CBLA 2JT8A 1TCFA 3VGOA 1AP4A 1XO5A 4QJ5B 2F2PA 2JULA 2AMIA 3JVTC 2JTZA 1JBAA 4MEWA 1QIWA 2B1UA 1S3PA 3TDUA 2H61C 2JNXA 1GQMA 2WNDA 1RWYA 5I2QA 2LANA 2LNKA 2LVJA 3ICBA 1HT9A 4GAOA 3O2PA 2KNEA 2P6BB 1XFZO 1PSRA 2LHIA 4PHMA 4C0LA 4WRIA 1B7TY 1LA3A 1S5GZ 3BUMB 4CFQA 2KQYA 2RGIA 1ALWA 2I94A 2ZFDA 4ZCVA 1GGWA 1DVIA 2M49B 2CXJA 4YGCB 5CSJA 1NYAA 2KDHA 2BE4A 1M46A 1TNPA 1TRFA 4TNCA 2HQWA 2LLUA 4HSZA 2AAOA 1YX8A 1M45A 2OTGB 3D0YA 4OKHA 1KWOB 3WXAA 1XYDA 2JT0A 2HPSA 1DJWA 4F0ZB 4GGNA 1BMOA 1CDLA 1N0YA 1SMGA 2F3ZA 1AVSA 2BBNA 3JVTB 4N5XA 4PHJA 5D69A 1Y1XA 5KU1A 2K7OA 4JWQA 1W7JB 4AOMA 2M1KB 2F8PA 1WDCC 2BCAA 1SKTA 4DIRA 1BODA 4I5JA 1D1OA 2KOTA 3CGAA 4M2PA 1SY9A 2LLTA 2WCBA 2KGRA 3M0WA 1RJVA 1CFDA 2KHNA 2KI4C 3LK1A 1B8LA 2HETA 1J7QA 2BKHB 2JXLA 1B1GA 1AHRA 3RLZA 2HF5A 3OP0A 1PVAA 4XYNA 1ZOTB 3TUYC 3CWGA 2M0RA 1TOPA 1F71A 2KI6C 4MZJA 1UHHA 2MRDA 1A2XA 1MXLC 4PE7A 1GGZA 2V53A 2F33A 1XK4A 1SCVA 1YUUA 2BECA 3EVVA 5KSZA 1K9PA 3EKJA 4MZLA 3BUOB 3WHUB 2L0PA 2M7LA 2MHHA 2WOSA 1RFJA 2Y5IA 1K90D 3PFVA 4P2YB 1JF2A 1A4PA 3QRXA 1NIWA 1UHNA 5CPVA 5GQQC 3SG3A 1C7WA 2CCMA 3EK4A 4HREE 3SG7A 1R6PA 1DGVA 3FIAA 1RK9A 1CDMA 2KI4B 2M97A 1B8RA 4GGFC 1B7TZ 3PLFB 1SK6D 1NUBA 1IG5A 2H61A 2L4HA 4CIDA 2NCPA 1IRJA 2LCPA 2WC8A 1J7RA 4WQ3A 3TUYB 1JUOA 2E6WA 1H8BA 4QJ3B 4DUQA 5AFPA 1NWDA 4YI8A 3LK0A 5CSNA 1A75B 1BJFA 1CLMA 3DF0B 3EVUA 5HKZA 5JOLA 1ZACA 1OE9B 2WCEA 1EJ3A 2JPTA 2M7NA 2PVBA 3AAJA 4YGEB 1QLSA 5I2LA 1CNPA 1NX0A 1B9AA 2ZKMX 1F55A 2LUCA 2BL0C 4C0JA 2PMYA 2K0JA 2MAZA 1KQMB 1S26D 1XFUO 4DS7A 2L51A 3DD4A 3SG5A 3O6BA 3C1VA 1UURA 2JC2A 2K2FA 1S6IA 1KFUS 4USLA 5AEQA 2BCBA 1MWNA 1QX5B 1UUSA 3CS1A 3GOFA 4IL1A 2Y1MA 3IF7A 1KQVA 1OMRA 2JOJA 4C0KA 2M1UA 1ZFSA 4BY5A 1DTLA 1DF0B 2COLB 2KYCA 2ZNDA 5HLVA 1ODBA 1QIVA 2CTNA 3K21A 2JT3A 1S36A 3BXKA 1JC2A 3I5FB 1XFVO 5HKYA 2BKIB 2K7BA 5I2OA 1BOCA 2WORA 1OZSA 2EGDA 3PN7C 1M31A 5CSFA 1KK8B 1OQPA 4ICBA 2M29A 5AERA 1PSBA 1QLKA 3NXAA 5F6TA 3TDZA 3KEVA 1K96A 2FJUB 5J3XA 1N65A 2LV7A 3PALA 2D8NA 2BL0B 2MLFC 1QVIY 1TN4A 3BUWB 3FS7A 4UPGA 5ER5A 1V1GA 2VRGA 4PDZA 2CT9A 1J7OA 1J1EA 3A4UB 1NSHA 1CFFA 2EHBA 1KK7Y 2M9GA 3HCMA 1J1DA 2GGMA 2TN4A 1DJYA 1M63B 1AJ4A 1NCZA 2JRFA 2LP3A 1NCYA 1MXEA 5DKRA 2KGBC 5HLOA 1UHJA 4U8DA 1LKJA 1SPYA 2Y1NA 3AAKA 3VRPA 3KO0A 3VRQA 1S6JA 1OMVA 4MSPA 1XA5A 1DF0A 1LXFC 4GGFA 3O78A 1CLBA 3OB2B 4N1FA 1PALA 4WQ2A 1RTP1 4NDBA 2K7DA 2DOQA 1Y0VH 3JTDC 1PVBA 1F54A 1Y6WA 1SL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM1 A;  1KSM A;  3AKB A;  5HKW A;  4CLN A;  1ZUZ A;  1CDN A;  2O60 A;  2M8U A;  1QJT A;  1E8A A;  4M2O A;  1MF8 B;  3GK2 A;  1QX7 A;  2AUC A;  1N2D A;  1FPW A;  4YBH B;  2JWW A;  2JXC A;  1YUT A;  2LVV A;  3F45 A;  2ZRS A;  4CFR A;  1A29 A;  1L2O C;  3D10 A;  1IH0 A;  1ALV A;  1R2U A;  2JZI A;  2KFF A;  1K95 A;  1TNW A;  4HRH A;  4PAL A;  1F4O A;  1WDC B;  1OZO A;  5G08 A;  3EKH A;  2NLN A;  3I5G C;  2L50 A;  2WCF A;  1IQ3 A;  1SL7 A;  2FCE A;  5CSI A;  4NDC A;  1G33 A;  4FTG A;  3SIB A;  4AQJ A;  1YTZ C;  2E30 A;  3OX6 A;  4PE1 A;  2KAX A;  1MQ1 A;  1G4Y R;  4ETO A;  1EG3 A;  5ER4 X;  2QPT A;  2K8M B;  2LVK A;  1SCM C;  2LM5 A;  2IS9 A;  3BUN B;  1DJZ A;  4N1G A;  3WHT B;  2LHL A;  3JTD B;  1LA0 A;  3NSK A;  3MSE B;  1NCX A;  2MA2 A;  1QVI Z;  1X02 A;  4MVF A;  1YUS A;  2EC6 C;  1PRW A;  5DKN A;  3PSR A;  1FBV A;  1TIZ A;  3EK7 A;  1YX7 A;  1QV0 A;  3LCP C;  4GPL B;  2QAC A;  1KK7 Z;  3VRO A;  1LVC D;  1AJ5 A;  5D7F A;  1PK0 D;  4XJK B;  4M2Q A;  4A4C A;  2PAS A;  3DVE A;  1OOJ A;  1QTX A;  1WRZ A;  1G8I A;  1BLQ A;  3LL8 B;  2KFG A;  3ZWH A;  1M39 A;  1SNL A;  2PSR A;  4NDD A;  2LLS A;  4YGD B;  1TTX A;  5PAL A;  1YR5 A;  3RM1 A;  2MLE C;  1CLL A;  1IQ5 A;  1B8C A;  3I5G B;  2F3Y A;  3BYA A;  1Y1A A;  4PCW A;  4JQ0 D;  3SJS A;  2JNF A;  3ZNI A;  1DT7 B;  3DVK A;  4GNK B;  1WLZ A;  4QJ4 B;  1FF1 A;  1K9U A;  2L4I A;  2ZNE A;  1XK4 C;  2LVI A;  1DGU A;  2K7C A;  4ORC B;  1K2H A;  3OB1 B;  3NSI A;  1DJI A;  1DJH A;  5AAN A;  1BR1 B;  1K93 D;  1YRU B;  1MHO A;  3TZ1 A;  2K61 A;  1S1E A;  1EL4 A;  3TS5 C;  4R1E A;  1QX2 A;  2KFH A;  1B4C A;  4ORA B;  1OMD A;  2BCX A;  4ORB B;  1PUL A;  1HQV A;  2LUX A;  2NCO A;  1V1F A;  2K2A A;  2LMU A;  1A75 A;  1MUX A;  2OPO A;  4MRX A;  3DF0 A;  4YI9 A;  2G9B A;  2Q91 A;  4XJK A;  1REC A;  1SRA A;  2CNP A;  2L2E A;  2O5G A;  1NP8 A;  2OS8 C;  1DJX A;  3TDI A;  4PE0 A;  2ISD A;  1C07 A;  3KHE A;  1LIN A;  4YRU A;  2I2R E;  3A8R A;  3CZT X;  1KCY A;  1IJ6 A;  1KSO A;  2PAL A;  3BOW B;  2LC5 A;  4CPV A;  3AKA A;  1VRK A;  1AUI B;  1K94 A;  3PAT A;  1B47 A;  4OR9 B;  3GK4 X;  2F2O A;  1FW4 A;  1S6C A;  5HYD A;  1W7I B;  4FQO A;  1OSA A;  2ZN9 A;  3SIA A;  1NX1 A;  1XFY O;  1JF0 A;  1K9K A;  1DMO A;  1K8U A;  2JTT A;  1CMF A;  3PN7 B;  1CTR A;  1XVJ A;  3TS5 B;  1FI5 A;  1DJG A;  2LP2 A;  1CM4 A;  3GK1 A;  1MR8 A;  4PE4 A;  1QAS A;  1F70 A;  2BE6 A;  3BQ3 A;  3DVM A;  3E3R A;  1YVH A;  4GBA A;  1EH2 A;  1UHK A;  4A4B A;  1CFP A;  2JU0 A;  1BR4 B;  3CR2 A;  3KPX A;  1AK8 A;  3OX5 A;  1SBJ A;  1WRL A;  4P5O E;  2LMV A;  3CTN A;  4I5N B;  2OS8 B;  3VRN A;  2KSP A;  1WRK A;  2HQ8 A;  1JWD A;  3VRR A;  1RRO A;  2KQ6 A;  2NXQ A;  5DKQ A;  2SAS A;  1KFX L;  2GV5 A;  2MJW B;  2H2K A;  1L7Z A;  1KFX S;  2ZRT A;  1A03 A;  1UHI A;  3KF9 A;  1JSA A;  2I18 A;  1JFK A;  3LLE A;  2M3W A;  2LAP A;  2GGZ A;  2MBX A;  4YGB B;  1H4B A;  3FWB A;  3WNX B;  2L5X B;  4Q04 A;  4MBE A;  3CR4 X;  1Q80 A;  1WLM A;  2FCD A;  3BOW A;  1JFJ A;  2BBM A;  5JJG A;  4PHK A;  2KBM A;  2I7A A;  1QV1 A;  1YRT B;  1TCO B;  1U5I B;  2Y4Q A;  1WY9 A;  1F4Q A;  3CR5 X;  3I5I C;  4DCK A;  3EVR A;  1SW8 A;  1IWQ A;  1S5G Y;  2JQ6 A;  3H4S E;  1IJ5 A;  3PM8 A;  4MRY A;  4I5L B;  1CKK A;  4E68 A;  4MZK A;  1KQM C;  4BY4 A;  2R2I A;  2KAV A;  1F8H A;  2L98 A;  1IGV A;  5I8N A;  1UP5 A;  3DVJ A;  1BG1 A;  2PRU A;  2KI6 D;  5TNC A;  1SR6 C;  3I5H C;  3SG4 A;  5IBW A;  1BF5 A;  1GJY A;  5K89 A;  2KBI A;  2LMT A;  4OCI A;  3SG6 A;  1CDP A;  4JPZ B;  5KTY A;  1L2O B;  1TNX A;  1YUR A;  1ZMZ A;  2SCP A;  3SG2 A;  1J7P A;  4L9M A;  2ZN8 A;  1CFC A;  4PHN A;  4MN0 A;  3IQQ A;  1TNQ A;  1XFX O;  2G2B A;  3IQO A;  3I5F C;  4I5K A;  2KAY A;  3OHM B;  5FYX A;  1XFW O;  1QS7 A;  3FWC A;  1BT6 A;  1NX3 A;  1KK8 C;  4GUK A;  2KYF A;  4DRW A;  4MLW A;  2LE9 B;  4GFT A;  1QXP A;  1SL8 A;  1C7V A;  3I5I B;  1CMG A;  1SCM B;  4YGA A;  1Y1U A;  3D0Y B;  4NQG A;  2FOT A;  3BUX B;  2NZ0 A;  1IKU A;  1EG4 A;  4OV2 A;  1NPQ A;  1YVL A;  2EC6 B;  1KFU L;  1NX2 A;  3NSL A;  5AXI A;  2Q4U A;  3NSO A;  3O4Y A;  4ZCU A;  1SR6 B;  3I5H B;  1J55 A;  1U5I A;  2A4J A;  2OTG C;  4HRG A;  1BU3 A;  3EK8 A;  1CB1 A;  1EXR A;  4D1E A;  1KWO C;  3CLN A;  1UWO A;  1QAT A;  3HX4 A;  4AQI A;  1FI6 A;  4OVN F;  5B8I B;  1SYM A;  5BPJ A;  2CBL A;  2JT8 A;  1TCF A;  3VGO A;  1AP4 A;  1XO5 A;  4QJ5 B;  2F2P A;  2JUL A;  2AMI A;  3JVT C;  2JTZ A;  1JBA A;  4MEW A;  1QIW A;  2B1U A;  1S3P A;  3TDU A;  2H61 C;  2JNX A;  1GQM A;  2WND A;  1RWY A;  5I2Q A;  2LAN A;  2LNK A;  2LVJ A;  3ICB A;  1HT9 A;  4GAO A;  3O2P A;  2KNE A;  2P6B B;  1XFZ O;  1PSR A;  2LHI A;  4PHM A;  4C0L A;  4WRI A;  1B7T Y;  1LA3 A;  1S5G Z;  3BUM B;  4CFQ A;  2KQY A;  2RGI A;  1ALW A;  2I94 A;  2ZFD A;  4ZCV A;  1GGW A;  1DVI A;  2M49 B;  2CXJ A;  4YGC B;  5CSJ A;  1NYA A;  2KDH A;  2BE4 A;  1M46 A;  1TNP A;  1TRF A;  4TNC A;  2HQW A;  2LLU A;  4HSZ A;  2AAO A;  1YX8 A;  1M45 A;  2OTG B;  3D0Y A;  4OKH A;  1KWO B;  3WXA A;  1XYD A;  2JT0 A;  2HPS A;  1DJW A;  4F0Z B;  4GGN A;  1BMO A;  1CDL A;  1N0Y A;  1SMG A;  2F3Z A;  1AVS A;  2BBN A;  3JVT B;  4N5X A;  4PHJ A;  5D69 A;  1Y1X A;  5KU1 A;  2K7O A;  4JWQ A;  1W7J B;  4AOM A;  2M1K B;  2F8P A;  1WDC C;  2BCA A;  1SKT A;  4DIR A;  1BOD A;  4I5J A;  1D1O A;  2KOT A;  3CGA A;  4M2P A;  1SY9 A;  2LLT A;  2WCB A;  2KGR A;  3M0W A;  1RJV A;  1CFD A;  2KHN A;  2KI4 C;  3LK1 A;  1B8L A;  2HET A;  1J7Q A;  2BKH B;  2JXL A;  1B1G A;  1AHR A;  3RLZ A;  2HF5 A;  3OP0 A;  1PVA A;  4XYN A;  1ZOT B;  3TUY C;  3CWG A;  2M0R A;  1TOP A;  1F71 A;  2KI6 C;  4MZJ A;  1UHH A;  2MRD A;  1A2X A;  1MXL C;  4PE7 A;  1GGZ A;  2V53 A;  2F33 A;  1XK4 A;  1SCV A;  1YUU A;  2BEC A;  3EVV A;  5KSZ A;  1K9P A;  3EKJ A;  4MZL A;  3BUO B;  3WHU B;  2L0P A;  2M7L A;  2MHH A;  2WOS A;  1RFJ A;  2Y5I A;  1K90 D;  3PFV A;  4P2Y B;  1JF2 A;  1A4P A;  3QRX A;  1NIW A;  1UHN A;  5CPV A;  5GQQ C;  3SG3 A;  1C7W A;  2CCM A;  3EK4 A;  4HRE E;  3SG7 A;  1R6P A;  1DGV A;  3FIA A;  1RK9 A;  1CDM A;  2KI4 B;  2M97 A;  1B8R A;  4GGF C;  1B7T Z;  3PLF B;  1SK6 D;  1NUB A;  1IG5 A;  2H61 A;  2L4H A;  4CID A;  2NCP A;  1IRJ A;  2LCP A;  2WC8 A;  1J7R A;  4WQ3 A;  3TUY B;  1JUO A;  2E6W A;  1H8B A;  4QJ3 B;  4DUQ A;  5AFP A;  1NWD A;  4YI8 A;  3LK0 A;  5CSN A;  1A75 B;  1BJF A;  1CLM A;  3DF0 B;  3EVU A;  5HKZ A;  5JOL A;  1ZAC A;  1OE9 B;  2WCE A;  1EJ3 A;  2JPT A;  2M7N A;  2PVB A;  3AAJ A;  4YGE B;  1QLS A;  5I2L A;  1CNP A;  1NX0 A;  1B9A A;  2ZKM X;  1F55 A;  2LUC A;  2BL0 C;  4C0J A;  2PMY A;  2K0J A;  2MAZ A;  1KQM B;  1S26 D;  1XFU O;  4DS7 A;  2L51 A;  3DD4 A;  3SG5 A;  3O6B A;  3C1V A;  1UUR A;  2JC2 A;  2K2F A;  1S6I A;  1KFU S;  4USL A;  5AEQ A;  2BCB A;  1MWN A;  1QX5 B;  1UUS A;  3CS1 A;  3GOF A;  4IL1 A;  2Y1M A;  3IF7 A;  1KQV A;  1OMR A;  2JOJ A;  4C0K A;  2M1U A;  1ZFS A;  4BY5 A;  1DTL A;  1DF0 B;  2COL B;  2KYC A;  2ZND A;  5HLV A;  1ODB A;  1QIV A;  2CTN A;  3K21 A;  2JT3 A;  1S36 A;  3BXK A;  1JC2 A;  3I5F B;  1XFV O;  5HKY A;  2BKI B;  2K7B A;  5I2O A;  1BOC A;  2WOR A;  1OZS A;  2EGD A;  3PN7 C;  1M31 A;  5CSF A;  1KK8 B;  1OQP A;  4ICB A;  2M29 A;  5AER A;  1PSB A;  1QLK A;  3NXA A;  5F6T A;  3TDZ A;  3KEV A;  1K96 A;  2FJU B;  5J3X A;  1N65 A;  2LV7 A;  3PAL A;  2D8N A;  2BL0 B;  2MLF C;  1QVI Y;  1TN4 A;  3BUW B;  3FS7 A;  4UPG A;  5ER5 A;  1V1G A;  2VRG A;  4PDZ A;  2CT9 A;  1J7O A;  1J1E A;  3A4U B;  1NSH A;  1CFF A;  2EHB A;  1KK7 Y;  2M9G A;  3HCM A;  1J1D A;  2GGM A;  2TN4 A;  1DJY A;  1M63 B;  1AJ4 A;  1NCZ A;  2JRF A;  2LP3 A;  1NCY A;  1MXE A;  5DKR A;  2KGB C;  5HLO A;  1UHJ A;  4U8D A;  1LKJ A;  1SPY A;  2Y1N A;  3AAK A;  3VRP A;  3KO0 A;  3VRQ A;  1S6J A;  1OMV A;  4MSP A;  1XA5 A;  1DF0 A;  1LXF C;  4GGF A;  3O78 A;  1CLB A;  3OB2 B;  4N1F A;  1PAL A;  4WQ2 A;  1RTP 1;  4NDB A;  2K7D A;  2DOQ A;  1Y0V H;  3JTD C;  1PVB A;  1F54 A;  1Y6W A;  1SL9 A; 
#chains in the Genus database with same CATH topology
 1CM1 A;  1KSM A;  4FQT A;  3AKB A;  5HKW A;  4CLN A;  1ZUZ A;  1CDN A;  2O60 A;  2M8U A;  1QJT A;  3BFB A;  1E8A A;  4M2O A;  1MF8 B;  3GK2 A;  1QX7 A;  2AUC A;  1N2D A;  1FPW A;  4YBH B;  2JWW A;  2JXC A;  1YUT A;  2LVV A;  3F45 A;  3NHI A;  2ZRS A;  4CFR A;  1A29 A;  1L2O C;  3D10 A;  5HL1 A;  1ALV A;  1R2U A;  2JZI A;  2KFF A;  1IH0 A;  1K95 A;  1TNW A;  4HRH A;  4PAL A;  1F4O A;  1WDC B;  1OZO A;  5G08 A;  3EKH A;  2NLN A;  3I5G C;  4INW A;  2L50 A;  2WCF A;  1IQ3 A;  1SL7 A;  2FCE A;  5CSI A;  4NDC A;  1G33 A;  4FTG A;  3SIB A;  4AQJ A;  1YTZ C;  2E30 A;  3OX6 A;  4PE1 A;  1Z2C B;  2KAX A;  1MQ1 A;  1G4Y R;  4ETO A;  1EG3 A;  5ER4 X;  2QPT A;  2K8M B;  2LVK A;  1SCM C;  2KLE A;  2LM5 A;  2IS9 A;  3BUN B;  1DJZ A;  4N1G A;  3WHT B;  2LHL A;  2PQL A;  3JTD B;  1LA0 A;  3NSK A;  2K60 A;  3MSE B;  1NCX A;  3CDN A;  2MA2 A;  1QVI Z;  1X02 A;  4MVF A;  1W9Z A;  1YUS A;  2EC6 C;  1PRW A;  5DKN A;  3PSR A;  1FBV A;  1TIZ A;  3EK7 A;  1YX7 A;  1QV0 A;  3LCP C;  3SS3 A;  4GPL B;  2QAC A;  1KK7 Z;  3VRO A;  1LVC D;  1AJ5 A;  5D7F A;  1PK0 D;  4XJK B;  4M2Q A;  4A4C A;  2PAS A;  3DVE A;  1OOJ A;  1QTX A;  1WRZ A;  1G8I A;  1BLQ A;  3LL8 B;  2KFG A;  3ZWH A;  1M39 A;  1SNL A;  2PSR A;  4NDD A;  2LLS A;  4YGD B;  1TTX A;  5PAL A;  1YR5 A;  3RM1 A;  3OGN A;  3NHT A;  2MLE C;  1CLL A;  1IQ5 A;  1B8C A;  3I5G B;  2F3Y A;  3BYA A;  1Y1A A;  4PCW A;  4JQ0 D;  3SJS A;  2FJY A;  1Z4H A;  2JNF A;  4JKT A;  3ZNI A;  1DT7 B;  3DVK A;  2KPH A;  2QEB A;  4GNK B;  1WLZ A;  2KLD A;  4QJ4 B;  1FF1 A;  1K9U A;  2L4I A;  1GM0 A;  2ZNE A;  1XK4 C;  2LVI A;  1DGU A;  2K7C A;  4ORC B;  4IJ7 A;  1K2H A;  3OB1 B;  3NSI A;  1DJI A;  1DJH A;  5AAN A;  3N7H A;  1BR1 B;  1K93 D;  1YRU B;  1MHO A;  3TZ1 A;  2K61 A;  1S1E A;  1EL4 A;  5I94 A;  3TS5 C;  4R1E A;  1QX2 A;  2KFH A;  3R1V A;  1B4C A;  4ORA B;  1OMD A;  2BCX A;  1OW4 A;  4ORB B;  1PUL A;  1HQV A;  2LUX A;  2NCO A;  1V1F A;  5FI2 A;  2K2A A;  2LMU A;  1A75 A;  3B6X A;  1MUX A;  3BFH A;  2OPO A;  4MRX A;  3DF0 A;  4YI9 A;  2G9B A;  2Q91 A;  4XJK A;  1REC A;  1SRA A;  2CNP A;  2L2E A;  2O5G A;  1NP8 A;  2L5Y A;  2OS8 C;  1DJX A;  3TDI A;  4PE0 A;  2ISD A;  1C07 A;  3KHE A;  1LIN A;  2WC5 A;  2I2R E;  4YRU A;  3A8R A;  3CZT X;  1KCY A;  1IJ6 A;  1KSO A;  2PAL A;  1C3Z A;  3BOW B;  2LC5 A;  4CPV A;  3AKA A;  1VRK A;  1AUI B;  1K94 A;  3PAT A;  1B47 A;  4OR9 B;  3GK4 X;  2F2O A;  1FW4 A;  1S6C A;  5HYD A;  1W7I B;  4FQO A;  1OSA A;  2ZN9 A;  3SIA A;  1NX1 A;  1XFY O;  1JF0 A;  1K9K A;  1DMO A;  1K8U A;  2JTT A;  1CMF A;  3PN7 B;  1CTR A;  1XVJ A;  3TS5 B;  1FI5 A;  1DJG A;  2LP2 A;  1CM4 A;  3GK1 A;  1MR8 A;  4PE4 A;  1QAS A;  3S0D A;  1F70 A;  3L47 A;  2BE6 A;  3BQ3 A;  3DVM A;  3E3R A;  1YVH A;  4GBA A;  1EH2 A;  1UHK A;  4A4B A;  1CFP A;  2JU0 A;  1BR4 B;  3CR2 A;  3KPX A;  3D73 A;  1AK8 A;  3OX5 A;  1SBJ A;  3B86 A;  1WRL A;  4P5O E;  2LMV A;  3CTN A;  4I5N B;  2OS8 B;  3VRN A;  2KSP A;  1WRK A;  2HQ8 A;  1JWD A;  3VRR A;  1RRO A;  2KQ6 A;  2NXQ A;  5DKQ A;  2SAS A;  3UO9 A;  1KFX L;  2GV5 A;  2MJW B;  2H2K A;  2YGU A;  1L7Z A;  1KFX S;  2ZRT A;  1A03 A;  1OOG A;  1UHI A;  1TWO A;  3KF9 A;  1JSA A;  2I18 A;  1JFK A;  3LLE A;  2M3W A;  2LAP A;  2QEV A;  2GGZ A;  2MBX A;  4YGB B;  1H4B A;  3FWB A;  3WNX B;  2L5X B;  4Q04 A;  4MBE A;  3CR4 X;  1Q80 A;  1WLM A;  2FCD A;  3BOW A;  1JFJ A;  2BBM A;  5JJG A;  4PHK A;  2KBM A;  2I7A A;  3CYZ A;  1QV1 A;  1YRT B;  1TCO B;  1U5I B;  2Y4Q A;  1WY9 A;  1F4Q A;  3CR5 X;  3I5I C;  4DCK A;  3EVR A;  1SW8 A;  1IWQ A;  1S5G Y;  2JQ6 A;  3H4S E;  1IJ5 A;  3PM8 A;  4MRY A;  4I5L B;  1CKK A;  4E68 A;  1TUZ A;  4MZK A;  1KQM C;  4BY4 A;  2R2I A;  2KAV A;  1F8H A;  2L98 A;  1IGV A;  1BG1 A;  2WCL A;  1OOI X;  5I8N A;  1QWV A;  1UP5 A;  3CAB A;  2PRU A;  2KI6 D;  3DVJ A;  1SR6 C;  1XFR A;  3I5H C;  5TNC A;  3SG4 A;  5IBW A;  1BF5 A;  1GJY A;  5K89 A;  2KBI A;  2LMT A;  4OCI A;  3SG6 A;  1CDP A;  4JPZ B;  5KTY A;  3DXL A;  1L2O B;  1TNX A;  1YUR A;  1ZMZ A;  2SCP A;  3SG2 A;  1J7P A;  4L9M A;  2ZN8 A;  1CFC A;  4PHN A;  4MN0 A;  3RZS A;  3IQQ A;  1TNQ A;  3V2L A;  1XFX O;  2G2B A;  3IQO A;  3I5F C;  3L4L A;  4I5K A;  2KAY A;  3FE8 A;  3OHM B;  5FYX A;  1XFW O;  1QS7 A;  2QEO A;  3FWC A;  1BT6 A;  1NX3 A;  1KK8 C;  1OOF A;  4GUK A;  2KYF A;  4DRW A;  2WCK A;  4MLW A;  2LE9 B;  4GFT A;  1QXP A;  1SL8 A;  1C7V A;  3I5I B;  1CMG A;  2P70 A;  1SCM B;  4YGA A;  1Y1U A;  3D0Y B;  4NQG A;  2FOT A;  3BUX B;  2NZ0 A;  1IKU A;  1EG4 A;  4OV2 A;  1NPQ A;  1YVL A;  2EC6 B;  1KFU L;  1NX2 A;  3BJH A;  3DZT A;  3NSL A;  2BNX A;  5AXI A;  2Q4U A;  3NSO A;  3O4Y A;  1C3Y A;  4ZCU A;  1SR6 B;  3I5H B;  3CZ1 A;  4OZD A;  1J55 A;  1U5I A;  2A4J A;  2OTG C;  4HRG A;  1BU3 A;  3EK8 A;  3S0A A;  1EXR A;  5EL2 A;  4D1E A;  1KWO C;  3CLN A;  1UWO A;  1QAT A;  3HX4 A;  3OBV A;  4AQI A;  4OVN F;  1FI6 A;  5B8I B;  1SYM A;  5BPJ A;  2CBL A;  2JT8 A;  1TCF A;  3VGO A;  1AP4 A;  1XO5 A;  4QJ5 B;  2F2P A;  2JUL A;  2WC6 A;  2AMI A;  3JVT C;  2JTZ A;  1JBA A;  2P71 A;  4MEW A;  1QIW A;  3SS4 A;  2B1U A;  1S3P A;  3TDU A;  1DEK A;  2H61 C;  2JNX A;  1GQM A;  2WND A;  1RWY A;  5I2Q A;  2LAN A;  4INX A;  2LNK A;  2LVJ A;  2WCJ A;  3ICB A;  1HT9 A;  4GAO A;  3O2P A;  2KNE A;  2P6B B;  1XFZ O;  1PSR A;  2LHI A;  3L4A A;  4PHM A;  4C0L A;  4WRI A;  1B7T Y;  1LA3 A;  3VB1 A;  1S5G Z;  3BUM B;  4CFQ A;  2KQY A;  2RGI A;  1ALW A;  2I94 A;  2WCM A;  2ZFD A;  4ZCV A;  1GGW A;  5D3O A;  1DVI A;  3K1E A;  2M49 B;  2CXJ A;  3DY9 A;  5CSJ A;  4YGC B;  1NYA A;  2KDH A;  3D76 A;  2BE4 A;  1M46 A;  1TNP A;  1TRF A;  4TNC A;  2HQW A;  2LLU A;  4HSZ A;  2AAO A;  1YX8 A;  1M45 A;  2OTG B;  2PYQ A;  3D0Y A;  4OKH A;  1KWO B;  3WXA A;  1XYD A;  2JT0 A;  3EG5 B;  2ERB A;  1DJW A;  2HPS A;  4F0Z B;  4GGN A;  1BMO A;  1CDL A;  1N0Y A;  1SMG A;  2F3Z A;  1AVS A;  2BBN A;  3JVT B;  4N5X A;  4PHJ A;  5D69 A;  1Y1X A;  5KU1 A;  3CZ2 A;  1DEL A;  2K7O A;  1W7J B;  4JWQ A;  2M1K B;  2F8P A;  4AOM A;  1WDC C;  2BCA A;  1SKT A;  4DIR A;  1BOD A;  4I5J A;  1D1O A;  3CZ0 A;  2KOT A;  3CGA A;  3FE9 A;  4M2P A;  1SY9 A;  2LLT A;  2WCB A;  2KGR A;  3M0W A;  1RJV A;  1CFD A;  3S0G A;  2KHN A;  2KI4 C;  3LK1 A;  1B8L A;  2HET A;  3B88 A;  1J7Q A;  3D75 A;  2BKH B;  2JXL A;  1TUJ A;  1AHR A;  1B1G A;  3RLZ A;  2HF5 A;  3OP0 A;  1PVA A;  4XYN A;  1ZOT B;  3TUY C;  3CWG A;  2M0R A;  1TOP A;  1F71 A;  2KI6 C;  4MZJ A;  1UHH A;  2MRD A;  1A2X A;  1MXL C;  4PE7 A;  1GGZ A;  1T14 A;  2V53 A;  2F33 A;  1XK4 A;  1SCV A;  1YUU A;  2BEC A;  3EVV A;  5KSZ A;  1K9P A;  3EKJ A;  4MZL A;  3BUO B;  3WHU B;  3FE6 A;  2L0P A;  2M7L A;  2MHH A;  2WOS A;  1RFJ A;  2Y5I A;  1K90 D;  1P28 A;  1ORG A;  3R1P A;  3PFV A;  3S0B A;  4P2Y B;  1JF2 A;  2QDI A;  1A4P A;  3QRX A;  1NIW A;  1UHN A;  1SSE B;  5CPV A;  5GQQ C;  3R72 A;  3SG3 A;  4F7F A;  1C7W A;  2CCM A;  2L2C A;  3EK4 A;  4HRE E;  1R6P A;  3SG7 A;  3S0F A;  1DGV A;  3FIA A;  1RK9 A;  1CDM A;  2KI4 B;  3UNW A;  2M97 A;  1B8R A;  4GGF C;  1B7T Z;  3PLF B;  1SK6 D;  1NUB A;  1IG5 A;  2H61 A;  2L4H A;  4CID A;  2NCP A;  1IRJ A;  2LCP A;  2WC8 A;  1J7R A;  4WQ3 A;  3PM2 A;  1JUO A;  2H8V A;  5FI6 A;  2E6W A;  3TUY B;  1H8B A;  4QJ3 B;  4DUQ A;  5AFP A;  1NWD A;  4YI8 A;  3LK0 A;  5CSN A;  1A75 B;  1BJF A;  3BFA A;  1CLM A;  3DF0 B;  1IIO A;  3EVU A;  5HKZ A;  5JOL A;  1ZAC A;  1OE9 B;  2WCE A;  1EJ3 A;  2JPT A;  2M7N A;  2PVB A;  3AAJ A;  4YGE B;  1QLS A;  2WCH A;  3D77 A;  5I2L A;  1CNP A;  1NX0 A;  1B9A A;  2ZKM X;  1F55 A;  2LUC A;  2BL0 C;  4C0J A;  2PMY A;  2K0J A;  2MAZ A;  1KQM B;  1S26 D;  1XFU O;  4DS7 A;  2L51 A;  3B87 A;  3DD4 A;  3SG5 A;  3D78 A;  3O6B A;  3C1V A;  1UUR A;  2JC2 A;  2K2F A;  1S6I A;  1KFU S;  3Q8I A;  4USL A;  2BCB A;  1MWN A;  1QX5 B;  1UUS A;  3CS1 A;  3GOF A;  5AEQ A;  4IL1 A;  2Y1M A;  3IF7 A;  2QEH A;  1KQV A;  1OMR A;  2JOJ A;  3B7A A;  4C0K A;  2M1U A;  1ZFS A;  4PT1 A;  4BY5 A;  1DTL A;  1DF0 B;  2BAP A;  2COL B;  3PJI A;  2KYC A;  1DQE A;  2ZND A;  5HLV A;  1ODB A;  1QIV A;  2CTN A;  3K21 A;  2JT3 A;  1S36 A;  3BXK A;  4KYN A;  1JC2 A;  3IVT A;  3I5F B;  1XFV O;  5HKY A;  2BKI B;  2K7B A;  5I2O A;  1BOC A;  2WOR A;  1OZS A;  2EGD A;  3PN7 C;  1M31 A;  5CSF A;  1KK8 B;  1OQP A;  4ICB A;  2M29 A;  5AER A;  1PSB A;  1QLK A;  3NXA A;  5FI7 A;  5F6T A;  3TDZ A;  3KEV A;  1K96 A;  2FJU B;  5J3X A;  1N65 A;  2LV7 A;  2GTE A;  2D8N A;  2BL0 B;  2MLF C;  3PAL A;  1QVI Y;  1TN4 A;  3BUW B;  3R1O A;  3FS7 A;  4UPG A;  4JD9 A;  5ER5 A;  1V1G A;  2VRG A;  3D74 A;  4PDZ A;  2CT9 A;  1J7O A;  1J1E A;  3A4U B;  1LS8 A;  1NSH A;  1CFF A;  2EHB A;  1KK7 Y;  3QME A;  2M9G A;  3HCM A;  1J1D A;  2GGM A;  2JPO A;  2TN4 A;  1DJY A;  1M63 B;  1AJ4 A;  1NCZ A;  2JRF A;  2LP3 A;  1NCY A;  1MXE A;  3NGV A;  5DKR A;  2KGB C;  1CB1 A;  1OOH A;  5HLO A;  1UHJ A;  5DIC A;  4U8D A;  1LKJ A;  1SPY A;  2Y1N A;  3AAK A;  3VRP A;  3KO0 A;  3VRQ A;  1S6J A;  1OMV A;  4MSP A;  1XA5 A;  1DF0 A;  1LXF C;  4GGF A;  3O78 A;  3O4X A;  1CLB A;  3OB2 B;  3SS5 A;  4N1F A;  1PAL A;  4WQ2 A;  3DYE A;  1RTP 1;  4NDB A;  2K7D A;  3S0E A;  2DOQ A;  1Y0V H;  3JTD C;  1DC1 A;  1PVB A;  1F54 A;  1Y6W A;  1SL9 A; 
#chains in the Genus database with same CATH homology
 1CM1 A;  1KSM A;  3AKB A;  5HKW A;  4CLN A;  1ZUZ A;  1CDN A;  2O60 A;  2M8U A;  1QJT A;  1E8A A;  4M2O A;  1MF8 B;  3GK2 A;  1QX7 A;  2AUC A;  1N2D A;  1FPW A;  4YBH B;  2JWW A;  2JXC A;  1YUT A;  2LVV A;  3F45 A;  2ZRS A;  4CFR A;  1A29 A;  1L2O C;  3D10 A;  1IH0 A;  1ALV A;  1R2U A;  2JZI A;  2KFF A;  1K95 A;  1TNW A;  4HRH A;  4PAL A;  1F4O A;  1WDC B;  1OZO A;  5G08 A;  3EKH A;  2NLN A;  3I5G C;  2L50 A;  2WCF A;  1IQ3 A;  1SL7 A;  2FCE A;  5CSI A;  4NDC A;  1G33 A;  4FTG A;  3SIB A;  4AQJ A;  1YTZ C;  2E30 A;  3OX6 A;  4PE1 A;  2KAX A;  1MQ1 A;  1G4Y R;  4ETO A;  1EG3 A;  5ER4 X;  2QPT A;  2K8M B;  2LVK A;  1SCM C;  2LM5 A;  2IS9 A;  3BUN B;  1DJZ A;  4N1G A;  3WHT B;  2LHL A;  3JTD B;  1LA0 A;  3NSK A;  3MSE B;  1NCX A;  2MA2 A;  1QVI Z;  1X02 A;  4MVF A;  1YUS A;  2EC6 C;  1PRW A;  5DKN A;  3PSR A;  1FBV A;  1TIZ A;  3EK7 A;  1YX7 A;  1QV0 A;  3LCP C;  4GPL B;  2QAC A;  1KK7 Z;  3VRO A;  1LVC D;  1AJ5 A;  5D7F A;  1PK0 D;  4XJK B;  4M2Q A;  4A4C A;  2PAS A;  3DVE A;  1OOJ A;  1QTX A;  1WRZ A;  1G8I A;  1BLQ A;  3LL8 B;  2KFG A;  3ZWH A;  1M39 A;  1SNL A;  2PSR A;  4NDD A;  2LLS A;  4YGD B;  1TTX A;  5PAL A;  1YR5 A;  3RM1 A;  2MLE C;  1CLL A;  1IQ5 A;  1B8C A;  3I5G B;  2F3Y A;  3BYA A;  1Y1A A;  4PCW A;  4JQ0 D;  3SJS A;  2JNF A;  3ZNI A;  1DT7 B;  3DVK A;  4GNK B;  1WLZ A;  4QJ4 B;  1FF1 A;  1K9U A;  2L4I A;  2ZNE A;  1XK4 C;  2LVI A;  1DGU A;  2K7C A;  4ORC B;  1K2H A;  3OB1 B;  3NSI A;  1DJI A;  1DJH A;  5AAN A;  1BR1 B;  1K93 D;  1YRU B;  1MHO A;  3TZ1 A;  2K61 A;  1S1E A;  1EL4 A;  3TS5 C;  4R1E A;  1QX2 A;  2KFH A;  1B4C A;  4ORA B;  1OMD A;  2BCX A;  4ORB B;  1PUL A;  1HQV A;  2LUX A;  2NCO A;  1V1F A;  2K2A A;  2LMU A;  1A75 A;  1MUX A;  2OPO A;  4MRX A;  3DF0 A;  4YI9 A;  2G9B A;  2Q91 A;  4XJK A;  1REC A;  1SRA A;  2CNP A;  2L2E A;  2O5G A;  1NP8 A;  2OS8 C;  1DJX A;  3TDI A;  4PE0 A;  2ISD A;  1C07 A;  3KHE A;  1LIN A;  4YRU A;  2I2R E;  3A8R A;  3CZT X;  1KCY A;  1IJ6 A;  1KSO A;  2PAL A;  3BOW B;  2LC5 A;  4CPV A;  3AKA A;  1VRK A;  1AUI B;  1K94 A;  3PAT A;  1B47 A;  4OR9 B;  3GK4 X;  2F2O A;  1FW4 A;  1S6C A;  5HYD A;  1W7I B;  4FQO A;  1OSA A;  2ZN9 A;  3SIA A;  1NX1 A;  1XFY O;  1JF0 A;  1K9K A;  1DMO A;  1K8U A;  2JTT A;  1CMF A;  3PN7 B;  1CTR A;  1XVJ A;  3TS5 B;  1FI5 A;  1DJG A;  2LP2 A;  1CM4 A;  3GK1 A;  1MR8 A;  4PE4 A;  1QAS A;  1F70 A;  2BE6 A;  3BQ3 A;  3DVM A;  3E3R A;  1YVH A;  4GBA A;  1EH2 A;  1UHK A;  4A4B A;  1CFP A;  2JU0 A;  1BR4 B;  3CR2 A;  3KPX A;  1AK8 A;  3OX5 A;  1SBJ A;  1WRL A;  4P5O E;  2LMV A;  3CTN A;  4I5N B;  2OS8 B;  3VRN A;  2KSP A;  1WRK A;  2HQ8 A;  1JWD A;  3VRR A;  1RRO A;  2KQ6 A;  2NXQ A;  5DKQ A;  2SAS A;  1KFX L;  2GV5 A;  2MJW B;  2H2K A;  1L7Z A;  1KFX S;  2ZRT A;  1A03 A;  1UHI A;  3KF9 A;  1JSA A;  2I18 A;  1JFK A;  3LLE A;  2M3W A;  2LAP A;  2GGZ A;  2MBX A;  4YGB B;  1H4B A;  3FWB A;  3WNX B;  2L5X B;  4Q04 A;  4MBE A;  3CR4 X;  1Q80 A;  1WLM A;  2FCD A;  3BOW A;  1JFJ A;  2BBM A;  5JJG A;  4PHK A;  2KBM A;  2I7A A;  1QV1 A;  1YRT B;  1TCO B;  1U5I B;  2Y4Q A;  1WY9 A;  1F4Q A;  3CR5 X;  3I5I C;  4DCK A;  3EVR A;  1SW8 A;  1IWQ A;  1S5G Y;  2JQ6 A;  3H4S E;  1IJ5 A;  3PM8 A;  4MRY A;  4I5L B;  1CKK A;  4E68 A;  4MZK A;  1KQM C;  4BY4 A;  2R2I A;  2KAV A;  1F8H A;  2L98 A;  1IGV A;  5I8N A;  1UP5 A;  3DVJ A;  1BG1 A;  2PRU A;  2KI6 D;  5TNC A;  1SR6 C;  3I5H C;  3SG4 A;  5IBW A;  1BF5 A;  1GJY A;  5K89 A;  2KBI A;  2LMT A;  4OCI A;  3SG6 A;  1CDP A;  4JPZ B;  5KTY A;  1L2O B;  1TNX A;  1YUR A;  1ZMZ A;  2SCP A;  3SG2 A;  1J7P A;  4L9M A;  2ZN8 A;  1CFC A;  4PHN A;  4MN0 A;  3IQQ A;  1TNQ A;  1XFX O;  2G2B A;  3IQO A;  3I5F C;  4I5K A;  2KAY A;  3OHM B;  5FYX A;  1XFW O;  1QS7 A;  3FWC A;  1BT6 A;  1NX3 A;  1KK8 C;  4GUK A;  2KYF A;  4DRW A;  4MLW A;  2LE9 B;  4GFT A;  1QXP A;  1SL8 A;  1C7V A;  3I5I B;  1CMG A;  1SCM B;  4YGA A;  1Y1U A;  3D0Y B;  4NQG A;  2FOT A;  3BUX B;  2NZ0 A;  1IKU A;  1EG4 A;  4OV2 A;  1NPQ A;  1YVL A;  2EC6 B;  1KFU L;  1NX2 A;  3NSL A;  5AXI A;  2Q4U A;  3NSO A;  3O4Y A;  4ZCU A;  1SR6 B;  3I5H B;  1J55 A;  1U5I A;  2A4J A;  2OTG C;  4HRG A;  1BU3 A;  3EK8 A;  1CB1 A;  1EXR A;  4D1E A;  1KWO C;  3CLN A;  1UWO A;  1QAT A;  3HX4 A;  4AQI A;  1FI6 A;  4OVN F;  5B8I B;  1SYM A;  5BPJ A;  2CBL A;  2JT8 A;  1TCF A;  3VGO A;  1AP4 A;  1XO5 A;  4QJ5 B;  2F2P A;  2JUL A;  2AMI A;  3JVT C;  2JTZ A;  1JBA A;  4MEW A;  1QIW A;  2B1U A;  1S3P A;  3TDU A;  2H61 C;  2JNX A;  1GQM A;  2WND A;  1RWY A;  5I2Q A;  2LAN A;  2LNK A;  2LVJ A;  3ICB A;  1HT9 A;  4GAO A;  3O2P A;  2KNE A;  2P6B B;  1XFZ O;  1PSR A;  2LHI A;  4PHM A;  4C0L A;  4WRI A;  1B7T Y;  1LA3 A;  1S5G Z;  3BUM B;  4CFQ A;  2KQY A;  2RGI A;  1ALW A;  2I94 A;  2ZFD A;  4ZCV A;  1GGW A;  1DVI A;  2M49 B;  2CXJ A;  4YGC B;  5CSJ A;  1NYA A;  2KDH A;  2BE4 A;  1M46 A;  1TNP A;  1TRF A;  4TNC A;  2HQW A;  2LLU A;  4HSZ A;  2AAO A;  1YX8 A;  1M45 A;  2OTG B;  3D0Y A;  4OKH A;  1KWO B;  3WXA A;  1XYD A;  2JT0 A;  2HPS A;  1DJW A;  4F0Z B;  4GGN A;  1BMO A;  1CDL A;  1N0Y A;  1SMG A;  2F3Z A;  1AVS A;  2BBN A;  3JVT B;  4N5X A;  4PHJ A;  5D69 A;  1Y1X A;  5KU1 A;  2K7O A;  4JWQ A;  1W7J B;  4AOM A;  2M1K B;  2F8P A;  1WDC C;  2BCA A;  1SKT A;  4DIR A;  1BOD A;  4I5J A;  1D1O A;  2KOT A;  3CGA A;  4M2P A;  1SY9 A;  2LLT A;  2WCB A;  2KGR A;  3M0W A;  1RJV A;  1CFD A;  2KHN A;  2KI4 C;  3LK1 A;  1B8L A;  2HET A;  1J7Q A;  2BKH B;  2JXL A;  1B1G A;  1AHR A;  3RLZ A;  2HF5 A;  3OP0 A;  1PVA A;  4XYN A;  1ZOT B;  3TUY C;  3CWG A;  2M0R A;  1TOP A;  1F71 A;  2KI6 C;  4MZJ A;  1UHH A;  2MRD A;  1A2X A;  1MXL C;  4PE7 A;  1GGZ A;  2V53 A;  2F33 A;  1XK4 A;  1SCV A;  1YUU A;  2BEC A;  3EVV A;  5KSZ A;  1K9P A;  3EKJ A;  4MZL A;  3BUO B;  3WHU B;  2L0P A;  2M7L A;  2MHH A;  2WOS A;  1RFJ A;  2Y5I A;  1K90 D;  3PFV A;  4P2Y B;  1JF2 A;  1A4P A;  3QRX A;  1NIW A;  1UHN A;  5CPV A;  5GQQ C;  3SG3 A;  1C7W A;  2CCM A;  3EK4 A;  4HRE E;  3SG7 A;  1R6P A;  1DGV A;  3FIA A;  1RK9 A;  1CDM A;  2KI4 B;  2M97 A;  1B8R A;  4GGF C;  1B7T Z;  3PLF B;  1SK6 D;  1NUB A;  1IG5 A;  2H61 A;  2L4H A;  4CID A;  2NCP A;  1IRJ A;  2LCP A;  2WC8 A;  1J7R A;  4WQ3 A;  3TUY B;  1JUO A;  2E6W A;  1H8B A;  4QJ3 B;  4DUQ A;  5AFP A;  1NWD A;  4YI8 A;  3LK0 A;  5CSN A;  1A75 B;  1BJF A;  1CLM A;  3DF0 B;  3EVU A;  5HKZ A;  5JOL A;  1ZAC A;  1OE9 B;  2WCE A;  1EJ3 A;  2JPT A;  2M7N A;  2PVB A;  3AAJ A;  4YGE B;  1QLS A;  5I2L A;  1CNP A;  1NX0 A;  1B9A A;  2ZKM X;  1F55 A;  2LUC A;  2BL0 C;  4C0J A;  2PMY A;  2K0J A;  2MAZ A;  1KQM B;  1S26 D;  1XFU O;  4DS7 A;  2L51 A;  3DD4 A;  3SG5 A;  3O6B A;  3C1V A;  1UUR A;  2JC2 A;  2K2F A;  1S6I A;  1KFU S;  4USL A;  5AEQ A;  2BCB A;  1MWN A;  1QX5 B;  1UUS A;  3CS1 A;  3GOF A;  4IL1 A;  2Y1M A;  3IF7 A;  1KQV A;  1OMR A;  2JOJ A;  4C0K A;  2M1U A;  1ZFS A;  4BY5 A;  1DTL A;  1DF0 B;  2COL B;  2KYC A;  2ZND A;  5HLV A;  1ODB A;  1QIV A;  2CTN A;  3K21 A;  2JT3 A;  1S36 A;  3BXK A;  1JC2 A;  3I5F B;  1XFV O;  5HKY A;  2BKI B;  2K7B A;  5I2O A;  1BOC A;  2WOR A;  1OZS A;  2EGD A;  3PN7 C;  1M31 A;  5CSF A;  1KK8 B;  1OQP A;  4ICB A;  2M29 A;  5AER A;  1PSB A;  1QLK A;  3NXA A;  5F6T A;  3TDZ A;  3KEV A;  1K96 A;  2FJU B;  5J3X A;  1N65 A;  2LV7 A;  3PAL A;  2D8N A;  2BL0 B;  2MLF C;  1QVI Y;  1TN4 A;  3BUW B;  3FS7 A;  4UPG A;  5ER5 A;  1V1G A;  2VRG A;  4PDZ A;  2CT9 A;  1J7O A;  1J1E A;  3A4U B;  1NSH A;  1CFF A;  2EHB A;  1KK7 Y;  2M9G A;  3HCM A;  1J1D A;  2GGM A;  2TN4 A;  1DJY A;  1M63 B;  1AJ4 A;  1NCZ A;  2JRF A;  2LP3 A;  1NCY A;  1MXE A;  5DKR A;  2KGB C;  5HLO A;  1UHJ A;  4U8D A;  1LKJ A;  1SPY A;  2Y1N A;  3AAK A;  3VRP A;  3KO0 A;  3VRQ A;  1S6J A;  1OMV A;  4MSP A;  1XA5 A;  1DF0 A;  1LXF C;  4GGF A;  3O78 A;  1CLB A;  3OB2 B;  4N1F A;  1PAL A;  4WQ2 A;  1RTP 1;  4NDB A;  2K7D A;  2DOQ A;  1Y0V H;  3JTD C;  1PVB A;  1F54 A;  1Y6W A;  1SL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...