2JNXA

Nmr derived solution structure of an ef-hand calcium binding protein from entamoeba histolytica
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
134
structure length
134
Chain Sequence
MAEALFKQLDANGDGSVSYEEVKAFVSSKRPIKNEQLLQLIFKAIDIDGNGEIDLAEFTKFAAAVKEQDLSDEKVGLKILYKLMDADGDGKLTKEEVTTFFKKFGYEKVVDQIMKADANGDGYITLEEFLAFNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium binding protein 2
publication title Structure, dynamics, and physiological properties of a Calcium Binding Protein from Entamoeba Histolytica (EhCaBP2)
rcsb
source organism Entamoeba histolytica
molecule tags Metal binding protein
total genus 29
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2007-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnxA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2jnxA02
1BOCA 1NSHA 4MZJA 2ZN8A 4GBAA 1F71A 1DJGA 5CSIA 2NCPA 3LK0A 1EJ3A 3FWBA 1EG3A 4I5KA 4XYNA 1YR5A 3PM8A 1C7VA 2KGRA 4MZLA 1B9AA 2D8NA 1QIVA 1DGVA 2F2OA 2KQ6A 5AERA 1KFUS 1H8BA 1B7TZ 5AFPA 2KGBC 1QV0A 1QLKA 1UP5A 2LHIA 4A4BA 4OVNF 2JU0A 2LLUA 2I94A 4IL1A 1GGWA 1QASA 1MQ1A 2JT0A 1LA0A 4I5LB 4MSPA 1QX7A 3TUYC 3VRQA 1JUOA 1Y6WA 2L4IA 1CKKA 1SCMB 3VGOA 1OMRA 1YVLA 2L0PA 1KK8C 1H4BA 2WCEA 4GPLB 3BOWA 2K7BA 1AUIB 2KFFA 2MJWB 2RGIA 2QPTA 1K9UA 3D10A 5AANA 2MHHA 1C7WA 3CWGA 2K2AA 1TIZA 1ODBA 1K9PA 3TDZA 1U5IB 2M0RA 4UPGA 3DVEA 3JTDB 3KPXA 3QRXA 4C0LA 1YVHA 2M1KB 2LMUA 4JPZB 1CFDA 4MBEA 4AQJA 5I2QA 1CDPA 5JJGA 4MLWA 2WCBA 1TNWA 1NCZA 1V1GA 3OP0A 5KU1A 1IGVA 2FCDA 4USLA 3AAKA 1DTLA 4PHNA 3CGAA 4PHJA 3EVVA 1TNQA 1UURA 2L2EA 2LVIA 3VRPA 3SG2A 3CS1A 1NUBA 3AAJA 1SCMC 4M2OA 1UHHA 1SPYA 1SY9A 1SW8A 2ZRTA 2AAOA 4XJKB 4HSZA 2JULA 1EG4A 2BCXA 1ZACA 1MXEA 1SKTA 2KBMA 3ZWHA 1FF1A 1DJYA 3I5FB 3LL8B 1PULA 2WOSA 1QV1A 2HETA 4N5XA 2JC2A 2NLNA 1F4OA 3EVUA 1YUTA 5KSZA 1OE9B 1LVCD 1CM4A 4I5JA 2JT8A 2JXLA 2CXJA 1PALA 1WLZA 2WC8A 3SJSA 4YGCB 2EC6B 1UUSA 2F3YA 2B1UA 3GK4X 1B47A 1ALWA 3DF0A 3JTDC 3FS7A 4MN0A 4QJ4B 1QXPA 2NZ0A 4ZCUA 2QACA 2K7CA 1DJIA 5G08A 3PSRA 1K9KA 1K94A 1U5IA 2F3ZA 1BR4B 1LKJA 2AUCA 1MHOA 3ICBA 1NCXA 1MUXA 2LVJA 4I5NB 1KWOC 4N1GA 1J55A 3TDIA 2KI4B 2WORA 1FPWA 1ALVA 2DOQA 1DMOA 2LMVA 4PE4A 4MZKA 3A8RA 1OMDA 2ZNDA 1QS7A 2JRFA 2OPOA 3CR4X 3OX6A 5HKZA 1J1DA 1OOJA 4WQ2A 3I5FC 1QJTA 4BY4A 1G8IA 2K8MB 2KI6D 1SBJA 1UHJA 5CPVA 2H61C 2MLEC 2KYFA 5D69A 5D7FA 3NSOA 4XJKA 1PRWA 4ORCB 2PSRA 2EC6C 2M9GA 4FQOA 4GUKA 5DKNA 2GV5A 1KK8B 1UHIA 4N1FA 2R2IA 1OSAA 4JWQA 2M49B 3GK1A 1CMFA 2LUCA 1SL7A 4QJ5B 1B8CA 3CTNA 4M2QA 2CBLA 1J7OA 1HQVA 3BUWB 1ZMZA 1TOPA 2PRUA 1M45A 5FYXA 2I7AA 2M3WA 4L9MA 4A4CA 1K96A 2F8PA 2KOTA 4E68A 2KI4C 1N65A 2CCMA 2LNKA 1BR1B 4TNCA 2Y4QA 4PE1A 4ORBB 1JWDA 2L51A 3BUXB 3KO0A 1KCYA 3SG3A 2JWWA 5ER4X 1YX7A 1B8LA 1XVJA 1K95A 2BL0B 1MR8A 1NCYA 1TNPA 1VRKA 2LVKA 2KDHA 4AOMA 4YGAA 1CLLA 2ISDA 1D1OA 2PVBA 1CM1A 1RFJA 1CFPA 1DJWA 1OQPA 1S6CA 1YTZC 2OTGB 5F6TA 2Y5IA 2M1UA 3BYAA 1GGZA 2M7LA 1M31A 2I2RE 1KSMA 1R2UA 4YI9A 2NXQA 4JQ0D 1CNPA 1XO5A 5HKWA 1AVSA 4MRYA 4AQIA 2TN4A 1XK4A 3DF0B 1QLSA 2M8UA 2MA2A 5CSNA 1RROA 4OR9B 4P2YB 1YUUA 1E8AA 2O5GA 2M7NA 2M29A 2JQ6A 2E30A 2H2KA 1EL4A 2NCOA 1CDNA 1J7RA 3K21A 3FIAA 1QATA 4NQGA 3BQ3A 3O78A 1QX5B 2OS8B 4PDZA 1S1EA 1DGUA 1Y0VH 3SIAA 1CFFA 3KHEA 3EK7A 2BL0C 1K93D 2L5XB 1M39A 2VRGA 3JVTB 1A75A 1GQMA 1XYDA 1M46A 1UHKA 2JT3A 2K61A 3DVJA 1OZOA 3BXKA 1JBAA 1Y1AA 4DS7A 3EKJA 2OTGC 2F33A 1KWOB 1B1GA 1AJ5A 1IRJA 5PALA 1QIWA 1RTP1 4PE0A 4C0JA 1IQ5A 1NX1A 2LLTA 3BUNB 2JOJA 2BECA 1IKUA 5I8NA 3PN7B 1QVIZ 3DVKA 1CLBA 4WQ3A 2CTNA 1K8UA 3CR5X 3A4UB 1G4YR 1BODA 1AHRA 3WHTB 3LCPC 3O2PA 1CB1A 4Q04A 3TS5C 3DD4A 3H4SE 1LINA 4CLNA 1JF2A 1CFCA 1DJXA 2FCEA 2OS8C 3TZ1A 5JOLA 2JTTA 5I2OA 1JF0A 4HRGA 2G2BA 2GGMA 1LXFC 3NSIA 2WNDA 3CZTX 2LUXA 2AMIA 1SMGA 1TRFA 2Q4UA 1CDMA 2JNXA 1Y1UA 3OHMB 3JVTC 2LCPA 1PVBA 2FOTA 1S5GY 4M2PA 3SG4A 5IBWA 4YGEB 2LC5A 4YBHB 1S3PA 3NXAA 2KAYA 1IH0A 4DIRA 4GNKB 2CNPA 1W7JB 1L7ZA 1ZFSA 3TDUA 2LP3A 2V53A 3PN7C 3O6BA 3LLEA 1NPQA 2L98A 2Y1NA 2I18A 1IWQA 4GGFC 2L4HA 1FW4A 1M63B 1NX2A 4QJ3B 1SYMA 3HX4A 1WRKA 3KF9A 5DKRA 1DVIA 1ZUZA 1BMOA 1B4CA 1B7TY 1BJFA 1WRZA 5AXIA 1Y1XA 3CR2A 1WY9A 2BBMA 4GGFA 2KAVA 2LP2A 1MXLC 2MRDA 1IQ3A 1JC2A 2MLFC 4CPVA 3D0YA 1WDCB 1RWYA 3IQQA 2LHLA 4ORAB 2KHNA 3SG5A 4CFRA 2BKHB 5TNCA 2KNEA 2ZNEA 3NSLA 4NDBA 5K89A 1NYAA 2LMTA 2LANA 1CDLA 4ZCVA 1PVAA 2KYCA 4GGNA 1S26D 4HREE 3OB2B 1K2HA 1A75B 5HYDA 2SASA 3I5IB 1KK7Z 4GAOA 1BT6A 1MWNA 4FTGA 5ER5A 2M97A 3I5HB 3KEVA 3IF7A 2KFGA 1XFZO 2KBIA 3PLFB 1KQVA 2LE9B 2MBXA 1S6JA 2Q91A 2SCPA 1N2DA 2ZN9A 1XK4C 2JPTA 3MSEB 2CT9A 3EVRA 3VRNA 1KQMC 2MAZA 3AKAA 2PALA 3SIBA 1A2XA 1Q80A 2BE6A 2HF5A 1IG5A 1SR6B 1C07A 3SG7A 1OZSA 1RK9A 1WDCC 2ZKMX 3WXAA 3GOFA 4PHKA 1K90D 3WHUB 1YRUB 1SRAA 4ETOA 2BBNA 5B8IB 2HQ8A 1UHNA 1NWDA 3EKHA 1AJ4A 1J7QA 1XFVO 3TS5B 3PATA 4YI8A 5AEQA 1F4QA 1FI6A 1S36A 3I5IC 1MF8B 1DF0A 2LVVA 1QVIY 2E6WA 3LK1A 1PSBA 2K7DA 1B8RA 3F45A 4OV2A 1OMVA 1CMGA 3I5HC 3M0WA 5CSJA 3BUOB 4NDCA 3ZNIA 1F70A 4CFQA 2O60A 1TTXA 3EK4A 1XFUO 1NX0A 1XFXO 4BY5A 2GGZA 2LLSA 4PHMA 1IJ5A 5DKQA 1JSAA 2ZRSA 2WCFA 1SL8A 3OB1B 1JFKA 4WRIA 1BG1A 1QTXA 2A4JA 3O4YA 1YX8A 5J3XA 2KFHA 1SR6C 4DRWA 3PFVA 2P6BB 3PALA 1FI5A 3I5GB 2LM5A 4D1EA 2Y1MA 1TCOB 1IJ6A 1A03A 1A4PA 1TN4A 1TNXA 5CSFA 1DT7B 2JZIA 1RJVA 1SCVA 1L2OB 3D0YB 4P5OE 1SK6D 2JTZA 1PK0D 1J1EA 1KFXL 2LV7A 4R1EA 2BE4A 5HLOA 1F54A 4GFTA 1BLQA 1AK8A 2EHBA 1CLMA 2KQYA 4DUQA 4DCKA 4HRHA 4F0ZB 3OX5A 2BCBA 1XFWO 4YGDB 2JNFA 4YGBB 2K7OA 2LAPA 1NX3A 2L50A 1KFXS 4OCIA 2IS9A 1RECA 1JFJA 4CIDA 2K2FA 3CLNA 2ZFDA 1NP8A 1YUSA 1EH2A 3IQOA 1HT9A 2KI6C 3GK2A 3NSKA 1XA5A 1LA3A 1A29A 1N0YA 4U8DA 3WNXB 1J7PA 3AKBA 3I5GC 3RLZA 1FBVA 3C1VA 2G9BA 5HLVA 1CTRA 1L2OC 2K0JA 1KK7Y 1QX2A 2PASA 5BPJA 1WLMA 1PSRA 3E3RA 3EK8A 2HPSA 1S6IA 5GQQC 1KQMB 2JXCA 4YRUA 4PE7A 2COLB 2FJUB 2KAXA 3DVMA 1G33A 4OKHA 1YRTB 1DF0B 3VROA 4MVFA 3SG6A 4PALA 3VRRA 1BU3A 2PMYA 3FWCA 3RM1A 5I2LA 1X02A 1SL9A 1F55A 4PCWA 4C0KA 2HQWA 1TCFA 1EXRA 5KTYA 1V1FA 1DJZA 3BOWB 2F2PA 2BCAA 1SNLA 2EGDA 3BUMB 1F8HA 1YURA 1DJHA 4ICBA 4MEWA 1WRLA 1S5GZ 3TUYB 1R6PA 1UWOA 1NIWA 2KSPA 2BKIB 1XFYO 1GJYA 5HKYA 4NDDA 1BF5A 1KSOA 1W7IB 1ZOTB 3HCMA 4MRXA 1KFUL 2H61A 1AP4A
chains in the Genus database with same CATH superfamily
1BOCA 1NSHA 4MZJA 2ZN8A 3R1PA 2WCJA 1GM0A 4GBAA 1F71A 2K60A 1DJGA 5CSIA 2NCPA 3LK0A 1EJ3A 3BFAA 3FWBA 1EG3A 4I5KA 4XYNA 1YR5A 3PM8A 1C7VA 2KGRA 4MZLA 1B9AA 2D8NA 1QIVA 1DGVA 2F2OA 2KQ6A 5AERA 1KFUS 1H8BA 1B7TZ 5AFPA 2KGBC 1QV0A 1TUJA 1QLKA 1UP5A 2LHIA 4A4BA 4OVNF 2ERBA 2JU0A 2LLUA 2I94A 3D74A 4IL1A 1GGWA 1QASA 1MQ1A 2JT0A 1LA0A 4I5LB 4MSPA 1QX7A 3TUYC 3VRQA 1JUOA 1Y6WA 2L4IA 1CKKA 1SCMB 3VGOA 1OMRA 1YVLA 2L0PA 1KK8C 1H4BA 3PM2A 2WCEA 4GPLB 3BOWA 2K7BA 2QEHA 1AUIB 3R1VA 2KFFA 2PQLA 2MJWB 2RGIA 2QPTA 1K9UA 3D10A 5AANA 2MHHA 1C7WA 3CZ0A 3CWGA 2K2AA 1TIZA 2QDIA 1ODBA 3D75A 1K9PA 3TDZA 1U5IB 2M0RA 4UPGA 3DVEA 3JTDB 3KPXA 3QRXA 4C0LA 1YVHA 2M1KB 2LMUA 4JPZB 1CFDA 4MBEA 4AQJA 5I2QA 1CDPA 5JJGA 4MLWA 2WCBA 1TNWA 1NCZA 1V1GA 3OP0A 5KU1A 1IGVA 2FCDA 3S0GA 4USLA 3AAKA 1DTLA 4PHNA 2KLEA 3CZ1A 3CGAA 4PHJA 3EVVA 1TNQA 1UURA 3DXLA 2L2EA 3FE6A 2LVIA 3VRPA 3SG2A 3CS1A 1NUBA 3AAJA 1SCMC 4M2OA 1UHHA 1SPYA 1SY9A 1SW8A 2ZRTA 2AAOA 4XJKB 1OOHA 5FI2A 4HSZA 2JULA 3S0DA 1EG4A 2BCXA 3SS3A 1ZACA 1MXEA 1SKTA 2KBMA 3B86A 4FQTA 3ZWHA 1FF1A 1DJYA 3I5FB 3LL8B 1PULA 2WOSA 1QV1A 2HETA 4N5XA 2JC2A 2NLNA 1F4OA 3EVUA 1YUTA 5KSZA 1OE9B 3NHIA 1LVCD 1CM4A 4I5JA 2JT8A 2JXLA 3PJIA 2CXJA 1PALA 1WLZA 2WC8A 3SJSA 4YGCB 3VB1A 2EC6B 1UUSA 2F3YA 2B1UA 3GK4X 1B47A 1ALWA 3DF0A 3JTDC 3FS7A 4MN0A 3L47A 4QJ4B 1QXPA 2NZ0A 4ZCUA 2QEBA 2QACA 2K7CA 1DJIA 5G08A 3PSRA 1K9KA 1K94A 1U5IA 2F3ZA 1BR4B 1LKJA 3QMEA 2AUCA 1MHOA 3B87A 1NCXA 1MUXA 2LVJA 3ICBA 4I5NB 1KWOC 4N1GA 1J55A 3TDIA 2KI4B 2WORA 1FPWA 1ALVA 2DOQA 1DMOA 2LMVA 4PE4A 4MZKA 3A8RA 1OMDA 2ZNDA 1QS7A 2JRFA 2OPOA 3CR4X 3OX6A 5HKZA 1J1DA 1OOJA 4WQ2A 3I5FC 1QJTA 4BY4A 1G8IA 2K8MB 2QEVA 2KI6D 1SBJA 3CDNA 1UHJA 5CPVA 2H61C 2MLEC 3CYZA 2KYFA 5D69A 2GTEA 5D7FA 3FE9A 3NSOA 1PRWA 3BFBA 2PSRA 4ORCB 4XJKA 2EC6C 2M9GA 4FQOA 4GUKA 5DKNA 2GV5A 1KK8B 1UHIA 4N1FA 2R2IA 1OSAA 4JWQA 2M49B 3GK1A 1CMFA 2LUCA 1SL7A 4QJ5B 1B8CA 3CTNA 4M2QA 2CBLA 1J7OA 2KLDA 1HQVA 3BUWB 1ZMZA 1TOPA 2PRUA 1M45A 5FYXA 2I7AA 2M3WA 4L9MA 4A4CA 1K96A 2F8PA 2KOTA 4E68A 4JD9A 2KI4C 1N65A 2CCMA 2LNKA 1BR1B 4TNCA 2Y4QA 4PE1A 4ORBB 1JWDA 2L51A 3BUXB 3KO0A 1KCYA 3SG3A 2JWWA 1DEKA 5ER4X 1YX7A 1B8LA 1XVJA 1ORGA 1K95A 2BL0B 1MR8A 1NCYA 1TNPA 1VRKA 2LVKA 2KDHA 4AOMA 4YGAA 1CLLA 1DQEA 2ISDA 1D1OA 2PVBA 1CM1A 1RFJA 1CFPA 1DJWA 1OQPA 5D3OA 1S6CA 1YTZC 2OTGB 3B6XA 5F6TA 2Y5IA 2M1UA 3BYAA 1GGZA 2M7LA 1M31A 2I2RE 1KSMA 1R2UA 4YI9A 2NXQA 4JQ0D 3S0AA 3NGVA 1CNPA 1XO5A 5HKWA 1AVSA 2WCLA 4MRYA 4AQIA 1OOFA 3B88A 1W9ZA 4JKTA 5FI6A 2TN4A 1XK4A 3DF0B 1QLSA 2M8UA 2MA2A 5CSNA 1RROA 4OR9B 4P2YB 1YUUA 1E8AA 2O5GA 2M7NA 2M29A 2JQ6A 3UO9A 2E30A 2H2KA 1EL4A 2NCOA 1CDNA 4OZDA 1J7RA 3K21A 3FIAA 1QATA 4NQGA 3BQ3A 3O78A 1QX5B 2OS8B 4PDZA 1S1EA 1DGUA 1Y0VH 5I94A 3SIAA 3BJHA 1CFFA 1TUZA 3BFHA 4F7FA 3KHEA 3EK7A 2BL0C 1K93D 2L5XB 1M39A 2VRGA 3JVTB 1A75A 1GQMA 1XYDA 1M46A 1UHKA 2JT3A 2K61A 3DVJA 1OZOA 3BXKA 1JBAA 1Y1AA 4DS7A 3EKJA 2OTGC 1Z4HA 2F33A 2FJYA 1KWOB 1B1GA 1AJ5A 1IRJA 5PALA 1QIWA 1RTP1 4PE0A 4C0JA 1IQ5A 1NX1A 2LLTA 3BUNB 2JOJA 2BECA 1IKUA 5I8NA 3PN7B 1QVIZ 3DVKA 1CLBA 4WQ3A 2CTNA 1K8UA 3L4LA 3CR5X 3A4UB 1G4YR 1BODA 1AHRA 3WHTB 3LCPC 3O2PA 1CB1A 4Q04A 3TS5C 3DD4A 3H4SE 1LINA 4CLNA 1JF2A 1XFRA 3D77A 1CFCA 1DJXA 2FCEA 2OS8C 3TZ1A 5JOLA 2JTTA 5I2OA 1JF0A 4HRGA 2G2BA 2GGMA 1LXFC 3NSIA 2WNDA 1QWVA 3CZTX 3O4XA 3S0BA 2LUXA 3RZSA 2AMIA 1SMGA 1TRFA 2Q4UA 1CDMA 2JNXA 1Y1UA 3OHMB 3JVTC 2LCPA 1PVBA 2FOTA 1S5GY 1LS8A 4M2PA 3SG4A 5IBWA 4YGEB 2LC5A 4YBHB 1S3PA 3NXAA 2KAYA 1IH0A 4DIRA 4GNKB 2CNPA 1W7JB 1L7ZA 1ZFSA 3TDUA 2LP3A 2V53A 3PN7C 1Z2CB 3O6BA 3LLEA 1NPQA 2L98A 1DC1A 2Y1NA 2I18A 1IWQA 4GGFC 2L4HA 1FW4A 1M63B 1NX2A 1C3YA 1SSEB 4QJ3B 3CABA 1SYMA 3HX4A 1WRKA 3KF9A 5DKRA 1DVIA 1ZUZA 1BMOA 1B4CA 1B7TY 1BJFA 1WRZA 2QEOA 5AXIA 3SS4A 1Y1XA 3CR2A 1WY9A 2BBMA 4GGFA 2KAVA 2LP2A 1MXLC 2MRDA 1IQ3A 1JC2A 2MLFC 4CPVA 3D0YA 1WDCB 3OBVA 1RWYA 3IQQA 2LHLA 4ORAB 2KHNA 3SG5A 4CFRA 2BKHB 5TNCA 2KNEA 2ZNEA 3K1EA 3NSLA 4NDBA 5K89A 2JPOA 1NYAA 2LMTA 2LANA 1CDLA 3CZ2A 1PVAA 4ZCVA 2KYCA 4GGNA 1S26D 4HREE 3OB2B 1K2HA 1A75B 3V2LA 5HYDA 3SS5A 2SASA 3I5IB 1KK7Z 2YGUA 4GAOA 1BT6A 1MWNA 4FTGA 5ER5A 2M97A 3I5HB 3KEVA 3IF7A 2KFGA 1OOIX 1XFZO 2KBIA 3PLFB 1KQVA 2LE9B 2MBXA 1S6JA 2Q91A 2SCPA 1N2DA 2BAPA 5EL2A 2ZN9A 1XK4C 2JPTA 3MSEB 2P71A 2WCMA 2CT9A 3EVRA 3VRNA 1KQMC 2WC6A 2MAZA 3AKAA 2PALA 3SIBA 1A2XA 3EG5B 1Q80A 2BE6A 2HF5A 3S0FA 2H8VA 1IG5A 1SR6B 1C07A 3SG7A 1OZSA 1RK9A 1WDCC 2ZKMX 3WXAA 3GOFA 4PHKA 1DELA 1K90D 3WHUB 1YRUB 1SRAA 4ETOA 2BBNA 3D73A 5B8IB 2HQ8A 1UHNA 1NWDA 3EKHA 1AJ4A 1C3ZA 1J7QA 1XFVO 3TS5B 3PATA 4YI8A 5AEQA 1F4QA 1FI6A 1S36A 3I5IC 1MF8B 1DF0A 2LVVA 3B7AA 1QVIY 2E6WA 3LK1A 1PSBA 3IVTA 2K7DA 3S0EA 1B8RA 3F45A 2WC5A 4OV2A 1OMVA 1CMGA 3I5HC 3M0WA 5CSJA 3BUOB 4NDCA 3ZNIA 1F70A 4CFQA 2O60A 1TTXA 3EK4A 1XFUO 3R1OA 1NX0A 1XFXO 4BY5A 2GGZA 2LLSA 4KYNA 1IJ5A 4PHMA 5DKQA 1JSAA 2ZRSA 2WCFA 1SL8A 4PT1A 3OB1B 1JFKA 4IJ7A 4WRIA 1BG1A 1QTXA 2A4JA 3O4YA 1YX8A 3D78A 5J3XA 2KFHA 1SR6C 4DRWA 3PFVA 2P6BB 3PALA 1FI5A 3DY9A 3I5GB 2LM5A 4D1EA 2Y1MA 1TCOB 1IJ6A 1A03A 1TWOA 1A4PA 1TN4A 1TNXA 2WCHA 5CSFA 1DT7B 2JZIA 1RJVA 1SCVA 1L2OB 2WCKA 3D0YB 4P5OE 1SK6D 2JTZA 1PK0D 1J1EA 1KFXL 2LV7A 5FI7A 3NHTA 4R1EA 2BE4A 5HLOA 2L2CA 1T14A 1F54A 3FE8A 4GFTA 1BLQA 1AK8A 2EHBA 1CLMA 2KQYA 4DUQA 4DCKA 4HRHA 4F0ZB 3L4AA 3OX5A 2BCBA 1XFWO 2L5YA 1OOGA 2JNFA 4YGDB 2K7OA 2LAPA 4YGBB 1NX3A 2L50A 1KFXS 3Q8IA 4OCIA 2IS9A 1RECA 1JFJA 4INXA 4CIDA 2K2FA 3CLNA 2ZFDA 1NP8A 1YUSA 1EH2A 3IQOA 1HT9A 2KI6C 3GK2A 5HL1A 3NSKA 1XA5A 1LA3A 1A29A 1N0YA 4U8DA 3WNXB 1J7PA 3AKBA 3I5GC 4INWA 3RLZA 1FBVA 3C1VA 2G9BA 5HLVA 3DYEA 1CTRA 1L2OC 2K0JA 3N7HA 5DICA 1IIOA 1KK7Y 3UNWA 1QX2A 2PASA 5BPJA 1WLMA 1PSRA 3E3RA 3EK8A 2HPSA 1S6IA 5GQQC 1KQMB 2JXCA 2PYQA 4YRUA 4PE7A 2COLB 2FJUB 2KAXA 3DVMA 1G33A 4OKHA 1YRTB 2KPHA 1DF0B 3VROA 4MVFA 3SG6A 3DZTA 2BNXA 4PALA 3VRRA 1BU3A 2P70A 2PMYA 3FWCA 3OGNA 1P28A 5I2LA 1X02A 3RM1A 1SL9A 1F55A 4PCWA 4C0KA 2HQWA 1TCFA 1EXRA 5KTYA 1V1FA 1DJZA 3BOWB 2F2PA 2BCAA 3D76A 1SNLA 2EGDA 3BUMB 1F8HA 1YURA 1DJHA 4ICBA 4MEWA 1WRLA 1S5GZ 3TUYB 1R6PA 1UWOA 1OW4A 1NIWA 1XFYO 2BKIB 2KSPA 1GJYA 5HKYA 4NDDA 1BF5A 1KSOA 1W7IB 3R72A 1ZOTB 3HCMA 4MRXA 1KFUL 2H61A 1AP4A
chains in the Genus database with same CATH topology
1BOCA 1NSHA 4MZJA 2ZN8A 4GBAA 1F71A 1DJGA 5CSIA 2NCPA 3LK0A 1EJ3A 3FWBA 1EG3A 4I5KA 4XYNA 1YR5A 3PM8A 1C7VA 2KGRA 4MZLA 1B9AA 2D8NA 1QIVA 1DGVA 2F2OA 2KQ6A 5AERA 1KFUS 1H8BA 1B7TZ 5AFPA 2KGBC 1QV0A 1QLKA 1UP5A 2LHIA 4A4BA 4OVNF 2JU0A 2LLUA 2I94A 4IL1A 1GGWA 1QASA 1MQ1A 2JT0A 1LA0A 4I5LB 4MSPA 1QX7A 3TUYC 3VRQA 1JUOA 1Y6WA 2L4IA 1CKKA 1SCMB 3VGOA 1OMRA 1YVLA 2L0PA 1KK8C 1H4BA 2WCEA 4GPLB 3BOWA 2K7BA 1AUIB 2KFFA 2MJWB 2RGIA 2QPTA 1K9UA 3D10A 5AANA 2MHHA 1C7WA 3CWGA 2K2AA 1TIZA 1ODBA 1K9PA 3TDZA 1U5IB 2M0RA 4UPGA 3DVEA 3JTDB 3KPXA 3QRXA 4C0LA 1YVHA 2M1KB 2LMUA 4JPZB 1CFDA 4MBEA 4AQJA 5I2QA 1CDPA 5JJGA 4MLWA 2WCBA 1TNWA 1NCZA 1V1GA 3OP0A 5KU1A 1IGVA 2FCDA 4USLA 3AAKA 1DTLA 4PHNA 3CGAA 4PHJA 3EVVA 1TNQA 1UURA 2L2EA 2LVIA 3VRPA 3SG2A 3CS1A 1NUBA 3AAJA 1SCMC 4M2OA 1UHHA 1SPYA 1SY9A 1SW8A 2ZRTA 2AAOA 4XJKB 4HSZA 2JULA 1EG4A 2BCXA 1ZACA 1MXEA 1SKTA 2KBMA 3ZWHA 1FF1A 1DJYA 3I5FB 3LL8B 1PULA 2WOSA 1QV1A 2HETA 4N5XA 2JC2A 2NLNA 1F4OA 3EVUA 1YUTA 5KSZA 1OE9B 1LVCD 1CM4A 4I5JA 2JT8A 2JXLA 2CXJA 1PALA 1WLZA 2WC8A 3SJSA 4YGCB 2EC6B 1UUSA 2F3YA 2B1UA 3GK4X 1B47A 1ALWA 3DF0A 3JTDC 3FS7A 4MN0A 4QJ4B 1QXPA 2NZ0A 4ZCUA 2QACA 2K7CA 1DJIA 5G08A 3PSRA 1K9KA 1K94A 1U5IA 2F3ZA 1BR4B 1LKJA 2AUCA 1MHOA 3ICBA 1NCXA 1MUXA 2LVJA 4I5NB 1KWOC 4N1GA 1J55A 3TDIA 2KI4B 2WORA 1FPWA 1ALVA 2DOQA 1DMOA 2LMVA 4PE4A 4MZKA 3A8RA 1OMDA 2ZNDA 1QS7A 2JRFA 2OPOA 3CR4X 3OX6A 5HKZA 1J1DA 1OOJA 4WQ2A 3I5FC 1QJTA 4BY4A 1G8IA 2K8MB 2KI6D 1SBJA 1UHJA 5CPVA 2H61C 2MLEC 2KYFA 5D69A 5D7FA 3NSOA 4XJKA 1PRWA 4ORCB 2PSRA 2EC6C 2M9GA 4FQOA 4GUKA 5DKNA 2GV5A 1KK8B 1UHIA 4N1FA 2R2IA 1OSAA 4JWQA 2M49B 3GK1A 1CMFA 2LUCA 1SL7A 4QJ5B 1B8CA 3CTNA 4M2QA 2CBLA 1J7OA 1HQVA 3BUWB 1ZMZA 1TOPA 2PRUA 1M45A 5FYXA 2I7AA 2M3WA 4L9MA 4A4CA 1K96A 2F8PA 2KOTA 4E68A 2KI4C 1N65A 2CCMA 2LNKA 1BR1B 4TNCA 2Y4QA 4PE1A 4ORBB 1JWDA 2L51A 3BUXB 3KO0A 1KCYA 3SG3A 2JWWA 5ER4X 1YX7A 1B8LA 1XVJA 1K95A 2BL0B 1MR8A 1NCYA 1TNPA 1VRKA 2LVKA 2KDHA 4AOMA 4YGAA 1CLLA 2ISDA 1D1OA 2PVBA 1CM1A 1RFJA 1CFPA 1DJWA 1OQPA 1S6CA 1YTZC 2OTGB 5F6TA 2Y5IA 2M1UA 3BYAA 1GGZA 2M7LA 1M31A 2I2RE 1KSMA 1R2UA 4YI9A 2NXQA 4JQ0D 1CNPA 1XO5A 5HKWA 1AVSA 4MRYA 4AQIA 2TN4A 1XK4A 3DF0B 1QLSA 2M8UA 2MA2A 5CSNA 1RROA 4OR9B 4P2YB 1YUUA 1E8AA 2O5GA 2M7NA 2M29A 2JQ6A 2E30A 2H2KA 1EL4A 2NCOA 1CDNA 1J7RA 3K21A 3FIAA 1QATA 4NQGA 3BQ3A 3O78A 1QX5B 2OS8B 4PDZA 1S1EA 1DGUA 1Y0VH 3SIAA 1CFFA 3KHEA 3EK7A 2BL0C 1K93D 2L5XB 1M39A 2VRGA 3JVTB 1A75A 1GQMA 1XYDA 1M46A 1UHKA 2JT3A 2K61A 3DVJA 1OZOA 3BXKA 1JBAA 1Y1AA 4DS7A 3EKJA 2OTGC 2F33A 1KWOB 1B1GA 1AJ5A 1IRJA 5PALA 1QIWA 1RTP1 4PE0A 4C0JA 1IQ5A 1NX1A 2LLTA 3BUNB 2JOJA 2BECA 1IKUA 5I8NA 3PN7B 1QVIZ 3DVKA 1CLBA 4WQ3A 2CTNA 1K8UA 3CR5X 3A4UB 1G4YR 1BODA 1AHRA 3WHTB 3LCPC 3O2PA 1CB1A 4Q04A 3TS5C 3DD4A 3H4SE 1LINA 4CLNA 1JF2A 1CFCA 1DJXA 2FCEA 2OS8C 3TZ1A 5JOLA 2JTTA 5I2OA 1JF0A 4HRGA 2G2BA 2GGMA 1LXFC 3NSIA 2WNDA 3CZTX 2LUXA 2AMIA 1SMGA 1TRFA 2Q4UA 1CDMA 2JNXA 1Y1UA 3OHMB 3JVTC 2LCPA 1PVBA 2FOTA 1S5GY 4M2PA 3SG4A 5IBWA 4YGEB 2LC5A 4YBHB 1S3PA 3NXAA 2KAYA 1IH0A 4DIRA 4GNKB 2CNPA 1W7JB 1L7ZA 1ZFSA 3TDUA 2LP3A 2V53A 3PN7C 3O6BA 3LLEA 1NPQA 2L98A 2Y1NA 2I18A 1IWQA 4GGFC 2L4HA 1FW4A 1M63B 1NX2A 4QJ3B 1SYMA 3HX4A 1WRKA 3KF9A 5DKRA 1DVIA 1ZUZA 1BMOA 1B4CA 1B7TY 1BJFA 1WRZA 5AXIA 1Y1XA 3CR2A 1WY9A 2BBMA 4GGFA 2KAVA 2LP2A 1MXLC 2MRDA 1IQ3A 1JC2A 2MLFC 4CPVA 3D0YA 1WDCB 1RWYA 3IQQA 2LHLA 4ORAB 2KHNA 3SG5A 4CFRA 2BKHB 5TNCA 2KNEA 2ZNEA 3NSLA 4NDBA 5K89A 1NYAA 2LMTA 2LANA 1CDLA 4ZCVA 1PVAA 2KYCA 4GGNA 1S26D 4HREE 3OB2B 1K2HA 1A75B 5HYDA 2SASA 3I5IB 1KK7Z 4GAOA 1BT6A 1MWNA 4FTGA 5ER5A 2M97A 3I5HB 3KEVA 3IF7A 2KFGA 1XFZO 2KBIA 3PLFB 1KQVA 2LE9B 2MBXA 1S6JA 2Q91A 2SCPA 1N2DA 2ZN9A 1XK4C 2JPTA 3MSEB 2CT9A 3EVRA 3VRNA 1KQMC 2MAZA 3AKAA 2PALA 3SIBA 1A2XA 1Q80A 2BE6A 2HF5A 1IG5A 1SR6B 1C07A 3SG7A 1OZSA 1RK9A 1WDCC 2ZKMX 3WXAA 3GOFA 4PHKA 1K90D 3WHUB 1YRUB 1SRAA 4ETOA 2BBNA 5B8IB 2HQ8A 1UHNA 1NWDA 3EKHA 1AJ4A 1J7QA 1XFVO 3TS5B 3PATA 4YI8A 5AEQA 1F4QA 1FI6A 1S36A 3I5IC 1MF8B 1DF0A 2LVVA 1QVIY 2E6WA 3LK1A 1PSBA 2K7DA 1B8RA 3F45A 4OV2A 1OMVA 1CMGA 3I5HC 3M0WA 5CSJA 3BUOB 4NDCA 3ZNIA 1F70A 4CFQA 2O60A 1TTXA 3EK4A 1XFUO 1NX0A 1XFXO 4BY5A 2GGZA 2LLSA 4PHMA 1IJ5A 5DKQA 1JSAA 2ZRSA 2WCFA 1SL8A 3OB1B 1JFKA 4WRIA 1BG1A 1QTXA 2A4JA 3O4YA 1YX8A 5J3XA 2KFHA 1SR6C 4DRWA 3PFVA 2P6BB 3PALA 1FI5A 3I5GB 2LM5A 4D1EA 2Y1MA 1TCOB 1IJ6A 1A03A 1A4PA 1TN4A 1TNXA 5CSFA 1DT7B 2JZIA 1RJVA 1SCVA 1L2OB 3D0YB 4P5OE 1SK6D 2JTZA 1PK0D 1J1EA 1KFXL 2LV7A 4R1EA 2BE4A 5HLOA 1F54A 4GFTA 1BLQA 1AK8A 2EHBA 1CLMA 2KQYA 4DUQA 4DCKA 4HRHA 4F0ZB 3OX5A 2BCBA 1XFWO 4YGDB 2JNFA 4YGBB 2K7OA 2LAPA 1NX3A 2L50A 1KFXS 4OCIA 2IS9A 1RECA 1JFJA 4CIDA 2K2FA 3CLNA 2ZFDA 1NP8A 1YUSA 1EH2A 3IQOA 1HT9A 2KI6C 3GK2A 3NSKA 1XA5A 1LA3A 1A29A 1N0YA 4U8DA 3WNXB 1J7PA 3AKBA 3I5GC 3RLZA 1FBVA 3C1VA 2G9BA 5HLVA 1CTRA 1L2OC 2K0JA 1KK7Y 1QX2A 2PASA 5BPJA 1WLMA 1PSRA 3E3RA 3EK8A 2HPSA 1S6IA 5GQQC 1KQMB 2JXCA 4YRUA 4PE7A 2COLB 2FJUB 2KAXA 3DVMA 1G33A 4OKHA 1YRTB 1DF0B 3VROA 4MVFA 3SG6A 4PALA 3VRRA 1BU3A 2PMYA 3FWCA 3RM1A 5I2LA 1X02A 1SL9A 1F55A 4PCWA 4C0KA 2HQWA 1TCFA 1EXRA 5KTYA 1V1FA 1DJZA 3BOWB 2F2PA 2BCAA 1SNLA 2EGDA 3BUMB 1F8HA 1YURA 1DJHA 4ICBA 4MEWA 1WRLA 1S5GZ 3TUYB 1R6PA 1UWOA 1NIWA 2KSPA 2BKIB 1XFYO 1GJYA 5HKYA 4NDDA 1BF5A 1KSOA 1W7IB 1ZOTB 3HCMA 4MRXA 1KFUL 2H61A 1AP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOC A;  1NSH A;  4MZJ A;  2ZN8 A;  4GBA A;  1F71 A;  1DJG A;  5CSI A;  2NCP A;  3LK0 A;  1EJ3 A;  3FWB A;  1EG3 A;  4I5K A;  4XYN A;  1YR5 A;  3PM8 A;  1C7V A;  2KGR A;  4MZL A;  1B9A A;  2D8N A;  1QIV A;  1DGV A;  2F2O A;  2KQ6 A;  5AER A;  1KFU S;  1H8B A;  1B7T Z;  5AFP A;  2KGB C;  1QV0 A;  1QLK A;  1UP5 A;  2LHI A;  4A4B A;  4OVN F;  2JU0 A;  2LLU A;  2I94 A;  4IL1 A;  1GGW A;  1QAS A;  1MQ1 A;  2JT0 A;  1LA0 A;  4I5L B;  4MSP A;  1QX7 A;  3TUY C;  3VRQ A;  1JUO A;  1Y6W A;  2L4I A;  1CKK A;  1SCM B;  3VGO A;  1OMR A;  1YVL A;  2L0P A;  1KK8 C;  1H4B A;  2WCE A;  4GPL B;  3BOW A;  2K7B A;  1AUI B;  2KFF A;  2MJW B;  2RGI A;  2QPT A;  1K9U A;  3D10 A;  5AAN A;  2MHH A;  1C7W A;  3CWG A;  2K2A A;  1TIZ A;  1ODB A;  1K9P A;  3TDZ A;  1U5I B;  2M0R A;  4UPG A;  3DVE A;  3JTD B;  3KPX A;  3QRX A;  4C0L A;  1YVH A;  2M1K B;  2LMU A;  4JPZ B;  1CFD A;  4MBE A;  4AQJ A;  5I2Q A;  1CDP A;  5JJG A;  4MLW A;  2WCB A;  1TNW A;  1NCZ A;  1V1G A;  3OP0 A;  5KU1 A;  1IGV A;  2FCD A;  4USL A;  3AAK A;  1DTL A;  4PHN A;  3CGA A;  4PHJ A;  3EVV A;  1TNQ A;  1UUR A;  2L2E A;  2LVI A;  3VRP A;  3SG2 A;  3CS1 A;  1NUB A;  3AAJ A;  1SCM C;  4M2O A;  1UHH A;  1SPY A;  1SY9 A;  1SW8 A;  2ZRT A;  2AAO A;  4XJK B;  4HSZ A;  2JUL A;  1EG4 A;  2BCX A;  1ZAC A;  1MXE A;  1SKT A;  2KBM A;  3ZWH A;  1FF1 A;  1DJY A;  3I5F B;  3LL8 B;  1PUL A;  2WOS A;  1QV1 A;  2HET A;  4N5X A;  2JC2 A;  2NLN A;  1F4O A;  3EVU A;  1YUT A;  5KSZ A;  1OE9 B;  1LVC D;  1CM4 A;  4I5J A;  2JT8 A;  2JXL A;  2CXJ A;  1PAL A;  1WLZ A;  2WC8 A;  3SJS A;  4YGC B;  2EC6 B;  1UUS A;  2F3Y A;  2B1U A;  3GK4 X;  1B47 A;  1ALW A;  3DF0 A;  3JTD C;  3FS7 A;  4MN0 A;  4QJ4 B;  1QXP A;  2NZ0 A;  4ZCU A;  2QAC A;  2K7C A;  1DJI A;  5G08 A;  3PSR A;  1K9K A;  1K94 A;  1U5I A;  2F3Z A;  1BR4 B;  1LKJ A;  2AUC A;  1MHO A;  3ICB A;  1NCX A;  1MUX A;  2LVJ A;  4I5N B;  1KWO C;  4N1G A;  1J55 A;  3TDI A;  2KI4 B;  2WOR A;  1FPW A;  1ALV A;  2DOQ A;  1DMO A;  2LMV A;  4PE4 A;  4MZK A;  3A8R A;  1OMD A;  2ZND A;  1QS7 A;  2JRF A;  2OPO A;  3CR4 X;  3OX6 A;  5HKZ A;  1J1D A;  1OOJ A;  4WQ2 A;  3I5F C;  1QJT A;  4BY4 A;  1G8I A;  2K8M B;  2KI6 D;  1SBJ A;  1UHJ A;  5CPV A;  2H61 C;  2MLE C;  2KYF A;  5D69 A;  5D7F A;  3NSO A;  4XJK A;  1PRW A;  4ORC B;  2PSR A;  2EC6 C;  2M9G A;  4FQO A;  4GUK A;  5DKN A;  2GV5 A;  1KK8 B;  1UHI A;  4N1F A;  2R2I A;  1OSA A;  4JWQ A;  2M49 B;  3GK1 A;  1CMF A;  2LUC A;  1SL7 A;  4QJ5 B;  1B8C A;  3CTN A;  4M2Q A;  2CBL A;  1J7O A;  1HQV A;  3BUW B;  1ZMZ A;  1TOP A;  2PRU A;  1M45 A;  5FYX A;  2I7A A;  2M3W A;  4L9M A;  4A4C A;  1K96 A;  2F8P A;  2KOT A;  4E68 A;  2KI4 C;  1N65 A;  2CCM A;  2LNK A;  1BR1 B;  4TNC A;  2Y4Q A;  4PE1 A;  4ORB B;  1JWD A;  2L51 A;  3BUX B;  3KO0 A;  1KCY A;  3SG3 A;  2JWW A;  5ER4 X;  1YX7 A;  1B8L A;  1XVJ A;  1K95 A;  2BL0 B;  1MR8 A;  1NCY A;  1TNP A;  1VRK A;  2LVK A;  2KDH A;  4AOM A;  4YGA A;  1CLL A;  2ISD A;  1D1O A;  2PVB A;  1CM1 A;  1RFJ A;  1CFP A;  1DJW A;  1OQP A;  1S6C A;  1YTZ C;  2OTG B;  5F6T A;  2Y5I A;  2M1U A;  3BYA A;  1GGZ A;  2M7L A;  1M31 A;  2I2R E;  1KSM A;  1R2U A;  4YI9 A;  2NXQ A;  4JQ0 D;  1CNP A;  1XO5 A;  5HKW A;  1AVS A;  4MRY A;  4AQI A;  2TN4 A;  1XK4 A;  3DF0 B;  1QLS A;  2M8U A;  2MA2 A;  5CSN A;  1RRO A;  4OR9 B;  4P2Y B;  1YUU A;  1E8A A;  2O5G A;  2M7N A;  2M29 A;  2JQ6 A;  2E30 A;  2H2K A;  1EL4 A;  2NCO A;  1CDN A;  1J7R A;  3K21 A;  3FIA A;  1QAT A;  4NQG A;  3BQ3 A;  3O78 A;  1QX5 B;  2OS8 B;  4PDZ A;  1S1E A;  1DGU A;  1Y0V H;  3SIA A;  1CFF A;  3KHE A;  3EK7 A;  2BL0 C;  1K93 D;  2L5X B;  1M39 A;  2VRG A;  3JVT B;  1A75 A;  1GQM A;  1XYD A;  1M46 A;  1UHK A;  2JT3 A;  2K61 A;  3DVJ A;  1OZO A;  3BXK A;  1JBA A;  1Y1A A;  4DS7 A;  3EKJ A;  2OTG C;  2F33 A;  1KWO B;  1B1G A;  1AJ5 A;  1IRJ A;  5PAL A;  1QIW A;  1RTP 1;  4PE0 A;  4C0J A;  1IQ5 A;  1NX1 A;  2LLT A;  3BUN B;  2JOJ A;  2BEC A;  1IKU A;  5I8N A;  3PN7 B;  1QVI Z;  3DVK A;  1CLB A;  4WQ3 A;  2CTN A;  1K8U A;  3CR5 X;  3A4U B;  1G4Y R;  1BOD A;  1AHR A;  3WHT B;  3LCP C;  3O2P A;  1CB1 A;  4Q04 A;  3TS5 C;  3DD4 A;  3H4S E;  1LIN A;  4CLN A;  1JF2 A;  1CFC A;  1DJX A;  2FCE A;  2OS8 C;  3TZ1 A;  5JOL A;  2JTT A;  5I2O A;  1JF0 A;  4HRG A;  2G2B A;  2GGM A;  1LXF C;  3NSI A;  2WND A;  3CZT X;  2LUX A;  2AMI A;  1SMG A;  1TRF A;  2Q4U A;  1CDM A;  2JNX A;  1Y1U A;  3OHM B;  3JVT C;  2LCP A;  1PVB A;  2FOT A;  1S5G Y;  4M2P A;  3SG4 A;  5IBW A;  4YGE B;  2LC5 A;  4YBH B;  1S3P A;  3NXA A;  2KAY A;  1IH0 A;  4DIR A;  4GNK B;  2CNP A;  1W7J B;  1L7Z A;  1ZFS A;  3TDU A;  2LP3 A;  2V53 A;  3PN7 C;  3O6B A;  3LLE A;  1NPQ A;  2L98 A;  2Y1N A;  2I18 A;  1IWQ A;  4GGF C;  2L4H A;  1FW4 A;  1M63 B;  1NX2 A;  4QJ3 B;  1SYM A;  3HX4 A;  1WRK A;  3KF9 A;  5DKR A;  1DVI A;  1ZUZ A;  1BMO A;  1B4C A;  1B7T Y;  1BJF A;  1WRZ A;  5AXI A;  1Y1X A;  3CR2 A;  1WY9 A;  2BBM A;  4GGF A;  2KAV A;  2LP2 A;  1MXL C;  2MRD A;  1IQ3 A;  1JC2 A;  2MLF C;  4CPV A;  3D0Y A;  1WDC B;  1RWY A;  3IQQ A;  2LHL A;  4ORA B;  2KHN A;  3SG5 A;  4CFR A;  2BKH B;  5TNC A;  2KNE A;  2ZNE A;  3NSL A;  4NDB A;  5K89 A;  1NYA A;  2LMT A;  2LAN A;  1CDL A;  4ZCV A;  1PVA A;  2KYC A;  4GGN A;  1S26 D;  4HRE E;  3OB2 B;  1K2H A;  1A75 B;  5HYD A;  2SAS A;  3I5I B;  1KK7 Z;  4GAO A;  1BT6 A;  1MWN A;  4FTG A;  5ER5 A;  2M97 A;  3I5H B;  3KEV A;  3IF7 A;  2KFG A;  1XFZ O;  2KBI A;  3PLF B;  1KQV A;  2LE9 B;  2MBX A;  1S6J A;  2Q91 A;  2SCP A;  1N2D A;  2ZN9 A;  1XK4 C;  2JPT A;  3MSE B;  2CT9 A;  3EVR A;  3VRN A;  1KQM C;  2MAZ A;  3AKA A;  2PAL A;  3SIB A;  1A2X A;  1Q80 A;  2BE6 A;  2HF5 A;  1IG5 A;  1SR6 B;  1C07 A;  3SG7 A;  1OZS A;  1RK9 A;  1WDC C;  2ZKM X;  3WXA A;  3GOF A;  4PHK A;  1K90 D;  3WHU B;  1YRU B;  1SRA A;  4ETO A;  2BBN A;  5B8I B;  2HQ8 A;  1UHN A;  1NWD A;  3EKH A;  1AJ4 A;  1J7Q A;  1XFV O;  3TS5 B;  3PAT A;  4YI8 A;  5AEQ A;  1F4Q A;  1FI6 A;  1S36 A;  3I5I C;  1MF8 B;  1DF0 A;  2LVV A;  1QVI Y;  2E6W A;  3LK1 A;  1PSB A;  2K7D A;  1B8R A;  3F45 A;  4OV2 A;  1OMV A;  1CMG A;  3I5H C;  3M0W A;  5CSJ A;  3BUO B;  4NDC A;  3ZNI A;  1F70 A;  4CFQ A;  2O60 A;  1TTX A;  3EK4 A;  1XFU O;  1NX0 A;  1XFX O;  4BY5 A;  2GGZ A;  2LLS A;  4PHM A;  1IJ5 A;  5DKQ A;  1JSA A;  2ZRS A;  2WCF A;  1SL8 A;  3OB1 B;  1JFK A;  4WRI A;  1BG1 A;  1QTX A;  2A4J A;  3O4Y A;  1YX8 A;  5J3X A;  2KFH A;  1SR6 C;  4DRW A;  3PFV A;  2P6B B;  3PAL A;  1FI5 A;  3I5G B;  2LM5 A;  4D1E A;  2Y1M A;  1TCO B;  1IJ6 A;  1A03 A;  1A4P A;  1TN4 A;  1TNX A;  5CSF A;  1DT7 B;  2JZI A;  1RJV A;  1SCV A;  1L2O B;  3D0Y B;  4P5O E;  1SK6 D;  2JTZ A;  1PK0 D;  1J1E A;  1KFX L;  2LV7 A;  4R1E A;  2BE4 A;  5HLO A;  1F54 A;  4GFT A;  1BLQ A;  1AK8 A;  2EHB A;  1CLM A;  2KQY A;  4DUQ A;  4DCK A;  4HRH A;  4F0Z B;  3OX5 A;  2BCB A;  1XFW O;  4YGD B;  2JNF A;  4YGB B;  2K7O A;  2LAP A;  1NX3 A;  2L50 A;  1KFX S;  4OCI A;  2IS9 A;  1REC A;  1JFJ A;  4CID A;  2K2F A;  3CLN A;  2ZFD A;  1NP8 A;  1YUS A;  1EH2 A;  3IQO A;  1HT9 A;  2KI6 C;  3GK2 A;  3NSK A;  1XA5 A;  1LA3 A;  1A29 A;  1N0Y A;  4U8D A;  3WNX B;  1J7P A;  3AKB A;  3I5G C;  3RLZ A;  1FBV A;  3C1V A;  2G9B A;  5HLV A;  1CTR A;  1L2O C;  2K0J A;  1KK7 Y;  1QX2 A;  2PAS A;  5BPJ A;  1WLM A;  1PSR A;  3E3R A;  3EK8 A;  2HPS A;  1S6I A;  5GQQ C;  1KQM B;  2JXC A;  4YRU A;  4PE7 A;  2COL B;  2FJU B;  2KAX A;  3DVM A;  1G33 A;  4OKH A;  1YRT B;  1DF0 B;  3VRO A;  4MVF A;  3SG6 A;  4PAL A;  3VRR A;  1BU3 A;  2PMY A;  3FWC A;  3RM1 A;  5I2L A;  1X02 A;  1SL9 A;  1F55 A;  4PCW A;  4C0K A;  2HQW A;  1TCF A;  1EXR A;  5KTY A;  1V1F A;  1DJZ A;  3BOW B;  2F2P A;  2BCA A;  1SNL A;  2EGD A;  3BUM B;  1F8H A;  1YUR A;  1DJH A;  4ICB A;  4MEW A;  1WRL A;  1S5G Z;  3TUY B;  1R6P A;  1UWO A;  1NIW A;  2KSP A;  2BKI B;  1XFY O;  1GJY A;  5HKY A;  4NDD A;  1BF5 A;  1KSO A;  1W7I B;  1ZOT B;  3HCM A;  4MRX A;  1KFU L;  2H61 A;  1AP4 A; 
#chains in the Genus database with same CATH topology
 1BOC A;  1NSH A;  4MZJ A;  2ZN8 A;  3R1P A;  2WCJ A;  1GM0 A;  4GBA A;  1F71 A;  2K60 A;  1DJG A;  5CSI A;  2NCP A;  3LK0 A;  1EJ3 A;  3BFA A;  3FWB A;  1EG3 A;  4I5K A;  4XYN A;  1YR5 A;  3PM8 A;  1C7V A;  2KGR A;  4MZL A;  1B9A A;  2D8N A;  1QIV A;  1DGV A;  2F2O A;  2KQ6 A;  5AER A;  1KFU S;  1H8B A;  1B7T Z;  5AFP A;  2KGB C;  1QV0 A;  1TUJ A;  1QLK A;  1UP5 A;  2LHI A;  4A4B A;  4OVN F;  2ERB A;  2JU0 A;  2LLU A;  2I94 A;  3D74 A;  4IL1 A;  1GGW A;  1QAS A;  1MQ1 A;  2JT0 A;  1LA0 A;  4I5L B;  4MSP A;  1QX7 A;  3TUY C;  3VRQ A;  1JUO A;  1Y6W A;  2L4I A;  1CKK A;  1SCM B;  3VGO A;  1OMR A;  1YVL A;  2L0P A;  1KK8 C;  1H4B A;  3PM2 A;  2WCE A;  4GPL B;  3BOW A;  2K7B A;  2QEH A;  1AUI B;  3R1V A;  2KFF A;  2PQL A;  2MJW B;  2RGI A;  2QPT A;  1K9U A;  3D10 A;  5AAN A;  2MHH A;  1C7W A;  3CZ0 A;  3CWG A;  2K2A A;  1TIZ A;  2QDI A;  1ODB A;  3D75 A;  1K9P A;  3TDZ A;  1U5I B;  2M0R A;  4UPG A;  3DVE A;  3JTD B;  3KPX A;  3QRX A;  4C0L A;  1YVH A;  2M1K B;  2LMU A;  4JPZ B;  1CFD A;  4MBE A;  4AQJ A;  5I2Q A;  1CDP A;  5JJG A;  4MLW A;  2WCB A;  1TNW A;  1NCZ A;  1V1G A;  3OP0 A;  5KU1 A;  1IGV A;  2FCD A;  3S0G A;  4USL A;  3AAK A;  1DTL A;  4PHN A;  2KLE A;  3CZ1 A;  3CGA A;  4PHJ A;  3EVV A;  1TNQ A;  1UUR A;  3DXL A;  2L2E A;  3FE6 A;  2LVI A;  3VRP A;  3SG2 A;  3CS1 A;  1NUB A;  3AAJ A;  1SCM C;  4M2O A;  1UHH A;  1SPY A;  1SY9 A;  1SW8 A;  2ZRT A;  2AAO A;  4XJK B;  1OOH A;  5FI2 A;  4HSZ A;  2JUL A;  3S0D A;  1EG4 A;  2BCX A;  3SS3 A;  1ZAC A;  1MXE A;  1SKT A;  2KBM A;  3B86 A;  4FQT A;  3ZWH A;  1FF1 A;  1DJY A;  3I5F B;  3LL8 B;  1PUL A;  2WOS A;  1QV1 A;  2HET A;  4N5X A;  2JC2 A;  2NLN A;  1F4O A;  3EVU A;  1YUT A;  5KSZ A;  1OE9 B;  3NHI A;  1LVC D;  1CM4 A;  4I5J A;  2JT8 A;  2JXL A;  3PJI A;  2CXJ A;  1PAL A;  1WLZ A;  2WC8 A;  3SJS A;  4YGC B;  3VB1 A;  2EC6 B;  1UUS A;  2F3Y A;  2B1U A;  3GK4 X;  1B47 A;  1ALW A;  3DF0 A;  3JTD C;  3FS7 A;  4MN0 A;  3L47 A;  4QJ4 B;  1QXP A;  2NZ0 A;  4ZCU A;  2QEB A;  2QAC A;  2K7C A;  1DJI A;  5G08 A;  3PSR A;  1K9K A;  1K94 A;  1U5I A;  2F3Z A;  1BR4 B;  1LKJ A;  3QME A;  2AUC A;  1MHO A;  3B87 A;  1NCX A;  1MUX A;  2LVJ A;  3ICB A;  4I5N B;  1KWO C;  4N1G A;  1J55 A;  3TDI A;  2KI4 B;  2WOR A;  1FPW A;  1ALV A;  2DOQ A;  1DMO A;  2LMV A;  4PE4 A;  4MZK A;  3A8R A;  1OMD A;  2ZND A;  1QS7 A;  2JRF A;  2OPO A;  3CR4 X;  3OX6 A;  5HKZ A;  1J1D A;  1OOJ A;  4WQ2 A;  3I5F C;  1QJT A;  4BY4 A;  1G8I A;  2K8M B;  2QEV A;  2KI6 D;  1SBJ A;  3CDN A;  1UHJ A;  5CPV A;  2H61 C;  2MLE C;  3CYZ A;  2KYF A;  5D69 A;  2GTE A;  5D7F A;  3FE9 A;  3NSO A;  1PRW A;  3BFB A;  2PSR A;  4ORC B;  4XJK A;  2EC6 C;  2M9G A;  4FQO A;  4GUK A;  5DKN A;  2GV5 A;  1KK8 B;  1UHI A;  4N1F A;  2R2I A;  1OSA A;  4JWQ A;  2M49 B;  3GK1 A;  1CMF A;  2LUC A;  1SL7 A;  4QJ5 B;  1B8C A;  3CTN A;  4M2Q A;  2CBL A;  1J7O A;  2KLD A;  1HQV A;  3BUW B;  1ZMZ A;  1TOP A;  2PRU A;  1M45 A;  5FYX A;  2I7A A;  2M3W A;  4L9M A;  4A4C A;  1K96 A;  2F8P A;  2KOT A;  4E68 A;  4JD9 A;  2KI4 C;  1N65 A;  2CCM A;  2LNK A;  1BR1 B;  4TNC A;  2Y4Q A;  4PE1 A;  4ORB B;  1JWD A;  2L51 A;  3BUX B;  3KO0 A;  1KCY A;  3SG3 A;  2JWW A;  1DEK A;  5ER4 X;  1YX7 A;  1B8L A;  1XVJ A;  1ORG A;  1K95 A;  2BL0 B;  1MR8 A;  1NCY A;  1TNP A;  1VRK A;  2LVK A;  2KDH A;  4AOM A;  4YGA A;  1CLL A;  1DQE A;  2ISD A;  1D1O A;  2PVB A;  1CM1 A;  1RFJ A;  1CFP A;  1DJW A;  1OQP A;  5D3O A;  1S6C A;  1YTZ C;  2OTG B;  3B6X A;  5F6T A;  2Y5I A;  2M1U A;  3BYA A;  1GGZ A;  2M7L A;  1M31 A;  2I2R E;  1KSM A;  1R2U A;  4YI9 A;  2NXQ A;  4JQ0 D;  3S0A A;  3NGV A;  1CNP A;  1XO5 A;  5HKW A;  1AVS A;  2WCL A;  4MRY A;  4AQI A;  1OOF A;  3B88 A;  1W9Z A;  4JKT A;  5FI6 A;  2TN4 A;  1XK4 A;  3DF0 B;  1QLS A;  2M8U A;  2MA2 A;  5CSN A;  1RRO A;  4OR9 B;  4P2Y B;  1YUU A;  1E8A A;  2O5G A;  2M7N A;  2M29 A;  2JQ6 A;  3UO9 A;  2E30 A;  2H2K A;  1EL4 A;  2NCO A;  1CDN A;  4OZD A;  1J7R A;  3K21 A;  3FIA A;  1QAT A;  4NQG A;  3BQ3 A;  3O78 A;  1QX5 B;  2OS8 B;  4PDZ A;  1S1E A;  1DGU A;  1Y0V H;  5I94 A;  3SIA A;  3BJH A;  1CFF A;  1TUZ A;  3BFH A;  4F7F A;  3KHE A;  3EK7 A;  2BL0 C;  1K93 D;  2L5X B;  1M39 A;  2VRG A;  3JVT B;  1A75 A;  1GQM A;  1XYD A;  1M46 A;  1UHK A;  2JT3 A;  2K61 A;  3DVJ A;  1OZO A;  3BXK A;  1JBA A;  1Y1A A;  4DS7 A;  3EKJ A;  2OTG C;  1Z4H A;  2F33 A;  2FJY A;  1KWO B;  1B1G A;  1AJ5 A;  1IRJ A;  5PAL A;  1QIW A;  1RTP 1;  4PE0 A;  4C0J A;  1IQ5 A;  1NX1 A;  2LLT A;  3BUN B;  2JOJ A;  2BEC A;  1IKU A;  5I8N A;  3PN7 B;  1QVI Z;  3DVK A;  1CLB A;  4WQ3 A;  2CTN A;  1K8U A;  3L4L A;  3CR5 X;  3A4U B;  1G4Y R;  1BOD A;  1AHR A;  3WHT B;  3LCP C;  3O2P A;  1CB1 A;  4Q04 A;  3TS5 C;  3DD4 A;  3H4S E;  1LIN A;  4CLN A;  1JF2 A;  1XFR A;  3D77 A;  1CFC A;  1DJX A;  2FCE A;  2OS8 C;  3TZ1 A;  5JOL A;  2JTT A;  5I2O A;  1JF0 A;  4HRG A;  2G2B A;  2GGM A;  1LXF C;  3NSI A;  2WND A;  1QWV A;  3CZT X;  3O4X A;  3S0B A;  2LUX A;  3RZS A;  2AMI A;  1SMG A;  1TRF A;  2Q4U A;  1CDM A;  2JNX A;  1Y1U A;  3OHM B;  3JVT C;  2LCP A;  1PVB A;  2FOT A;  1S5G Y;  1LS8 A;  4M2P A;  3SG4 A;  5IBW A;  4YGE B;  2LC5 A;  4YBH B;  1S3P A;  3NXA A;  2KAY A;  1IH0 A;  4DIR A;  4GNK B;  2CNP A;  1W7J B;  1L7Z A;  1ZFS A;  3TDU A;  2LP3 A;  2V53 A;  3PN7 C;  1Z2C B;  3O6B A;  3LLE A;  1NPQ A;  2L98 A;  1DC1 A;  2Y1N A;  2I18 A;  1IWQ A;  4GGF C;  2L4H A;  1FW4 A;  1M63 B;  1NX2 A;  1C3Y A;  1SSE B;  4QJ3 B;  3CAB A;  1SYM A;  3HX4 A;  1WRK A;  3KF9 A;  5DKR A;  1DVI A;  1ZUZ A;  1BMO A;  1B4C A;  1B7T Y;  1BJF A;  1WRZ A;  2QEO A;  5AXI A;  3SS4 A;  1Y1X A;  3CR2 A;  1WY9 A;  2BBM A;  4GGF A;  2KAV A;  2LP2 A;  1MXL C;  2MRD A;  1IQ3 A;  1JC2 A;  2MLF C;  4CPV A;  3D0Y A;  1WDC B;  3OBV A;  1RWY A;  3IQQ A;  2LHL A;  4ORA B;  2KHN A;  3SG5 A;  4CFR A;  2BKH B;  5TNC A;  2KNE A;  2ZNE A;  3K1E A;  3NSL A;  4NDB A;  5K89 A;  2JPO A;  1NYA A;  2LMT A;  2LAN A;  1CDL A;  3CZ2 A;  1PVA A;  4ZCV A;  2KYC A;  4GGN A;  1S26 D;  4HRE E;  3OB2 B;  1K2H A;  1A75 B;  3V2L A;  5HYD A;  3SS5 A;  2SAS A;  3I5I B;  1KK7 Z;  2YGU A;  4GAO A;  1BT6 A;  1MWN A;  4FTG A;  5ER5 A;  2M97 A;  3I5H B;  3KEV A;  3IF7 A;  2KFG A;  1OOI X;  1XFZ O;  2KBI A;  3PLF B;  1KQV A;  2LE9 B;  2MBX A;  1S6J A;  2Q91 A;  2SCP A;  1N2D A;  2BAP A;  5EL2 A;  2ZN9 A;  1XK4 C;  2JPT A;  3MSE B;  2P71 A;  2WCM A;  2CT9 A;  3EVR A;  3VRN A;  1KQM C;  2WC6 A;  2MAZ A;  3AKA A;  2PAL A;  3SIB A;  1A2X A;  3EG5 B;  1Q80 A;  2BE6 A;  2HF5 A;  3S0F A;  2H8V A;  1IG5 A;  1SR6 B;  1C07 A;  3SG7 A;  1OZS A;  1RK9 A;  1WDC C;  2ZKM X;  3WXA A;  3GOF A;  4PHK A;  1DEL A;  1K90 D;  3WHU B;  1YRU B;  1SRA A;  4ETO A;  2BBN A;  3D73 A;  5B8I B;  2HQ8 A;  1UHN A;  1NWD A;  3EKH A;  1AJ4 A;  1C3Z A;  1J7Q A;  1XFV O;  3TS5 B;  3PAT A;  4YI8 A;  5AEQ A;  1F4Q A;  1FI6 A;  1S36 A;  3I5I C;  1MF8 B;  1DF0 A;  2LVV A;  3B7A A;  1QVI Y;  2E6W A;  3LK1 A;  1PSB A;  3IVT A;  2K7D A;  3S0E A;  1B8R A;  3F45 A;  2WC5 A;  4OV2 A;  1OMV A;  1CMG A;  3I5H C;  3M0W A;  5CSJ A;  3BUO B;  4NDC A;  3ZNI A;  1F70 A;  4CFQ A;  2O60 A;  1TTX A;  3EK4 A;  1XFU O;  3R1O A;  1NX0 A;  1XFX O;  4BY5 A;  2GGZ A;  2LLS A;  4KYN A;  1IJ5 A;  4PHM A;  5DKQ A;  1JSA A;  2ZRS A;  2WCF A;  1SL8 A;  4PT1 A;  3OB1 B;  1JFK A;  4IJ7 A;  4WRI A;  1BG1 A;  1QTX A;  2A4J A;  3O4Y A;  1YX8 A;  3D78 A;  5J3X A;  2KFH A;  1SR6 C;  4DRW A;  3PFV A;  2P6B B;  3PAL A;  1FI5 A;  3DY9 A;  3I5G B;  2LM5 A;  4D1E A;  2Y1M A;  1TCO B;  1IJ6 A;  1A03 A;  1TWO A;  1A4P A;  1TN4 A;  1TNX A;  2WCH A;  5CSF A;  1DT7 B;  2JZI A;  1RJV A;  1SCV A;  1L2O B;  2WCK A;  3D0Y B;  4P5O E;  1SK6 D;  2JTZ A;  1PK0 D;  1J1E A;  1KFX L;  2LV7 A;  5FI7 A;  3NHT A;  4R1E A;  2BE4 A;  5HLO A;  2L2C A;  1T14 A;  1F54 A;  3FE8 A;  4GFT A;  1BLQ A;  1AK8 A;  2EHB A;  1CLM A;  2KQY A;  4DUQ A;  4DCK A;  4HRH A;  4F0Z B;  3L4A A;  3OX5 A;  2BCB A;  1XFW O;  2L5Y A;  1OOG A;  2JNF A;  4YGD B;  2K7O A;  2LAP A;  4YGB B;  1NX3 A;  2L50 A;  1KFX S;  3Q8I A;  4OCI A;  2IS9 A;  1REC A;  1JFJ A;  4INX A;  4CID A;  2K2F A;  3CLN A;  2ZFD A;  1NP8 A;  1YUS A;  1EH2 A;  3IQO A;  1HT9 A;  2KI6 C;  3GK2 A;  5HL1 A;  3NSK A;  1XA5 A;  1LA3 A;  1A29 A;  1N0Y A;  4U8D A;  3WNX B;  1J7P A;  3AKB A;  3I5G C;  4INW A;  3RLZ A;  1FBV A;  3C1V A;  2G9B A;  5HLV A;  3DYE A;  1CTR A;  1L2O C;  2K0J A;  3N7H A;  5DIC A;  1IIO A;  1KK7 Y;  3UNW A;  1QX2 A;  2PAS A;  5BPJ A;  1WLM A;  1PSR A;  3E3R A;  3EK8 A;  2HPS A;  1S6I A;  5GQQ C;  1KQM B;  2JXC A;  2PYQ A;  4YRU A;  4PE7 A;  2COL B;  2FJU B;  2KAX A;  3DVM A;  1G33 A;  4OKH A;  1YRT B;  2KPH A;  1DF0 B;  3VRO A;  4MVF A;  3SG6 A;  3DZT A;  2BNX A;  4PAL A;  3VRR A;  1BU3 A;  2P70 A;  2PMY A;  3FWC A;  3OGN A;  1P28 A;  5I2L A;  1X02 A;  3RM1 A;  1SL9 A;  1F55 A;  4PCW A;  4C0K A;  2HQW A;  1TCF A;  1EXR A;  5KTY A;  1V1F A;  1DJZ A;  3BOW B;  2F2P A;  2BCA A;  3D76 A;  1SNL A;  2EGD A;  3BUM B;  1F8H A;  1YUR A;  1DJH A;  4ICB A;  4MEW A;  1WRL A;  1S5G Z;  3TUY B;  1R6P A;  1UWO A;  1OW4 A;  1NIW A;  1XFY O;  2BKI B;  2KSP A;  1GJY A;  5HKY A;  4NDD A;  1BF5 A;  1KSO A;  1W7I B;  3R72 A;  1ZOT B;  3HCM A;  4MRX A;  1KFU L;  2H61 A;  1AP4 A; 
#chains in the Genus database with same CATH homology
 1BOC A;  1NSH A;  4MZJ A;  2ZN8 A;  4GBA A;  1F71 A;  1DJG A;  5CSI A;  2NCP A;  3LK0 A;  1EJ3 A;  3FWB A;  1EG3 A;  4I5K A;  4XYN A;  1YR5 A;  3PM8 A;  1C7V A;  2KGR A;  4MZL A;  1B9A A;  2D8N A;  1QIV A;  1DGV A;  2F2O A;  2KQ6 A;  5AER A;  1KFU S;  1H8B A;  1B7T Z;  5AFP A;  2KGB C;  1QV0 A;  1QLK A;  1UP5 A;  2LHI A;  4A4B A;  4OVN F;  2JU0 A;  2LLU A;  2I94 A;  4IL1 A;  1GGW A;  1QAS A;  1MQ1 A;  2JT0 A;  1LA0 A;  4I5L B;  4MSP A;  1QX7 A;  3TUY C;  3VRQ A;  1JUO A;  1Y6W A;  2L4I A;  1CKK A;  1SCM B;  3VGO A;  1OMR A;  1YVL A;  2L0P A;  1KK8 C;  1H4B A;  2WCE A;  4GPL B;  3BOW A;  2K7B A;  1AUI B;  2KFF A;  2MJW B;  2RGI A;  2QPT A;  1K9U A;  3D10 A;  5AAN A;  2MHH A;  1C7W A;  3CWG A;  2K2A A;  1TIZ A;  1ODB A;  1K9P A;  3TDZ A;  1U5I B;  2M0R A;  4UPG A;  3DVE A;  3JTD B;  3KPX A;  3QRX A;  4C0L A;  1YVH A;  2M1K B;  2LMU A;  4JPZ B;  1CFD A;  4MBE A;  4AQJ A;  5I2Q A;  1CDP A;  5JJG A;  4MLW A;  2WCB A;  1TNW A;  1NCZ A;  1V1G A;  3OP0 A;  5KU1 A;  1IGV A;  2FCD A;  4USL A;  3AAK A;  1DTL A;  4PHN A;  3CGA A;  4PHJ A;  3EVV A;  1TNQ A;  1UUR A;  2L2E A;  2LVI A;  3VRP A;  3SG2 A;  3CS1 A;  1NUB A;  3AAJ A;  1SCM C;  4M2O A;  1UHH A;  1SPY A;  1SY9 A;  1SW8 A;  2ZRT A;  2AAO A;  4XJK B;  4HSZ A;  2JUL A;  1EG4 A;  2BCX A;  1ZAC A;  1MXE A;  1SKT A;  2KBM A;  3ZWH A;  1FF1 A;  1DJY A;  3I5F B;  3LL8 B;  1PUL A;  2WOS A;  1QV1 A;  2HET A;  4N5X A;  2JC2 A;  2NLN A;  1F4O A;  3EVU A;  1YUT A;  5KSZ A;  1OE9 B;  1LVC D;  1CM4 A;  4I5J A;  2JT8 A;  2JXL A;  2CXJ A;  1PAL A;  1WLZ A;  2WC8 A;  3SJS A;  4YGC B;  2EC6 B;  1UUS A;  2F3Y A;  2B1U A;  3GK4 X;  1B47 A;  1ALW A;  3DF0 A;  3JTD C;  3FS7 A;  4MN0 A;  4QJ4 B;  1QXP A;  2NZ0 A;  4ZCU A;  2QAC A;  2K7C A;  1DJI A;  5G08 A;  3PSR A;  1K9K A;  1K94 A;  1U5I A;  2F3Z A;  1BR4 B;  1LKJ A;  2AUC A;  1MHO A;  3ICB A;  1NCX A;  1MUX A;  2LVJ A;  4I5N B;  1KWO C;  4N1G A;  1J55 A;  3TDI A;  2KI4 B;  2WOR A;  1FPW A;  1ALV A;  2DOQ A;  1DMO A;  2LMV A;  4PE4 A;  4MZK A;  3A8R A;  1OMD A;  2ZND A;  1QS7 A;  2JRF A;  2OPO A;  3CR4 X;  3OX6 A;  5HKZ A;  1J1D A;  1OOJ A;  4WQ2 A;  3I5F C;  1QJT A;  4BY4 A;  1G8I A;  2K8M B;  2KI6 D;  1SBJ A;  1UHJ A;  5CPV A;  2H61 C;  2MLE C;  2KYF A;  5D69 A;  5D7F A;  3NSO A;  4XJK A;  1PRW A;  4ORC B;  2PSR A;  2EC6 C;  2M9G A;  4FQO A;  4GUK A;  5DKN A;  2GV5 A;  1KK8 B;  1UHI A;  4N1F A;  2R2I A;  1OSA A;  4JWQ A;  2M49 B;  3GK1 A;  1CMF A;  2LUC A;  1SL7 A;  4QJ5 B;  1B8C A;  3CTN A;  4M2Q A;  2CBL A;  1J7O A;  1HQV A;  3BUW B;  1ZMZ A;  1TOP A;  2PRU A;  1M45 A;  5FYX A;  2I7A A;  2M3W A;  4L9M A;  4A4C A;  1K96 A;  2F8P A;  2KOT A;  4E68 A;  2KI4 C;  1N65 A;  2CCM A;  2LNK A;  1BR1 B;  4TNC A;  2Y4Q A;  4PE1 A;  4ORB B;  1JWD A;  2L51 A;  3BUX B;  3KO0 A;  1KCY A;  3SG3 A;  2JWW A;  5ER4 X;  1YX7 A;  1B8L A;  1XVJ A;  1K95 A;  2BL0 B;  1MR8 A;  1NCY A;  1TNP A;  1VRK A;  2LVK A;  2KDH A;  4AOM A;  4YGA A;  1CLL A;  2ISD A;  1D1O A;  2PVB A;  1CM1 A;  1RFJ A;  1CFP A;  1DJW A;  1OQP A;  1S6C A;  1YTZ C;  2OTG B;  5F6T A;  2Y5I A;  2M1U A;  3BYA A;  1GGZ A;  2M7L A;  1M31 A;  2I2R E;  1KSM A;  1R2U A;  4YI9 A;  2NXQ A;  4JQ0 D;  1CNP A;  1XO5 A;  5HKW A;  1AVS A;  4MRY A;  4AQI A;  2TN4 A;  1XK4 A;  3DF0 B;  1QLS A;  2M8U A;  2MA2 A;  5CSN A;  1RRO A;  4OR9 B;  4P2Y B;  1YUU A;  1E8A A;  2O5G A;  2M7N A;  2M29 A;  2JQ6 A;  2E30 A;  2H2K A;  1EL4 A;  2NCO A;  1CDN A;  1J7R A;  3K21 A;  3FIA A;  1QAT A;  4NQG A;  3BQ3 A;  3O78 A;  1QX5 B;  2OS8 B;  4PDZ A;  1S1E A;  1DGU A;  1Y0V H;  3SIA A;  1CFF A;  3KHE A;  3EK7 A;  2BL0 C;  1K93 D;  2L5X B;  1M39 A;  2VRG A;  3JVT B;  1A75 A;  1GQM A;  1XYD A;  1M46 A;  1UHK A;  2JT3 A;  2K61 A;  3DVJ A;  1OZO A;  3BXK A;  1JBA A;  1Y1A A;  4DS7 A;  3EKJ A;  2OTG C;  2F33 A;  1KWO B;  1B1G A;  1AJ5 A;  1IRJ A;  5PAL A;  1QIW A;  1RTP 1;  4PE0 A;  4C0J A;  1IQ5 A;  1NX1 A;  2LLT A;  3BUN B;  2JOJ A;  2BEC A;  1IKU A;  5I8N A;  3PN7 B;  1QVI Z;  3DVK A;  1CLB A;  4WQ3 A;  2CTN A;  1K8U A;  3CR5 X;  3A4U B;  1G4Y R;  1BOD A;  1AHR A;  3WHT B;  3LCP C;  3O2P A;  1CB1 A;  4Q04 A;  3TS5 C;  3DD4 A;  3H4S E;  1LIN A;  4CLN A;  1JF2 A;  1CFC A;  1DJX A;  2FCE A;  2OS8 C;  3TZ1 A;  5JOL A;  2JTT A;  5I2O A;  1JF0 A;  4HRG A;  2G2B A;  2GGM A;  1LXF C;  3NSI A;  2WND A;  3CZT X;  2LUX A;  2AMI A;  1SMG A;  1TRF A;  2Q4U A;  1CDM A;  2JNX A;  1Y1U A;  3OHM B;  3JVT C;  2LCP A;  1PVB A;  2FOT A;  1S5G Y;  4M2P A;  3SG4 A;  5IBW A;  4YGE B;  2LC5 A;  4YBH B;  1S3P A;  3NXA A;  2KAY A;  1IH0 A;  4DIR A;  4GNK B;  2CNP A;  1W7J B;  1L7Z A;  1ZFS A;  3TDU A;  2LP3 A;  2V53 A;  3PN7 C;  3O6B A;  3LLE A;  1NPQ A;  2L98 A;  2Y1N A;  2I18 A;  1IWQ A;  4GGF C;  2L4H A;  1FW4 A;  1M63 B;  1NX2 A;  4QJ3 B;  1SYM A;  3HX4 A;  1WRK A;  3KF9 A;  5DKR A;  1DVI A;  1ZUZ A;  1BMO A;  1B4C A;  1B7T Y;  1BJF A;  1WRZ A;  5AXI A;  1Y1X A;  3CR2 A;  1WY9 A;  2BBM A;  4GGF A;  2KAV A;  2LP2 A;  1MXL C;  2MRD A;  1IQ3 A;  1JC2 A;  2MLF C;  4CPV A;  3D0Y A;  1WDC B;  1RWY A;  3IQQ A;  2LHL A;  4ORA B;  2KHN A;  3SG5 A;  4CFR A;  2BKH B;  5TNC A;  2KNE A;  2ZNE A;  3NSL A;  4NDB A;  5K89 A;  1NYA A;  2LMT A;  2LAN A;  1CDL A;  4ZCV A;  1PVA A;  2KYC A;  4GGN A;  1S26 D;  4HRE E;  3OB2 B;  1K2H A;  1A75 B;  5HYD A;  2SAS A;  3I5I B;  1KK7 Z;  4GAO A;  1BT6 A;  1MWN A;  4FTG A;  5ER5 A;  2M97 A;  3I5H B;  3KEV A;  3IF7 A;  2KFG A;  1XFZ O;  2KBI A;  3PLF B;  1KQV A;  2LE9 B;  2MBX A;  1S6J A;  2Q91 A;  2SCP A;  1N2D A;  2ZN9 A;  1XK4 C;  2JPT A;  3MSE B;  2CT9 A;  3EVR A;  3VRN A;  1KQM C;  2MAZ A;  3AKA A;  2PAL A;  3SIB A;  1A2X A;  1Q80 A;  2BE6 A;  2HF5 A;  1IG5 A;  1SR6 B;  1C07 A;  3SG7 A;  1OZS A;  1RK9 A;  1WDC C;  2ZKM X;  3WXA A;  3GOF A;  4PHK A;  1K90 D;  3WHU B;  1YRU B;  1SRA A;  4ETO A;  2BBN A;  5B8I B;  2HQ8 A;  1UHN A;  1NWD A;  3EKH A;  1AJ4 A;  1J7Q A;  1XFV O;  3TS5 B;  3PAT A;  4YI8 A;  5AEQ A;  1F4Q A;  1FI6 A;  1S36 A;  3I5I C;  1MF8 B;  1DF0 A;  2LVV A;  1QVI Y;  2E6W A;  3LK1 A;  1PSB A;  2K7D A;  1B8R A;  3F45 A;  4OV2 A;  1OMV A;  1CMG A;  3I5H C;  3M0W A;  5CSJ A;  3BUO B;  4NDC A;  3ZNI A;  1F70 A;  4CFQ A;  2O60 A;  1TTX A;  3EK4 A;  1XFU O;  1NX0 A;  1XFX O;  4BY5 A;  2GGZ A;  2LLS A;  4PHM A;  1IJ5 A;  5DKQ A;  1JSA A;  2ZRS A;  2WCF A;  1SL8 A;  3OB1 B;  1JFK A;  4WRI A;  1BG1 A;  1QTX A;  2A4J A;  3O4Y A;  1YX8 A;  5J3X A;  2KFH A;  1SR6 C;  4DRW A;  3PFV A;  2P6B B;  3PAL A;  1FI5 A;  3I5G B;  2LM5 A;  4D1E A;  2Y1M A;  1TCO B;  1IJ6 A;  1A03 A;  1A4P A;  1TN4 A;  1TNX A;  5CSF A;  1DT7 B;  2JZI A;  1RJV A;  1SCV A;  1L2O B;  3D0Y B;  4P5O E;  1SK6 D;  2JTZ A;  1PK0 D;  1J1E A;  1KFX L;  2LV7 A;  4R1E A;  2BE4 A;  5HLO A;  1F54 A;  4GFT A;  1BLQ A;  1AK8 A;  2EHB A;  1CLM A;  2KQY A;  4DUQ A;  4DCK A;  4HRH A;  4F0Z B;  3OX5 A;  2BCB A;  1XFW O;  4YGD B;  2JNF A;  4YGB B;  2K7O A;  2LAP A;  1NX3 A;  2L50 A;  1KFX S;  4OCI A;  2IS9 A;  1REC A;  1JFJ A;  4CID A;  2K2F A;  3CLN A;  2ZFD A;  1NP8 A;  1YUS A;  1EH2 A;  3IQO A;  1HT9 A;  2KI6 C;  3GK2 A;  3NSK A;  1XA5 A;  1LA3 A;  1A29 A;  1N0Y A;  4U8D A;  3WNX B;  1J7P A;  3AKB A;  3I5G C;  3RLZ A;  1FBV A;  3C1V A;  2G9B A;  5HLV A;  1CTR A;  1L2O C;  2K0J A;  1KK7 Y;  1QX2 A;  2PAS A;  5BPJ A;  1WLM A;  1PSR A;  3E3R A;  3EK8 A;  2HPS A;  1S6I A;  5GQQ C;  1KQM B;  2JXC A;  4YRU A;  4PE7 A;  2COL B;  2FJU B;  2KAX A;  3DVM A;  1G33 A;  4OKH A;  1YRT B;  1DF0 B;  3VRO A;  4MVF A;  3SG6 A;  4PAL A;  3VRR A;  1BU3 A;  2PMY A;  3FWC A;  3RM1 A;  5I2L A;  1X02 A;  1SL9 A;  1F55 A;  4PCW A;  4C0K A;  2HQW A;  1TCF A;  1EXR A;  5KTY A;  1V1F A;  1DJZ A;  3BOW B;  2F2P A;  2BCA A;  1SNL A;  2EGD A;  3BUM B;  1F8H A;  1YUR A;  1DJH A;  4ICB A;  4MEW A;  1WRL A;  1S5G Z;  3TUY B;  1R6P A;  1UWO A;  1NIW A;  2KSP A;  2BKI B;  1XFY O;  1GJY A;  5HKY A;  4NDD A;  1BF5 A;  1KSO A;  1W7I B;  1ZOT B;  3HCM A;  4MRX A;  1KFU L;  2H61 A;  1AP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...