2OS8C

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
total genus 37
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C02
1NCYA 2E6WA 5GQQC 2BBMA 1QIVA 3BUOB 4GBAA 4USLA 4WRIA 3NSLA 2KI4B 4A4BA 1XFWO 1JFJA 4MBEA 1AVSA 1MXEA 2KBIA 2LMVA 3EVUA 1DJXA 2ZN9A 4DCKA 1A4PA 1JBAA 2NLNA 1SKTA 4P5OE 4CIDA 2AUCA 4JPZB 2WORA 4YGDB 1EL4A 2HQ8A 1XFZO 2M9GA 5HLVA 1CLBA 3VRNA 3SG7A 1KQMC 4AQJA 1CFCA 1XFVO 2OS8C 5IBWA 1CB1A 1PRWA 4GPLB 2CXJA 2I94A 3EK7A 2JOJA 3EK4A 1K94A 1UWOA 2OS8B 3AKAA 1DGVA 3RM1A 1WLZA 1JF0A 1F71A 1GGZA 1TOPA 5CSFA 2PSRA 3SG5A 1L2OB 3TDIA 1ZACA 4AQIA 1SMGA 4CPVA 1FPWA 4F0ZB 1QS7A 1RFJA 1A03A 2L51A 1Q80A 1QLKA 3PM8A 3KF9A 3A8RA 4WQ2A 4YI9A 2LVKA 2SCPA 1FBVA 1LVCD 3NSIA 2BCXA 2PMYA 2JNFA 1IRJA 5BPJA 2L2EA 1GJYA 1XA5A 2KI6D 3FIAA 4L9MA 2JRFA 2JULA 4Q04A 1D1OA 1DF0A 2PRUA 3LLEA 3OB2B 4PALA 1H4BA 2JU0A 1DJIA 1NWDA 2LMTA 2Q4UA 1FI5A 2M1KB 1QVIZ 2MA2A 2K7CA 1TNPA 1EXRA 2JZIA 1NCXA 2M8UA 5AFPA 1YUTA 1NX0A 3BUXB 2Y4QA 2MRDA 1Y1UA 1VRKA 3CZTX 1SL7A 2F33A 4PCWA 2NXQA 2OTGB 1SPYA 1J55A 1Y0VH 1OZOA 2D8NA 4DUQA 3IQOA 1Y1AA 1S1EA 3TDUA 1M46A 1JWDA 4YBHB 2NZ0A 5KTYA 1LA0A 1LA3A 4NDBA 2KFHA 1EG4A 5HKZA 3LK0A 4CFQA 1CLLA 2JQ6A 3I5GC 2LLUA 5I2OA 3MSEB 4U8DA 1IQ3A 1N65A 2CT9A 3I5GB 3KO0A 1IGVA 3CLNA 3LCPC 1OE9B 1UUSA 2K61A 4MRYA 1YUUA 2JT3A 4XJKB 1F54A 1C7VA 1WY9A 1IG5A 2F2PA 3LL8B 4PHMA 2LMUA 1XFXO 3DVJA 2Y5IA 2MLEC 5DKRA 3EKHA 3E3RA 1SL9A 4MZKA 3OHMB 4OVNF 2MHHA 4PHKA 1AK8A 3TUYC 1Y6WA 3CR4X 3PN7C 1DMOA 1DJHA 1FW4A 2F2OA 3BYAA 1K9UA 2K7BA 4N1FA 3TUYB 2GGZA 4I5LB 1KFXS 3C1VA 2BL0B 3TDZA 1NIWA 4HRHA 1K93D 3WNXB 1BOCA 1CNPA 3NSKA 1B7TZ 3H4SE 1CTRA 2IS9A 1NP8A 1NPQA 4BY5A 3I5IB 2JC2A 1X02A 2RGIA 4MZJA 2CTNA 3VRPA 2F3YA 4OKHA 2LM5A 1CKKA 4BY4A 1YR5A 3CS1A 1MHOA 1OSAA 4FQOA 1RROA 1RWYA 1WRZA 1ZFSA 2KHNA 5D7FA 1WRKA 2KBMA 1U5IA 1GQMA 1MR8A 1UHKA 5AEQA 1CDNA 1YX8A 5PALA 2EHBA 1PSRA 3QRXA 1ZOTB 2K7OA 4PDZA 1DJZA 2ZN8A 5CSIA 1KK7Y 5HKYA 2A4JA 2M29A 3BUNB 1NX3A 4D1EA 1TTXA 1RECA 2CNPA 1NUBA 4YGEB 1NCZA 4HSZA 1ZMZA 1M31A 1SRAA 1KQMB 2LLSA 3WHTB 1A29A 1BMOA 1SCMC 1CFDA 3ZNIA 4QJ5B 2K2FA 1OOJA 1RTP1 5DKQA 4MEWA 2LHLA 1SCMB 1L7ZA 1YUSA 2ZFDA 4C0JA 2O5GA 4IL1A 3SG4A 2H61C 4FTGA 1YTZC 3AAJA 1KSOA 2Q91A 5D69A 1LINA 4GGFC 1AUIB 2H61A 3EK8A 3PALA 5G08A 3I5FC 1XFUO 1CM4A 3OB1B 1MXLC 1G4YR 4GGFA 1QX2A 2GGMA 2WCBA 1CFPA 2KQYA 2M0RA 1RK9A 2L98A 3GOFA 2SASA 3KHEA 3PATA 3OX5A 4PE7A 1BT6A 1N2DA 1CFFA 1G33A 1H8BA 1KFXL 1OZSA 1V1FA 4UPGA 1DF0B 1BG1A 2VRGA 1LXFC 3A4UB 2BKIB 4E68A 2I18A 3FWBA 1KK8C 2F8PA 1QIWA 1UURA 1KWOC 2CBLA 2G2BA 3WHUB 1JUOA 1QASA 2K2AA 3CTNA 3NSOA 1SL8A 1B8RA 3CR5X 1KK8B 1F4QA 1K8UA 1KWOB 5AXIA 2DOQA 2F3ZA 1SW8A 4GUKA 4A4CA 2CCMA 1CDMA 3RLZA 1EG3A 1S6IA 1DVIA 4ZCVA 2JTZA 1IQ5A 3K21A 2O60A 2ZNDA 1KFUS 2L0PA 3ZWHA 1ZUZA 1FF1A 1YRUB 4I5KA 2M1UA 4MN0A 4PE4A 2FCDA 1BR1B 4YGAA 4NQGA 3TS5C 1K2HA 1QVIY 2H2KA 5CPVA 1MQ1A 3CWGA 1QATA 2JNXA 2E30A 3TS5B 1A2XA 1K9PA 1TRFA 4WQ3A 3SIBA 2L50A 5CSJA 4N1GA 5JOLA 2L4IA 2AMIA 3GK2A 2M49B 1M45A 1CMFA 2BBNA 2MAZA 3JTDC 4PE1A 1KSMA 1SYMA 4DS7A 3PFVA 5KSZA 4ICBA 1J7QA 1EJ3A 3I5HC 5DKNA 4NDDA 2LANA 2WOSA 5I8NA 4YRUA 5J3XA 3VGOA 3I5HB 1HQVA 3LK1A 1XK4C 1N0YA 3GK4X 2KYFA 4JQ0D 1SCVA 2JT8A 2M7LA 4I5JA 1WDCC 2OPOA 1XK4A 3PN7B 2ISDA 3IF7A 4GFTA 1K95A 2BCAA 1DJYA 2HF5A 2ZRSA 1TNQA 1J7RA 1HT9A 1G8IA 2LV7A 5AANA 2JTTA 2KGBC 2PASA 1S5GZ 4MZLA 4P2YB 1F4OA 1WLMA 2Y1NA 4ORBB 1B8CA 3D0YA 1UHIA 2KOTA 3CR2A 2LUCA 2V53A 3VRQA 1BF5A 2ZKMX 4MSPA 1S26D 1U5IB 2NCOA 1MWNA 2WCEA 3O6BA 2LC5A 1A75A 2JWWA 1SK6D 1B7TY 3BOWA 3NXAA 3DVMA 2PALA 3FWCA 2GV5A 1CM1A 2EC6C 3O2PA 1K96A 4YGCB 2K0JA 4GAOA 1MF8B 1W7JB 2LVIA 2HETA 2LVJA 2ZRTA 4N5XA 1KFUL 3SG3A 1AHRA 1K9KA 1J7PA 2JPTA 2MJWB 1J7OA 2WCFA 1BU3A 2MLFC 1QLSA 1AJ4A 3BQ3A 2TN4A 3EKJA 1PVBA 1TCOB 1YVLA 1F8HA 3OX6A 3SIAA 1CDPA 2COLB 3SG6A 1C07A 1B9AA 4GGNA 1F55A 3PSRA 5B8IB 4M2PA 5F6TA 1F70A 1PULA 2WC8A 1QXPA 1SY9A 1SBJA 1NX1A 4I5NB 1JC2A 4TNCA 1JSAA 4MVFA 4PHJA 1CLMA 1Y1XA 1BR4B 5HYDA 4OR9B 3I5FB 3O78A 1IJ5A 3KPXA 5CSNA 1L2OC 2P6BB 3ICBA 2LHIA 1AJ5A 4QJ3B 2B1UA 1CMGA 1S36A 3DD4A 4C0KA 1QTXA 3CGAA 4YGBB 5K89A 1UHNA 1XO5A 5JJGA 1J1DA 1B8LA 1WRLA 2JT0A 5TNCA 3HX4A 2HPSA 2FJUB 1S3PA 3OP0A 2EGDA 2AAOA 2KYCA 3IQQA 3F45A 1FI6A 4R1EA 1S6JA 1S6CA 5AERA 1OMVA 1SNLA 1BJFA 1KCYA 2QPTA 2BE6A 1W7IB 1OMDA 3EVVA 2KAVA 3D10A 4OCIA 5HLOA 1B4CA 1PK0D 2LNKA 2LP2A 1TN4A 3FS7A 2KI6C 4CFRA 1J1EA 2KFGA 2KNEA 4YI8A 3JVTC 4JWQA 1IKUA 1JF2A 1PALA 1OMRA 1UP5A 1XYDA 4XYNA 1DJGA 2FOTA 2MBXA 2KAXA 3JVTB 5ER5A 2K7DA 2KAYA 3DVKA 2KGRA 4C0LA 2BKHB 4ORAB 2JXLA 4ZCUA 1QV1A 1B47A 1QX5B 2OTGC 3WXAA 2G9BA 2L4HA 1BLQA 4DRWA 4QJ4B 4M2QA 1ALWA 1TIZA 1QV0A 2L5XB 2ZNEA 2LLTA 2LCPA 1RJVA 1EH2A 1MUXA 3JTDB 3SJSA 2K8MB 1R2UA 1YX7A 2M97A 1NYAA 1TNXA 2I7AA 2WNDA 1ALVA 3HCMA 3VRRA 1CDLA 1UHHA 3BXKA 1B1GA 2BECA 2LE9B 1M63B 2M3WA 1LKJA 1ODBA 4M2OA 1XFYO 2M7NA 1SR6C 3PLFB 1XVJA 1DTLA 2KFFA 4OV2A 4MLWA 3AKBA 4PE0A 4XJKA 3O4YA 1DT7B 3KEVA 1YRTB 1SR6B 1DGUA 2HQWA 2LP3A 1WDCB 1QX7A 1V1GA 1NSHA 2I2RE 3BUMB 4DIRA 1E8AA 3SG2A 2LUXA 2LAPA 2LVVA 1KQVA 2KQ6A 2QACA 1OQPA 1C7WA 2KSPA 5ER4X 2R2IA 1TNWA 3BUWB 3GK1A 3M0WA 3EVRA 5KU1A 3D0YB 1K90D 2BE4A 2BL0C 4HREE 1IH0A 2FCEA 4CLNA 2PVBA 3TZ1A 1UHJA 4ORCB 5HKWA 1PVAA 1PSBA 4AOMA 2KDHA 1A75B 4PHNA 1DJWA 3I5IC 3BOWB 4NDCA 4HRGA 1QJTA 1TCFA 1YVHA 5FYXA 1GGWA 1R6PA 5I2QA 1JFKA 5I2LA 3DVEA 4MRXA 1AP4A 3DF0B 1IWQA 1NX2A 1S5GY 3DF0A 1KK7Z 3VROA 1YURA 2NCPA 4GNKB 1M39A 4ETOA 2JXCA 2EC6B 2BCBA 1IJ6A 2Y1MA 1BODA 3AAKA 2KI4C
chains in the Genus database with same CATH superfamily
1NCYA 2E6WA 4OZDA 2BBMA 5GQQC 1QIVA 3BUOB 4GBAA 4USLA 4WRIA 2WCKA 3NSLA 2KI4B 4A4BA 1XFWO 1JFJA 4MBEA 1AVSA 1MXEA 5FI6A 2KBIA 2LMVA 3EVUA 5FI7A 1DJXA 2ZN9A 4DCKA 1A4PA 3V2LA 1JBAA 3NHTA 2NLNA 1SKTA 3PJIA 4P5OE 4CIDA 2AUCA 3S0BA 4JPZB 2WORA 4YGDB 1EL4A 2HQ8A 1XFZO 2M9GA 2WCLA 5HLVA 1CLBA 3VRNA 3SG7A 1KQMC 4AQJA 1CFCA 1XFVO 2OS8C 5IBWA 1CB1A 1C3ZA 1PRWA 4GPLB 2CXJA 2I94A 3EK7A 2JOJA 3EK4A 1K94A 1UWOA 2OS8B 3AKAA 1DGVA 3RM1A 1WLZA 1W9ZA 1JF0A 1F71A 1GGZA 1TOPA 5CSFA 2PSRA 3SG5A 1L2OB 3DZTA 3TDIA 1ZACA 4AQIA 1DEKA 1SMGA 4CPVA 1FPWA 4F0ZB 1QS7A 1RFJA 1A03A 2L51A 1Q80A 1QLKA 1XFRA 3PM8A 3KF9A 3A8RA 4WQ2A 4YI9A 2LVKA 5EL2A 2SCPA 1FBVA 1LVCD 3NSIA 2BCXA 2PMYA 2JNFA 1IRJA 5BPJA 2L2EA 1GJYA 1XA5A 2KI6D 3FIAA 4L9MA 2JRFA 2JULA 4Q04A 1D1OA 1DF0A 2PRUA 3B88A 3LLEA 3OB2B 4PALA 1H4BA 2JU0A 3VB1A 1DJIA 1NWDA 3NHIA 3SS3A 2LMTA 2Q4UA 1FI5A 2M1KB 1QVIZ 2MA2A 3D75A 2K7CA 3R1VA 1TNPA 1EXRA 3S0FA 2JZIA 2WC5A 1NCXA 2M8UA 5AFPA 1YUTA 1NX0A 1TUJA 3BUXB 2Y4QA 2MRDA 1Y1UA 1SSEB 1VRKA 3CZTX 1SL7A 2F33A 4PCWA 2NXQA 2OTGB 4KYNA 1SPYA 1TWOA 1J55A 1Y0VH 3B6XA 1OZOA 2D8NA 3N7HA 4DUQA 3IQOA 1Y1AA 1S1EA 3TDUA 1M46A 1JWDA 3S0DA 1Z2CB 4YBHB 2NZ0A 5KTYA 1LA0A 1LA3A 4NDBA 2KFHA 1EG4A 5HKZA 3LK0A 3DYEA 4CFQA 1QWVA 1CLLA 2JQ6A 3I5GC 2LLUA 2QEHA 3MSEB 3R72A 4U8DA 5I2OA 1IQ3A 1N65A 5I94A 2CT9A 3I5GB 3KO0A 1IGVA 3CLNA 3LCPC 1OE9B 1OOHA 4F7FA 1UUSA 2K61A 4MRYA 1YUUA 2JT3A 4XJKB 1F54A 1C7VA 1WY9A 1IG5A 2F2PA 2K60A 3LL8B 4PHMA 2LMUA 1XFXO 3DVJA 2Y5IA 2MLEC 5DKRA 3EKHA 3E3RA 1SL9A 4INXA 4MZKA 2P70A 2KLEA 3OHMB 4OVNF 2MHHA 4PHKA 1AK8A 3TUYC 1Y6WA 3CR4X 3PN7C 1DMOA 2H8VA 2WCMA 1DJHA 1FW4A 2F2OA 3BYAA 1K9UA 2K7BA 4N1FA 3TUYB 5D3OA 2GGZA 4I5LB 1KFXS 3C1VA 2BL0B 3TDZA 1NIWA 4HRHA 1K93D 3WNXB 1BOCA 1CNPA 3NSKA 1B7TZ 3H4SE 1CTRA 2IS9A 1NP8A 3SS5A 1NPQA 4BY5A 1OOIX 3I5IB 2JC2A 1X02A 2RGIA 4MZJA 2CTNA 3VRPA 2F3YA 1OOGA 4OKHA 2LM5A 1CKKA 4BY4A 1YR5A 3CS1A 1MHOA 1OSAA 4FQOA 1RROA 1RWYA 1WRZA 1ZFSA 2KHNA 5D7FA 1WRKA 2KBMA 3B86A 1U5IA 1GQMA 1MR8A 1UHKA 5AEQA 1OOFA 1YX8A 1CDNA 5PALA 2EHBA 1PSRA 3QRXA 1ZOTB 3S0EA 2K7OA 4PDZA 1DJZA 4PT1A 2ZN8A 5CSIA 3UNWA 3DY9A 1KK7Y 5HKYA 2A4JA 2M29A 3BUNB 3R1PA 4IJ7A 1NX3A 4D1EA 1DELA 1TTXA 1RECA 2CNPA 1NUBA 3CABA 4YGEB 1NCZA 4HSZA 1ZMZA 1M31A 1SRAA 1KQMB 2BAPA 2LLSA 3WHTB 1A29A 1BMOA 1SCMC 1CFDA 3ZNIA 1DC1A 4QJ5B 2K2FA 3O4XA 1OOJA 1RTP1 1GM0A 2ERBA 5DKQA 4MEWA 2LHLA 1SCMB 1L7ZA 1YUSA 2ZFDA 4C0JA 2O5GA 4IL1A 3SG4A 2H61C 4FTGA 1C3YA 1YTZC 3AAJA 1KSOA 2Q91A 5D69A 1LINA 4GGFC 1AUIB 2H61A 4INWA 3EK8A 3PALA 5G08A 3I5FC 1XFUO 1CM4A 3OB1B 1MXLC 3FE9A 1G4YR 4GGFA 1QX2A 2GGMA 2WCBA 1CFPA 2KQYA 2M0RA 1RK9A 2L98A 3GOFA 2SASA 3KHEA 3PATA 3OX5A 4PE7A 1BT6A 1N2DA 1CFFA 1G33A 1H8BA 1KFXL 2L5YA 3OBVA 1OZSA 1V1FA 4UPGA 1DF0B 2GTEA 2VRGA 1LXFC 2L2CA 3A4UB 1BG1A 2BKIB 4E68A 2I18A 3FWBA 1KK8C 2F8PA 1QIWA 1UURA 1KWOC 2CBLA 2G2BA 3WHUB 1JUOA 1QASA 2K2AA 3CTNA 3NSOA 1SL8A 1B8RA 3CR5X 1KK8B 1F4QA 1K8UA 1KWOB 5AXIA 2DOQA 2F3ZA 1SW8A 4GUKA 4A4CA 2CCMA 1CDMA 3RLZA 1EG3A 1S6IA 1DVIA 4ZCVA 2JTZA 2WC6A 1IQ5A 3IVTA 1T14A 2O60A 3K21A 2ZNDA 1KFUS 2L0PA 3ZWHA 1ZUZA 1FF1A 1YRUB 4I5KA 2M1UA 4MN0A 4PE4A 2FCDA 1BR1B 3BFAA 4NQGA 4YGAA 3TS5C 1K2HA 1QVIY 2H2KA 5CPVA 1MQ1A 3CWGA 1QATA 2JNXA 2E30A 3TS5B 1A2XA 1K9PA 1TRFA 4WQ3A 3SIBA 2L50A 5CSJA 4N1GA 5JOLA 2L4IA 2QDIA 2AMIA 3GK2A 2KLDA 3CZ1A 2M49B 1M45A 1CMFA 2BBNA 2MAZA 3JTDC 4PE1A 1KSMA 1SYMA 4DS7A 3PFVA 5KSZA 4ICBA 1J7QA 1EJ3A 3I5HC 5DKNA 2BNXA 4NDDA 2LANA 2WOSA 3RZSA 5I8NA 4YRUA 5J3XA 3VGOA 3I5HB 1HQVA 3LK1A 1XK4C 1N0YA 3GK4X 2KYFA 4JQ0D 1SCVA 2JT8A 2M7LA 4I5JA 1WDCC 2OPOA 1XK4A 1DQEA 1LS8A 3PN7B 2ISDA 3IF7A 4GFTA 1K95A 2BCAA 1DJYA 2HF5A 2ZRSA 1TNQA 1J7RA 3D74A 2YGUA 1HT9A 1G8IA 3BFHA 2LV7A 5AANA 2JTTA 2KGBC 2PASA 1S5GZ 4MZLA 4P2YB 1F4OA 1WLMA 2Y1NA 4ORBB 1B8CA 3D0YA 1UHIA 2KOTA 3CR2A 2LUCA 2V53A 3D76A 3VRQA 3D77A 1BF5A 2ZKMX 3CZ2A 4MSPA 1S26D 1U5IB 2NCOA 3S0GA 1MWNA 2WCEA 3O6BA 2LC5A 1A75A 2JWWA 1SK6D 1B7TY 3BOWA 3NXAA 3DVMA 2PALA 3FWCA 2GV5A 1CM1A 2QEOA 2EC6C 3O2PA 1K96A 3K1EA 3D73A 4YGCB 2K0JA 4GAOA 1MF8B 1W7JB 2LVIA 2HETA 2LVJA 2QEBA 2ZRTA 4N5XA 1KFUL 3SG3A 1AHRA 1K9KA 1J7PA 2JPTA 2MJWB 1J7OA 2WCFA 3CZ0A 1BU3A 3L47A 2MLFC 1QLSA 1AJ4A 3BQ3A 3OGNA 2TN4A 3EKJA 3L4AA 1PVBA 1TCOB 1YVLA 1F8HA 3OX6A 1OW4A 3SIAA 3UO9A 3PM2A 1CDPA 2COLB 3SG6A 1C07A 1B9AA 3BFBA 4GGNA 1F55A 3PSRA 5B8IB 4M2PA 5F6TA 1F70A 1PULA 2WC8A 1QXPA 1SY9A 1SBJA 1NX1A 4I5NB 1JC2A 4TNCA 1JSAA 4MVFA 4PHJA 1CLMA 1Y1XA 1BR4B 5HYDA 1P28A 4OR9B 3I5FB 3O78A 1IJ5A 3KPXA 5CSNA 1L2OC 2P6BB 3ICBA 2LHIA 1AJ5A 4QJ3B 2B1UA 1CMGA 1S36A 3DD4A 4C0KA 1QTXA 3CGAA 4YGBB 5K89A 1UHNA 1XO5A 5JJGA 1J1DA 1B8LA 1WRLA 2JT0A 5TNCA 3HX4A 2HPSA 2FJUB 1S3PA 3EG5B 3OP0A 2EGDA 2AAOA 2KYCA 3IQQA 3F45A 1FI6A 4R1EA 1S6JA 1S6CA 5AERA 1OMVA 1SNLA 1BJFA 1KCYA 2QPTA 2BE6A 1W7IB 1OMDA 3EVVA 5HL1A 2KAVA 3D10A 4OCIA 5HLOA 1B4CA 1PK0D 2LNKA 2LP2A 1TN4A 3FS7A 3CDNA 2KI6C 4CFRA 1J1EA 2KFGA 2KNEA 2QEVA 4FQTA 4YI8A 3JVTC 4JWQA 3CYZA 1IKUA 1JF2A 1PALA 1OMRA 1UP5A 1XYDA 4XYNA 1DJGA 2FOTA 2MBXA 2KAXA 3JVTB 5ER5A 2K7DA 2KAYA 3R1OA 3DVKA 2KGRA 5DICA 4C0LA 2BKHB 4ORAB 2JXLA 4ZCUA 1QV1A 1B47A 1QX5B 1Z4HA 2OTGC 2G9BA 2L4HA 3D78A 3WXAA 1BLQA 3Q8IA 4DRWA 4QJ4B 4JKTA 4M2QA 1ALWA 1TIZA 1QV0A 2L5XB 2ZNEA 2LLTA 3NGVA 2LCPA 1RJVA 1EH2A 1MUXA 3JTDB 3SJSA 2K8MB 1R2UA 1YX7A 1ORGA 2M97A 1NYAA 1TNXA 3B87A 2I7AA 2WNDA 1ALVA 3HCMA 3VRRA 1CDLA 1UHHA 3BXKA 1B1GA 3B7AA 2BECA 2LE9B 1M63B 2M3WA 3FE6A 1LKJA 1ODBA 4M2OA 1XFYO 2M7NA 2PYQA 1IIOA 1SR6C 2FJYA 3PLFB 1XVJA 1DTLA 2KFFA 4OV2A 4MLWA 3AKBA 4PE0A 4XJKA 3O4YA 1DT7B 3KEVA 1YRTB 1SR6B 1DGUA 2HQWA 2LP3A 1WDCB 1QX7A 1V1GA 1NSHA 2I2RE 3BUMB 4DIRA 1E8AA 2WCJA 3SG2A 2LUXA 1TUZA 2LAPA 2LVVA 3BJHA 1KQVA 2KQ6A 2QACA 1OQPA 1C7WA 2KSPA 5ER4X 2R2IA 1TNWA 3BUWB 3GK1A 2KPHA 3M0WA 3DXLA 3EVRA 2WCHA 5KU1A 3D0YB 1K90D 2BE4A 2BL0C 4HREE 1IH0A 2FCEA 3S0AA 4CLNA 3FE8A 3SS4A 2PVBA 3TZ1A 2JPOA 1UHJA 2PQLA 4ORCB 5HKWA 1PVAA 1PSBA 4AOMA 3QMEA 2KDHA 1A75B 4PHNA 5FI2A 1DJWA 3I5IC 3BOWB 4NDCA 4HRGA 1QJTA 1YVHA 1TCFA 5FYXA 1GGWA 1R6PA 5I2QA 1JFKA 5I2LA 3DVEA 4JD9A 4MRXA 1AP4A 3DF0B 1IWQA 1NX2A 1S5GY 3DF0A 1KK7Z 3VROA 1YURA 2NCPA 4GNKB 1M39A 4ETOA 2JXCA 2EC6B 2BCBA 1IJ6A 2P71A 2Y1MA 1BODA 3L4LA 3AAKA 2KI4C
chains in the Genus database with same CATH topology
1NCYA 2E6WA 5GQQC 2BBMA 1QIVA 3BUOB 4GBAA 4USLA 4WRIA 3NSLA 2KI4B 4A4BA 1XFWO 1JFJA 4MBEA 1AVSA 1MXEA 2KBIA 2LMVA 3EVUA 1DJXA 2ZN9A 4DCKA 1A4PA 1JBAA 2NLNA 1SKTA 4P5OE 4CIDA 2AUCA 4JPZB 2WORA 4YGDB 1EL4A 2HQ8A 1XFZO 2M9GA 5HLVA 1CLBA 3VRNA 3SG7A 1KQMC 4AQJA 1CFCA 1XFVO 2OS8C 5IBWA 1CB1A 1PRWA 4GPLB 2CXJA 2I94A 3EK7A 2JOJA 3EK4A 1K94A 1UWOA 2OS8B 3AKAA 1DGVA 3RM1A 1WLZA 1JF0A 1F71A 1GGZA 1TOPA 5CSFA 2PSRA 3SG5A 1L2OB 3TDIA 1ZACA 4AQIA 1SMGA 4CPVA 1FPWA 4F0ZB 1QS7A 1RFJA 1A03A 2L51A 1Q80A 1QLKA 3PM8A 3KF9A 3A8RA 4WQ2A 4YI9A 2LVKA 2SCPA 1FBVA 1LVCD 3NSIA 2BCXA 2PMYA 2JNFA 1IRJA 5BPJA 2L2EA 1GJYA 1XA5A 2KI6D 3FIAA 4L9MA 2JRFA 2JULA 4Q04A 1D1OA 1DF0A 2PRUA 3LLEA 3OB2B 4PALA 1H4BA 2JU0A 1DJIA 1NWDA 2LMTA 2Q4UA 1FI5A 2M1KB 1QVIZ 2MA2A 2K7CA 1TNPA 1EXRA 2JZIA 1NCXA 2M8UA 5AFPA 1YUTA 1NX0A 3BUXB 2Y4QA 2MRDA 1Y1UA 1VRKA 3CZTX 1SL7A 2F33A 4PCWA 2NXQA 2OTGB 1SPYA 1J55A 1Y0VH 1OZOA 2D8NA 4DUQA 3IQOA 1Y1AA 1S1EA 3TDUA 1M46A 1JWDA 4YBHB 2NZ0A 5KTYA 1LA0A 1LA3A 4NDBA 2KFHA 1EG4A 5HKZA 3LK0A 4CFQA 1CLLA 2JQ6A 3I5GC 2LLUA 5I2OA 3MSEB 4U8DA 1IQ3A 1N65A 2CT9A 3I5GB 3KO0A 1IGVA 3CLNA 3LCPC 1OE9B 1UUSA 2K61A 4MRYA 1YUUA 2JT3A 4XJKB 1F54A 1C7VA 1WY9A 1IG5A 2F2PA 3LL8B 4PHMA 2LMUA 1XFXO 3DVJA 2Y5IA 2MLEC 5DKRA 3EKHA 3E3RA 1SL9A 4MZKA 3OHMB 4OVNF 2MHHA 4PHKA 1AK8A 3TUYC 1Y6WA 3CR4X 3PN7C 1DMOA 1DJHA 1FW4A 2F2OA 3BYAA 1K9UA 2K7BA 4N1FA 3TUYB 2GGZA 4I5LB 1KFXS 3C1VA 2BL0B 3TDZA 1NIWA 4HRHA 1K93D 3WNXB 1BOCA 1CNPA 3NSKA 1B7TZ 3H4SE 1CTRA 2IS9A 1NP8A 1NPQA 4BY5A 3I5IB 2JC2A 1X02A 2RGIA 4MZJA 2CTNA 3VRPA 2F3YA 4OKHA 2LM5A 1CKKA 4BY4A 1YR5A 3CS1A 1MHOA 1OSAA 4FQOA 1RROA 1RWYA 1WRZA 1ZFSA 2KHNA 5D7FA 1WRKA 2KBMA 1U5IA 1GQMA 1MR8A 1UHKA 5AEQA 1CDNA 1YX8A 5PALA 2EHBA 1PSRA 3QRXA 1ZOTB 2K7OA 4PDZA 1DJZA 2ZN8A 5CSIA 1KK7Y 5HKYA 2A4JA 2M29A 3BUNB 1NX3A 4D1EA 1TTXA 1RECA 2CNPA 1NUBA 4YGEB 1NCZA 4HSZA 1ZMZA 1M31A 1SRAA 1KQMB 2LLSA 3WHTB 1A29A 1BMOA 1SCMC 1CFDA 3ZNIA 4QJ5B 2K2FA 1OOJA 1RTP1 5DKQA 4MEWA 2LHLA 1SCMB 1L7ZA 1YUSA 2ZFDA 4C0JA 2O5GA 4IL1A 3SG4A 2H61C 4FTGA 1YTZC 3AAJA 1KSOA 2Q91A 5D69A 1LINA 4GGFC 1AUIB 2H61A 3EK8A 3PALA 5G08A 3I5FC 1XFUO 1CM4A 3OB1B 1MXLC 1G4YR 4GGFA 1QX2A 2GGMA 2WCBA 1CFPA 2KQYA 2M0RA 1RK9A 2L98A 3GOFA 2SASA 3KHEA 3PATA 3OX5A 4PE7A 1BT6A 1N2DA 1CFFA 1G33A 1H8BA 1KFXL 1OZSA 1V1FA 4UPGA 1DF0B 1BG1A 2VRGA 1LXFC 3A4UB 2BKIB 4E68A 2I18A 3FWBA 1KK8C 2F8PA 1QIWA 1UURA 1KWOC 2CBLA 2G2BA 3WHUB 1JUOA 1QASA 2K2AA 3CTNA 3NSOA 1SL8A 1B8RA 3CR5X 1KK8B 1F4QA 1K8UA 1KWOB 5AXIA 2DOQA 2F3ZA 1SW8A 4GUKA 4A4CA 2CCMA 1CDMA 3RLZA 1EG3A 1S6IA 1DVIA 4ZCVA 2JTZA 1IQ5A 3K21A 2O60A 2ZNDA 1KFUS 2L0PA 3ZWHA 1ZUZA 1FF1A 1YRUB 4I5KA 2M1UA 4MN0A 4PE4A 2FCDA 1BR1B 4YGAA 4NQGA 3TS5C 1K2HA 1QVIY 2H2KA 5CPVA 1MQ1A 3CWGA 1QATA 2JNXA 2E30A 3TS5B 1A2XA 1K9PA 1TRFA 4WQ3A 3SIBA 2L50A 5CSJA 4N1GA 5JOLA 2L4IA 2AMIA 3GK2A 2M49B 1M45A 1CMFA 2BBNA 2MAZA 3JTDC 4PE1A 1KSMA 1SYMA 4DS7A 3PFVA 5KSZA 4ICBA 1J7QA 1EJ3A 3I5HC 5DKNA 4NDDA 2LANA 2WOSA 5I8NA 4YRUA 5J3XA 3VGOA 3I5HB 1HQVA 3LK1A 1XK4C 1N0YA 3GK4X 2KYFA 4JQ0D 1SCVA 2JT8A 2M7LA 4I5JA 1WDCC 2OPOA 1XK4A 3PN7B 2ISDA 3IF7A 4GFTA 1K95A 2BCAA 1DJYA 2HF5A 2ZRSA 1TNQA 1J7RA 1HT9A 1G8IA 2LV7A 5AANA 2JTTA 2KGBC 2PASA 1S5GZ 4MZLA 4P2YB 1F4OA 1WLMA 2Y1NA 4ORBB 1B8CA 3D0YA 1UHIA 2KOTA 3CR2A 2LUCA 2V53A 3VRQA 1BF5A 2ZKMX 4MSPA 1S26D 1U5IB 2NCOA 1MWNA 2WCEA 3O6BA 2LC5A 1A75A 2JWWA 1SK6D 1B7TY 3BOWA 3NXAA 3DVMA 2PALA 3FWCA 2GV5A 1CM1A 2EC6C 3O2PA 1K96A 4YGCB 2K0JA 4GAOA 1MF8B 1W7JB 2LVIA 2HETA 2LVJA 2ZRTA 4N5XA 1KFUL 3SG3A 1AHRA 1K9KA 1J7PA 2JPTA 2MJWB 1J7OA 2WCFA 1BU3A 2MLFC 1QLSA 1AJ4A 3BQ3A 2TN4A 3EKJA 1PVBA 1TCOB 1YVLA 1F8HA 3OX6A 3SIAA 1CDPA 2COLB 3SG6A 1C07A 1B9AA 4GGNA 1F55A 3PSRA 5B8IB 4M2PA 5F6TA 1F70A 1PULA 2WC8A 1QXPA 1SY9A 1SBJA 1NX1A 4I5NB 1JC2A 4TNCA 1JSAA 4MVFA 4PHJA 1CLMA 1Y1XA 1BR4B 5HYDA 4OR9B 3I5FB 3O78A 1IJ5A 3KPXA 5CSNA 1L2OC 2P6BB 3ICBA 2LHIA 1AJ5A 4QJ3B 2B1UA 1CMGA 1S36A 3DD4A 4C0KA 1QTXA 3CGAA 4YGBB 5K89A 1UHNA 1XO5A 5JJGA 1J1DA 1B8LA 1WRLA 2JT0A 5TNCA 3HX4A 2HPSA 2FJUB 1S3PA 3OP0A 2EGDA 2AAOA 2KYCA 3IQQA 3F45A 1FI6A 4R1EA 1S6JA 1S6CA 5AERA 1OMVA 1SNLA 1BJFA 1KCYA 2QPTA 2BE6A 1W7IB 1OMDA 3EVVA 2KAVA 3D10A 4OCIA 5HLOA 1B4CA 1PK0D 2LNKA 2LP2A 1TN4A 3FS7A 2KI6C 4CFRA 1J1EA 2KFGA 2KNEA 4YI8A 3JVTC 4JWQA 1IKUA 1JF2A 1PALA 1OMRA 1UP5A 1XYDA 4XYNA 1DJGA 2FOTA 2MBXA 2KAXA 3JVTB 5ER5A 2K7DA 2KAYA 3DVKA 2KGRA 4C0LA 2BKHB 4ORAB 2JXLA 4ZCUA 1QV1A 1B47A 1QX5B 2OTGC 3WXAA 2G9BA 2L4HA 1BLQA 4DRWA 4QJ4B 4M2QA 1ALWA 1TIZA 1QV0A 2L5XB 2ZNEA 2LLTA 2LCPA 1RJVA 1EH2A 1MUXA 3JTDB 3SJSA 2K8MB 1R2UA 1YX7A 2M97A 1NYAA 1TNXA 2I7AA 2WNDA 1ALVA 3HCMA 3VRRA 1CDLA 1UHHA 3BXKA 1B1GA 2BECA 2LE9B 1M63B 2M3WA 1LKJA 1ODBA 4M2OA 1XFYO 2M7NA 1SR6C 3PLFB 1XVJA 1DTLA 2KFFA 4OV2A 4MLWA 3AKBA 4PE0A 4XJKA 3O4YA 1DT7B 3KEVA 1YRTB 1SR6B 1DGUA 2HQWA 2LP3A 1WDCB 1QX7A 1V1GA 1NSHA 2I2RE 3BUMB 4DIRA 1E8AA 3SG2A 2LUXA 2LAPA 2LVVA 1KQVA 2KQ6A 2QACA 1OQPA 1C7WA 2KSPA 5ER4X 2R2IA 1TNWA 3BUWB 3GK1A 3M0WA 3EVRA 5KU1A 3D0YB 1K90D 2BE4A 2BL0C 4HREE 1IH0A 2FCEA 4CLNA 2PVBA 3TZ1A 1UHJA 4ORCB 5HKWA 1PVAA 1PSBA 4AOMA 2KDHA 1A75B 4PHNA 1DJWA 3I5IC 3BOWB 4NDCA 4HRGA 1QJTA 1TCFA 1YVHA 5FYXA 1GGWA 1R6PA 5I2QA 1JFKA 5I2LA 3DVEA 4MRXA 1AP4A 3DF0B 1IWQA 1NX2A 1S5GY 3DF0A 1KK7Z 3VROA 1YURA 2NCPA 4GNKB 1M39A 4ETOA 2JXCA 2EC6B 2BCBA 1IJ6A 2Y1MA 1BODA 3AAKA 2KI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCY A;  2E6W A;  5GQQ C;  2BBM A;  1QIV A;  3BUO B;  4GBA A;  4USL A;  4WRI A;  3NSL A;  2KI4 B;  4A4B A;  1XFW O;  1JFJ A;  4MBE A;  1AVS A;  1MXE A;  2KBI A;  2LMV A;  3EVU A;  1DJX A;  2ZN9 A;  4DCK A;  1A4P A;  1JBA A;  2NLN A;  1SKT A;  4P5O E;  4CID A;  2AUC A;  4JPZ B;  2WOR A;  4YGD B;  1EL4 A;  2HQ8 A;  1XFZ O;  2M9G A;  5HLV A;  1CLB A;  3VRN A;  3SG7 A;  1KQM C;  4AQJ A;  1CFC A;  1XFV O;  2OS8 C;  5IBW A;  1CB1 A;  1PRW A;  4GPL B;  2CXJ A;  2I94 A;  3EK7 A;  2JOJ A;  3EK4 A;  1K94 A;  1UWO A;  2OS8 B;  3AKA A;  1DGV A;  3RM1 A;  1WLZ A;  1JF0 A;  1F71 A;  1GGZ A;  1TOP A;  5CSF A;  2PSR A;  3SG5 A;  1L2O B;  3TDI A;  1ZAC A;  4AQI A;  1SMG A;  4CPV A;  1FPW A;  4F0Z B;  1QS7 A;  1RFJ A;  1A03 A;  2L51 A;  1Q80 A;  1QLK A;  3PM8 A;  3KF9 A;  3A8R A;  4WQ2 A;  4YI9 A;  2LVK A;  2SCP A;  1FBV A;  1LVC D;  3NSI A;  2BCX A;  2PMY A;  2JNF A;  1IRJ A;  5BPJ A;  2L2E A;  1GJY A;  1XA5 A;  2KI6 D;  3FIA A;  4L9M A;  2JRF A;  2JUL A;  4Q04 A;  1D1O A;  1DF0 A;  2PRU A;  3LLE A;  3OB2 B;  4PAL A;  1H4B A;  2JU0 A;  1DJI A;  1NWD A;  2LMT A;  2Q4U A;  1FI5 A;  2M1K B;  1QVI Z;  2MA2 A;  2K7C A;  1TNP A;  1EXR A;  2JZI A;  1NCX A;  2M8U A;  5AFP A;  1YUT A;  1NX0 A;  3BUX B;  2Y4Q A;  2MRD A;  1Y1U A;  1VRK A;  3CZT X;  1SL7 A;  2F33 A;  4PCW A;  2NXQ A;  2OTG B;  1SPY A;  1J55 A;  1Y0V H;  1OZO A;  2D8N A;  4DUQ A;  3IQO A;  1Y1A A;  1S1E A;  3TDU A;  1M46 A;  1JWD A;  4YBH B;  2NZ0 A;  5KTY A;  1LA0 A;  1LA3 A;  4NDB A;  2KFH A;  1EG4 A;  5HKZ A;  3LK0 A;  4CFQ A;  1CLL A;  2JQ6 A;  3I5G C;  2LLU A;  5I2O A;  3MSE B;  4U8D A;  1IQ3 A;  1N65 A;  2CT9 A;  3I5G B;  3KO0 A;  1IGV A;  3CLN A;  3LCP C;  1OE9 B;  1UUS A;  2K61 A;  4MRY A;  1YUU A;  2JT3 A;  4XJK B;  1F54 A;  1C7V A;  1WY9 A;  1IG5 A;  2F2P A;  3LL8 B;  4PHM A;  2LMU A;  1XFX O;  3DVJ A;  2Y5I A;  2MLE C;  5DKR A;  3EKH A;  3E3R A;  1SL9 A;  4MZK A;  3OHM B;  4OVN F;  2MHH A;  4PHK A;  1AK8 A;  3TUY C;  1Y6W A;  3CR4 X;  3PN7 C;  1DMO A;  1DJH A;  1FW4 A;  2F2O A;  3BYA A;  1K9U A;  2K7B A;  4N1F A;  3TUY B;  2GGZ A;  4I5L B;  1KFX S;  3C1V A;  2BL0 B;  3TDZ A;  1NIW A;  4HRH A;  1K93 D;  3WNX B;  1BOC A;  1CNP A;  3NSK A;  1B7T Z;  3H4S E;  1CTR A;  2IS9 A;  1NP8 A;  1NPQ A;  4BY5 A;  3I5I B;  2JC2 A;  1X02 A;  2RGI A;  4MZJ A;  2CTN A;  3VRP A;  2F3Y A;  4OKH A;  2LM5 A;  1CKK A;  4BY4 A;  1YR5 A;  3CS1 A;  1MHO A;  1OSA A;  4FQO A;  1RRO A;  1RWY A;  1WRZ A;  1ZFS A;  2KHN A;  5D7F A;  1WRK A;  2KBM A;  1U5I A;  1GQM A;  1MR8 A;  1UHK A;  5AEQ A;  1CDN A;  1YX8 A;  5PAL A;  2EHB A;  1PSR A;  3QRX A;  1ZOT B;  2K7O A;  4PDZ A;  1DJZ A;  2ZN8 A;  5CSI A;  1KK7 Y;  5HKY A;  2A4J A;  2M29 A;  3BUN B;  1NX3 A;  4D1E A;  1TTX A;  1REC A;  2CNP A;  1NUB A;  4YGE B;  1NCZ A;  4HSZ A;  1ZMZ A;  1M31 A;  1SRA A;  1KQM B;  2LLS A;  3WHT B;  1A29 A;  1BMO A;  1SCM C;  1CFD A;  3ZNI A;  4QJ5 B;  2K2F A;  1OOJ A;  1RTP 1;  5DKQ A;  4MEW A;  2LHL A;  1SCM B;  1L7Z A;  1YUS A;  2ZFD A;  4C0J A;  2O5G A;  4IL1 A;  3SG4 A;  2H61 C;  4FTG A;  1YTZ C;  3AAJ A;  1KSO A;  2Q91 A;  5D69 A;  1LIN A;  4GGF C;  1AUI B;  2H61 A;  3EK8 A;  3PAL A;  5G08 A;  3I5F C;  1XFU O;  1CM4 A;  3OB1 B;  1MXL C;  1G4Y R;  4GGF A;  1QX2 A;  2GGM A;  2WCB A;  1CFP A;  2KQY A;  2M0R A;  1RK9 A;  2L98 A;  3GOF A;  2SAS A;  3KHE A;  3PAT A;  3OX5 A;  4PE7 A;  1BT6 A;  1N2D A;  1CFF A;  1G33 A;  1H8B A;  1KFX L;  1OZS A;  1V1F A;  4UPG A;  1DF0 B;  1BG1 A;  2VRG A;  1LXF C;  3A4U B;  2BKI B;  4E68 A;  2I18 A;  3FWB A;  1KK8 C;  2F8P A;  1QIW A;  1UUR A;  1KWO C;  2CBL A;  2G2B A;  3WHU B;  1JUO A;  1QAS A;  2K2A A;  3CTN A;  3NSO A;  1SL8 A;  1B8R A;  3CR5 X;  1KK8 B;  1F4Q A;  1K8U A;  1KWO B;  5AXI A;  2DOQ A;  2F3Z A;  1SW8 A;  4GUK A;  4A4C A;  2CCM A;  1CDM A;  3RLZ A;  1EG3 A;  1S6I A;  1DVI A;  4ZCV A;  2JTZ A;  1IQ5 A;  3K21 A;  2O60 A;  2ZND A;  1KFU S;  2L0P A;  3ZWH A;  1ZUZ A;  1FF1 A;  1YRU B;  4I5K A;  2M1U A;  4MN0 A;  4PE4 A;  2FCD A;  1BR1 B;  4YGA A;  4NQG A;  3TS5 C;  1K2H A;  1QVI Y;  2H2K A;  5CPV A;  1MQ1 A;  3CWG A;  1QAT A;  2JNX A;  2E30 A;  3TS5 B;  1A2X A;  1K9P A;  1TRF A;  4WQ3 A;  3SIB A;  2L50 A;  5CSJ A;  4N1G A;  5JOL A;  2L4I A;  2AMI A;  3GK2 A;  2M49 B;  1M45 A;  1CMF A;  2BBN A;  2MAZ A;  3JTD C;  4PE1 A;  1KSM A;  1SYM A;  4DS7 A;  3PFV A;  5KSZ A;  4ICB A;  1J7Q A;  1EJ3 A;  3I5H C;  5DKN A;  4NDD A;  2LAN A;  2WOS A;  5I8N A;  4YRU A;  5J3X A;  3VGO A;  3I5H B;  1HQV A;  3LK1 A;  1XK4 C;  1N0Y A;  3GK4 X;  2KYF A;  4JQ0 D;  1SCV A;  2JT8 A;  2M7L A;  4I5J A;  1WDC C;  2OPO A;  1XK4 A;  3PN7 B;  2ISD A;  3IF7 A;  4GFT A;  1K95 A;  2BCA A;  1DJY A;  2HF5 A;  2ZRS A;  1TNQ A;  1J7R A;  1HT9 A;  1G8I A;  2LV7 A;  5AAN A;  2JTT A;  2KGB C;  2PAS A;  1S5G Z;  4MZL A;  4P2Y B;  1F4O A;  1WLM A;  2Y1N A;  4ORB B;  1B8C A;  3D0Y A;  1UHI A;  2KOT A;  3CR2 A;  2LUC A;  2V53 A;  3VRQ A;  1BF5 A;  2ZKM X;  4MSP A;  1S26 D;  1U5I B;  2NCO A;  1MWN A;  2WCE A;  3O6B A;  2LC5 A;  1A75 A;  2JWW A;  1SK6 D;  1B7T Y;  3BOW A;  3NXA A;  3DVM A;  2PAL A;  3FWC A;  2GV5 A;  1CM1 A;  2EC6 C;  3O2P A;  1K96 A;  4YGC B;  2K0J A;  4GAO A;  1MF8 B;  1W7J B;  2LVI A;  2HET A;  2LVJ A;  2ZRT A;  4N5X A;  1KFU L;  3SG3 A;  1AHR A;  1K9K A;  1J7P A;  2JPT A;  2MJW B;  1J7O A;  2WCF A;  1BU3 A;  2MLF C;  1QLS A;  1AJ4 A;  3BQ3 A;  2TN4 A;  3EKJ A;  1PVB A;  1TCO B;  1YVL A;  1F8H A;  3OX6 A;  3SIA A;  1CDP A;  2COL B;  3SG6 A;  1C07 A;  1B9A A;  4GGN A;  1F55 A;  3PSR A;  5B8I B;  4M2P A;  5F6T A;  1F70 A;  1PUL A;  2WC8 A;  1QXP A;  1SY9 A;  1SBJ A;  1NX1 A;  4I5N B;  1JC2 A;  4TNC A;  1JSA A;  4MVF A;  4PHJ A;  1CLM A;  1Y1X A;  1BR4 B;  5HYD A;  4OR9 B;  3I5F B;  3O78 A;  1IJ5 A;  3KPX A;  5CSN A;  1L2O C;  2P6B B;  3ICB A;  2LHI A;  1AJ5 A;  4QJ3 B;  2B1U A;  1CMG A;  1S36 A;  3DD4 A;  4C0K A;  1QTX A;  3CGA A;  4YGB B;  5K89 A;  1UHN A;  1XO5 A;  5JJG A;  1J1D A;  1B8L A;  1WRL A;  2JT0 A;  5TNC A;  3HX4 A;  2HPS A;  2FJU B;  1S3P A;  3OP0 A;  2EGD A;  2AAO A;  2KYC A;  3IQQ A;  3F45 A;  1FI6 A;  4R1E A;  1S6J A;  1S6C A;  5AER A;  1OMV A;  1SNL A;  1BJF A;  1KCY A;  2QPT A;  2BE6 A;  1W7I B;  1OMD A;  3EVV A;  2KAV A;  3D10 A;  4OCI A;  5HLO A;  1B4C A;  1PK0 D;  2LNK A;  2LP2 A;  1TN4 A;  3FS7 A;  2KI6 C;  4CFR A;  1J1E A;  2KFG A;  2KNE A;  4YI8 A;  3JVT C;  4JWQ A;  1IKU A;  1JF2 A;  1PAL A;  1OMR A;  1UP5 A;  1XYD A;  4XYN A;  1DJG A;  2FOT A;  2MBX A;  2KAX A;  3JVT B;  5ER5 A;  2K7D A;  2KAY A;  3DVK A;  2KGR A;  4C0L A;  2BKH B;  4ORA B;  2JXL A;  4ZCU A;  1QV1 A;  1B47 A;  1QX5 B;  2OTG C;  3WXA A;  2G9B A;  2L4H A;  1BLQ A;  4DRW A;  4QJ4 B;  4M2Q A;  1ALW A;  1TIZ A;  1QV0 A;  2L5X B;  2ZNE A;  2LLT A;  2LCP A;  1RJV A;  1EH2 A;  1MUX A;  3JTD B;  3SJS A;  2K8M B;  1R2U A;  1YX7 A;  2M97 A;  1NYA A;  1TNX A;  2I7A A;  2WND A;  1ALV A;  3HCM A;  3VRR A;  1CDL A;  1UHH A;  3BXK A;  1B1G A;  2BEC A;  2LE9 B;  1M63 B;  2M3W A;  1LKJ A;  1ODB A;  4M2O A;  1XFY O;  2M7N A;  1SR6 C;  3PLF B;  1XVJ A;  1DTL A;  2KFF A;  4OV2 A;  4MLW A;  3AKB A;  4PE0 A;  4XJK A;  3O4Y A;  1DT7 B;  3KEV A;  1YRT B;  1SR6 B;  1DGU A;  2HQW A;  2LP3 A;  1WDC B;  1QX7 A;  1V1G A;  1NSH A;  2I2R E;  3BUM B;  4DIR A;  1E8A A;  3SG2 A;  2LUX A;  2LAP A;  2LVV A;  1KQV A;  2KQ6 A;  2QAC A;  1OQP A;  1C7W A;  2KSP A;  5ER4 X;  2R2I A;  1TNW A;  3BUW B;  3GK1 A;  3M0W A;  3EVR A;  5KU1 A;  3D0Y B;  1K90 D;  2BE4 A;  2BL0 C;  4HRE E;  1IH0 A;  2FCE A;  4CLN A;  2PVB A;  3TZ1 A;  1UHJ A;  4ORC B;  5HKW A;  1PVA A;  1PSB A;  4AOM A;  2KDH A;  1A75 B;  4PHN A;  1DJW A;  3I5I C;  3BOW B;  4NDC A;  4HRG A;  1QJT A;  1TCF A;  1YVH A;  5FYX A;  1GGW A;  1R6P A;  5I2Q A;  1JFK A;  5I2L A;  3DVE A;  4MRX A;  1AP4 A;  3DF0 B;  1IWQ A;  1NX2 A;  1S5G Y;  3DF0 A;  1KK7 Z;  3VRO A;  1YUR A;  2NCP A;  4GNK B;  1M39 A;  4ETO A;  2JXC A;  2EC6 B;  2BCB A;  1IJ6 A;  2Y1M A;  1BOD A;  3AAK A;  2KI4 C; 
#chains in the Genus database with same CATH topology
 1NCY A;  2E6W A;  4OZD A;  2BBM A;  5GQQ C;  1QIV A;  3BUO B;  4GBA A;  4USL A;  4WRI A;  2WCK A;  3NSL A;  2KI4 B;  4A4B A;  1XFW O;  1JFJ A;  4MBE A;  1AVS A;  1MXE A;  5FI6 A;  2KBI A;  2LMV A;  3EVU A;  5FI7 A;  1DJX A;  2ZN9 A;  4DCK A;  1A4P A;  3V2L A;  1JBA A;  3NHT A;  2NLN A;  1SKT A;  3PJI A;  4P5O E;  4CID A;  2AUC A;  3S0B A;  4JPZ B;  2WOR A;  4YGD B;  1EL4 A;  2HQ8 A;  1XFZ O;  2M9G A;  2WCL A;  5HLV A;  1CLB A;  3VRN A;  3SG7 A;  1KQM C;  4AQJ A;  1CFC A;  1XFV O;  2OS8 C;  5IBW A;  1CB1 A;  1C3Z A;  1PRW A;  4GPL B;  2CXJ A;  2I94 A;  3EK7 A;  2JOJ A;  3EK4 A;  1K94 A;  1UWO A;  2OS8 B;  3AKA A;  1DGV A;  3RM1 A;  1WLZ A;  1W9Z A;  1JF0 A;  1F71 A;  1GGZ A;  1TOP A;  5CSF A;  2PSR A;  3SG5 A;  1L2O B;  3DZT A;  3TDI A;  1ZAC A;  4AQI A;  1DEK A;  1SMG A;  4CPV A;  1FPW A;  4F0Z B;  1QS7 A;  1RFJ A;  1A03 A;  2L51 A;  1Q80 A;  1QLK A;  1XFR A;  3PM8 A;  3KF9 A;  3A8R A;  4WQ2 A;  4YI9 A;  2LVK A;  5EL2 A;  2SCP A;  1FBV A;  1LVC D;  3NSI A;  2BCX A;  2PMY A;  2JNF A;  1IRJ A;  5BPJ A;  2L2E A;  1GJY A;  1XA5 A;  2KI6 D;  3FIA A;  4L9M A;  2JRF A;  2JUL A;  4Q04 A;  1D1O A;  1DF0 A;  2PRU A;  3B88 A;  3LLE A;  3OB2 B;  4PAL A;  1H4B A;  2JU0 A;  3VB1 A;  1DJI A;  1NWD A;  3NHI A;  3SS3 A;  2LMT A;  2Q4U A;  1FI5 A;  2M1K B;  1QVI Z;  2MA2 A;  3D75 A;  2K7C A;  3R1V A;  1TNP A;  1EXR A;  3S0F A;  2JZI A;  2WC5 A;  1NCX A;  2M8U A;  5AFP A;  1YUT A;  1NX0 A;  1TUJ A;  3BUX B;  2Y4Q A;  2MRD A;  1Y1U A;  1SSE B;  1VRK A;  3CZT X;  1SL7 A;  2F33 A;  4PCW A;  2NXQ A;  2OTG B;  4KYN A;  1SPY A;  1TWO A;  1J55 A;  1Y0V H;  3B6X A;  1OZO A;  2D8N A;  3N7H A;  4DUQ A;  3IQO A;  1Y1A A;  1S1E A;  3TDU A;  1M46 A;  1JWD A;  3S0D A;  1Z2C B;  4YBH B;  2NZ0 A;  5KTY A;  1LA0 A;  1LA3 A;  4NDB A;  2KFH A;  1EG4 A;  5HKZ A;  3LK0 A;  3DYE A;  4CFQ A;  1QWV A;  1CLL A;  2JQ6 A;  3I5G C;  2LLU A;  2QEH A;  3MSE B;  3R72 A;  4U8D A;  5I2O A;  1IQ3 A;  1N65 A;  5I94 A;  2CT9 A;  3I5G B;  3KO0 A;  1IGV A;  3CLN A;  3LCP C;  1OE9 B;  1OOH A;  4F7F A;  1UUS A;  2K61 A;  4MRY A;  1YUU A;  2JT3 A;  4XJK B;  1F54 A;  1C7V A;  1WY9 A;  1IG5 A;  2F2P A;  2K60 A;  3LL8 B;  4PHM A;  2LMU A;  1XFX O;  3DVJ A;  2Y5I A;  2MLE C;  5DKR A;  3EKH A;  3E3R A;  1SL9 A;  4INX A;  4MZK A;  2P70 A;  2KLE A;  3OHM B;  4OVN F;  2MHH A;  4PHK A;  1AK8 A;  3TUY C;  1Y6W A;  3CR4 X;  3PN7 C;  1DMO A;  2H8V A;  2WCM A;  1DJH A;  1FW4 A;  2F2O A;  3BYA A;  1K9U A;  2K7B A;  4N1F A;  3TUY B;  5D3O A;  2GGZ A;  4I5L B;  1KFX S;  3C1V A;  2BL0 B;  3TDZ A;  1NIW A;  4HRH A;  1K93 D;  3WNX B;  1BOC A;  1CNP A;  3NSK A;  1B7T Z;  3H4S E;  1CTR A;  2IS9 A;  1NP8 A;  3SS5 A;  1NPQ A;  4BY5 A;  1OOI X;  3I5I B;  2JC2 A;  1X02 A;  2RGI A;  4MZJ A;  2CTN A;  3VRP A;  2F3Y A;  1OOG A;  4OKH A;  2LM5 A;  1CKK A;  4BY4 A;  1YR5 A;  3CS1 A;  1MHO A;  1OSA A;  4FQO A;  1RRO A;  1RWY A;  1WRZ A;  1ZFS A;  2KHN A;  5D7F A;  1WRK A;  2KBM A;  3B86 A;  1U5I A;  1GQM A;  1MR8 A;  1UHK A;  5AEQ A;  1OOF A;  1YX8 A;  1CDN A;  5PAL A;  2EHB A;  1PSR A;  3QRX A;  1ZOT B;  3S0E A;  2K7O A;  4PDZ A;  1DJZ A;  4PT1 A;  2ZN8 A;  5CSI A;  3UNW A;  3DY9 A;  1KK7 Y;  5HKY A;  2A4J A;  2M29 A;  3BUN B;  3R1P A;  4IJ7 A;  1NX3 A;  4D1E A;  1DEL A;  1TTX A;  1REC A;  2CNP A;  1NUB A;  3CAB A;  4YGE B;  1NCZ A;  4HSZ A;  1ZMZ A;  1M31 A;  1SRA A;  1KQM B;  2BAP A;  2LLS A;  3WHT B;  1A29 A;  1BMO A;  1SCM C;  1CFD A;  3ZNI A;  1DC1 A;  4QJ5 B;  2K2F A;  3O4X A;  1OOJ A;  1RTP 1;  1GM0 A;  2ERB A;  5DKQ A;  4MEW A;  2LHL A;  1SCM B;  1L7Z A;  1YUS A;  2ZFD A;  4C0J A;  2O5G A;  4IL1 A;  3SG4 A;  2H61 C;  4FTG A;  1C3Y A;  1YTZ C;  3AAJ A;  1KSO A;  2Q91 A;  5D69 A;  1LIN A;  4GGF C;  1AUI B;  2H61 A;  4INW A;  3EK8 A;  3PAL A;  5G08 A;  3I5F C;  1XFU O;  1CM4 A;  3OB1 B;  1MXL C;  3FE9 A;  1G4Y R;  4GGF A;  1QX2 A;  2GGM A;  2WCB A;  1CFP A;  2KQY A;  2M0R A;  1RK9 A;  2L98 A;  3GOF A;  2SAS A;  3KHE A;  3PAT A;  3OX5 A;  4PE7 A;  1BT6 A;  1N2D A;  1CFF A;  1G33 A;  1H8B A;  1KFX L;  2L5Y A;  3OBV A;  1OZS A;  1V1F A;  4UPG A;  1DF0 B;  2GTE A;  2VRG A;  1LXF C;  2L2C A;  3A4U B;  1BG1 A;  2BKI B;  4E68 A;  2I18 A;  3FWB A;  1KK8 C;  2F8P A;  1QIW A;  1UUR A;  1KWO C;  2CBL A;  2G2B A;  3WHU B;  1JUO A;  1QAS A;  2K2A A;  3CTN A;  3NSO A;  1SL8 A;  1B8R A;  3CR5 X;  1KK8 B;  1F4Q A;  1K8U A;  1KWO B;  5AXI A;  2DOQ A;  2F3Z A;  1SW8 A;  4GUK A;  4A4C A;  2CCM A;  1CDM A;  3RLZ A;  1EG3 A;  1S6I A;  1DVI A;  4ZCV A;  2JTZ A;  2WC6 A;  1IQ5 A;  3IVT A;  1T14 A;  2O60 A;  3K21 A;  2ZND A;  1KFU S;  2L0P A;  3ZWH A;  1ZUZ A;  1FF1 A;  1YRU B;  4I5K A;  2M1U A;  4MN0 A;  4PE4 A;  2FCD A;  1BR1 B;  3BFA A;  4NQG A;  4YGA A;  3TS5 C;  1K2H A;  1QVI Y;  2H2K A;  5CPV A;  1MQ1 A;  3CWG A;  1QAT A;  2JNX A;  2E30 A;  3TS5 B;  1A2X A;  1K9P A;  1TRF A;  4WQ3 A;  3SIB A;  2L50 A;  5CSJ A;  4N1G A;  5JOL A;  2L4I A;  2QDI A;  2AMI A;  3GK2 A;  2KLD A;  3CZ1 A;  2M49 B;  1M45 A;  1CMF A;  2BBN A;  2MAZ A;  3JTD C;  4PE1 A;  1KSM A;  1SYM A;  4DS7 A;  3PFV A;  5KSZ A;  4ICB A;  1J7Q A;  1EJ3 A;  3I5H C;  5DKN A;  2BNX A;  4NDD A;  2LAN A;  2WOS A;  3RZS A;  5I8N A;  4YRU A;  5J3X A;  3VGO A;  3I5H B;  1HQV A;  3LK1 A;  1XK4 C;  1N0Y A;  3GK4 X;  2KYF A;  4JQ0 D;  1SCV A;  2JT8 A;  2M7L A;  4I5J A;  1WDC C;  2OPO A;  1XK4 A;  1DQE A;  1LS8 A;  3PN7 B;  2ISD A;  3IF7 A;  4GFT A;  1K95 A;  2BCA A;  1DJY A;  2HF5 A;  2ZRS A;  1TNQ A;  1J7R A;  3D74 A;  2YGU A;  1HT9 A;  1G8I A;  3BFH A;  2LV7 A;  5AAN A;  2JTT A;  2KGB C;  2PAS A;  1S5G Z;  4MZL A;  4P2Y B;  1F4O A;  1WLM A;  2Y1N A;  4ORB B;  1B8C A;  3D0Y A;  1UHI A;  2KOT A;  3CR2 A;  2LUC A;  2V53 A;  3D76 A;  3VRQ A;  3D77 A;  1BF5 A;  2ZKM X;  3CZ2 A;  4MSP A;  1S26 D;  1U5I B;  2NCO A;  3S0G A;  1MWN A;  2WCE A;  3O6B A;  2LC5 A;  1A75 A;  2JWW A;  1SK6 D;  1B7T Y;  3BOW A;  3NXA A;  3DVM A;  2PAL A;  3FWC A;  2GV5 A;  1CM1 A;  2QEO A;  2EC6 C;  3O2P A;  1K96 A;  3K1E A;  3D73 A;  4YGC B;  2K0J A;  4GAO A;  1MF8 B;  1W7J B;  2LVI A;  2HET A;  2LVJ A;  2QEB A;  2ZRT A;  4N5X A;  1KFU L;  3SG3 A;  1AHR A;  1K9K A;  1J7P A;  2JPT A;  2MJW B;  1J7O A;  2WCF A;  3CZ0 A;  1BU3 A;  3L47 A;  2MLF C;  1QLS A;  1AJ4 A;  3BQ3 A;  3OGN A;  2TN4 A;  3EKJ A;  3L4A A;  1PVB A;  1TCO B;  1YVL A;  1F8H A;  3OX6 A;  1OW4 A;  3SIA A;  3UO9 A;  3PM2 A;  1CDP A;  2COL B;  3SG6 A;  1C07 A;  1B9A A;  3BFB A;  4GGN A;  1F55 A;  3PSR A;  5B8I B;  4M2P A;  5F6T A;  1F70 A;  1PUL A;  2WC8 A;  1QXP A;  1SY9 A;  1SBJ A;  1NX1 A;  4I5N B;  1JC2 A;  4TNC A;  1JSA A;  4MVF A;  4PHJ A;  1CLM A;  1Y1X A;  1BR4 B;  5HYD A;  1P28 A;  4OR9 B;  3I5F B;  3O78 A;  1IJ5 A;  3KPX A;  5CSN A;  1L2O C;  2P6B B;  3ICB A;  2LHI A;  1AJ5 A;  4QJ3 B;  2B1U A;  1CMG A;  1S36 A;  3DD4 A;  4C0K A;  1QTX A;  3CGA A;  4YGB B;  5K89 A;  1UHN A;  1XO5 A;  5JJG A;  1J1D A;  1B8L A;  1WRL A;  2JT0 A;  5TNC A;  3HX4 A;  2HPS A;  2FJU B;  1S3P A;  3EG5 B;  3OP0 A;  2EGD A;  2AAO A;  2KYC A;  3IQQ A;  3F45 A;  1FI6 A;  4R1E A;  1S6J A;  1S6C A;  5AER A;  1OMV A;  1SNL A;  1BJF A;  1KCY A;  2QPT A;  2BE6 A;  1W7I B;  1OMD A;  3EVV A;  5HL1 A;  2KAV A;  3D10 A;  4OCI A;  5HLO A;  1B4C A;  1PK0 D;  2LNK A;  2LP2 A;  1TN4 A;  3FS7 A;  3CDN A;  2KI6 C;  4CFR A;  1J1E A;  2KFG A;  2KNE A;  2QEV A;  4FQT A;  4YI8 A;  3JVT C;  4JWQ A;  3CYZ A;  1IKU A;  1JF2 A;  1PAL A;  1OMR A;  1UP5 A;  1XYD A;  4XYN A;  1DJG A;  2FOT A;  2MBX A;  2KAX A;  3JVT B;  5ER5 A;  2K7D A;  2KAY A;  3R1O A;  3DVK A;  2KGR A;  5DIC A;  4C0L A;  2BKH B;  4ORA B;  2JXL A;  4ZCU A;  1QV1 A;  1B47 A;  1QX5 B;  1Z4H A;  2OTG C;  2G9B A;  2L4H A;  3D78 A;  3WXA A;  1BLQ A;  3Q8I A;  4DRW A;  4QJ4 B;  4JKT A;  4M2Q A;  1ALW A;  1TIZ A;  1QV0 A;  2L5X B;  2ZNE A;  2LLT A;  3NGV A;  2LCP A;  1RJV A;  1EH2 A;  1MUX A;  3JTD B;  3SJS A;  2K8M B;  1R2U A;  1YX7 A;  1ORG A;  2M97 A;  1NYA A;  1TNX A;  3B87 A;  2I7A A;  2WND A;  1ALV A;  3HCM A;  3VRR A;  1CDL A;  1UHH A;  3BXK A;  1B1G A;  3B7A A;  2BEC A;  2LE9 B;  1M63 B;  2M3W A;  3FE6 A;  1LKJ A;  1ODB A;  4M2O A;  1XFY O;  2M7N A;  2PYQ A;  1IIO A;  1SR6 C;  2FJY A;  3PLF B;  1XVJ A;  1DTL A;  2KFF A;  4OV2 A;  4MLW A;  3AKB A;  4PE0 A;  4XJK A;  3O4Y A;  1DT7 B;  3KEV A;  1YRT B;  1SR6 B;  1DGU A;  2HQW A;  2LP3 A;  1WDC B;  1QX7 A;  1V1G A;  1NSH A;  2I2R E;  3BUM B;  4DIR A;  1E8A A;  2WCJ A;  3SG2 A;  2LUX A;  1TUZ A;  2LAP A;  2LVV A;  3BJH A;  1KQV A;  2KQ6 A;  2QAC A;  1OQP A;  1C7W A;  2KSP A;  5ER4 X;  2R2I A;  1TNW A;  3BUW B;  3GK1 A;  2KPH A;  3M0W A;  3DXL A;  3EVR A;  2WCH A;  5KU1 A;  3D0Y B;  1K90 D;  2BE4 A;  2BL0 C;  4HRE E;  1IH0 A;  2FCE A;  3S0A A;  4CLN A;  3FE8 A;  3SS4 A;  2PVB A;  3TZ1 A;  2JPO A;  1UHJ A;  2PQL A;  4ORC B;  5HKW A;  1PVA A;  1PSB A;  4AOM A;  3QME A;  2KDH A;  1A75 B;  4PHN A;  5FI2 A;  1DJW A;  3I5I C;  3BOW B;  4NDC A;  4HRG A;  1QJT A;  1YVH A;  1TCF A;  5FYX A;  1GGW A;  1R6P A;  5I2Q A;  1JFK A;  5I2L A;  3DVE A;  4JD9 A;  4MRX A;  1AP4 A;  3DF0 B;  1IWQ A;  1NX2 A;  1S5G Y;  3DF0 A;  1KK7 Z;  3VRO A;  1YUR A;  2NCP A;  4GNK B;  1M39 A;  4ETO A;  2JXC A;  2EC6 B;  2BCB A;  1IJ6 A;  2P71 A;  2Y1M A;  1BOD A;  3L4L A;  3AAK A;  2KI4 C; 
#chains in the Genus database with same CATH homology
 1NCY A;  2E6W A;  5GQQ C;  2BBM A;  1QIV A;  3BUO B;  4GBA A;  4USL A;  4WRI A;  3NSL A;  2KI4 B;  4A4B A;  1XFW O;  1JFJ A;  4MBE A;  1AVS A;  1MXE A;  2KBI A;  2LMV A;  3EVU A;  1DJX A;  2ZN9 A;  4DCK A;  1A4P A;  1JBA A;  2NLN A;  1SKT A;  4P5O E;  4CID A;  2AUC A;  4JPZ B;  2WOR A;  4YGD B;  1EL4 A;  2HQ8 A;  1XFZ O;  2M9G A;  5HLV A;  1CLB A;  3VRN A;  3SG7 A;  1KQM C;  4AQJ A;  1CFC A;  1XFV O;  2OS8 C;  5IBW A;  1CB1 A;  1PRW A;  4GPL B;  2CXJ A;  2I94 A;  3EK7 A;  2JOJ A;  3EK4 A;  1K94 A;  1UWO A;  2OS8 B;  3AKA A;  1DGV A;  3RM1 A;  1WLZ A;  1JF0 A;  1F71 A;  1GGZ A;  1TOP A;  5CSF A;  2PSR A;  3SG5 A;  1L2O B;  3TDI A;  1ZAC A;  4AQI A;  1SMG A;  4CPV A;  1FPW A;  4F0Z B;  1QS7 A;  1RFJ A;  1A03 A;  2L51 A;  1Q80 A;  1QLK A;  3PM8 A;  3KF9 A;  3A8R A;  4WQ2 A;  4YI9 A;  2LVK A;  2SCP A;  1FBV A;  1LVC D;  3NSI A;  2BCX A;  2PMY A;  2JNF A;  1IRJ A;  5BPJ A;  2L2E A;  1GJY A;  1XA5 A;  2KI6 D;  3FIA A;  4L9M A;  2JRF A;  2JUL A;  4Q04 A;  1D1O A;  1DF0 A;  2PRU A;  3LLE A;  3OB2 B;  4PAL A;  1H4B A;  2JU0 A;  1DJI A;  1NWD A;  2LMT A;  2Q4U A;  1FI5 A;  2M1K B;  1QVI Z;  2MA2 A;  2K7C A;  1TNP A;  1EXR A;  2JZI A;  1NCX A;  2M8U A;  5AFP A;  1YUT A;  1NX0 A;  3BUX B;  2Y4Q A;  2MRD A;  1Y1U A;  1VRK A;  3CZT X;  1SL7 A;  2F33 A;  4PCW A;  2NXQ A;  2OTG B;  1SPY A;  1J55 A;  1Y0V H;  1OZO A;  2D8N A;  4DUQ A;  3IQO A;  1Y1A A;  1S1E A;  3TDU A;  1M46 A;  1JWD A;  4YBH B;  2NZ0 A;  5KTY A;  1LA0 A;  1LA3 A;  4NDB A;  2KFH A;  1EG4 A;  5HKZ A;  3LK0 A;  4CFQ A;  1CLL A;  2JQ6 A;  3I5G C;  2LLU A;  5I2O A;  3MSE B;  4U8D A;  1IQ3 A;  1N65 A;  2CT9 A;  3I5G B;  3KO0 A;  1IGV A;  3CLN A;  3LCP C;  1OE9 B;  1UUS A;  2K61 A;  4MRY A;  1YUU A;  2JT3 A;  4XJK B;  1F54 A;  1C7V A;  1WY9 A;  1IG5 A;  2F2P A;  3LL8 B;  4PHM A;  2LMU A;  1XFX O;  3DVJ A;  2Y5I A;  2MLE C;  5DKR A;  3EKH A;  3E3R A;  1SL9 A;  4MZK A;  3OHM B;  4OVN F;  2MHH A;  4PHK A;  1AK8 A;  3TUY C;  1Y6W A;  3CR4 X;  3PN7 C;  1DMO A;  1DJH A;  1FW4 A;  2F2O A;  3BYA A;  1K9U A;  2K7B A;  4N1F A;  3TUY B;  2GGZ A;  4I5L B;  1KFX S;  3C1V A;  2BL0 B;  3TDZ A;  1NIW A;  4HRH A;  1K93 D;  3WNX B;  1BOC A;  1CNP A;  3NSK A;  1B7T Z;  3H4S E;  1CTR A;  2IS9 A;  1NP8 A;  1NPQ A;  4BY5 A;  3I5I B;  2JC2 A;  1X02 A;  2RGI A;  4MZJ A;  2CTN A;  3VRP A;  2F3Y A;  4OKH A;  2LM5 A;  1CKK A;  4BY4 A;  1YR5 A;  3CS1 A;  1MHO A;  1OSA A;  4FQO A;  1RRO A;  1RWY A;  1WRZ A;  1ZFS A;  2KHN A;  5D7F A;  1WRK A;  2KBM A;  1U5I A;  1GQM A;  1MR8 A;  1UHK A;  5AEQ A;  1CDN A;  1YX8 A;  5PAL A;  2EHB A;  1PSR A;  3QRX A;  1ZOT B;  2K7O A;  4PDZ A;  1DJZ A;  2ZN8 A;  5CSI A;  1KK7 Y;  5HKY A;  2A4J A;  2M29 A;  3BUN B;  1NX3 A;  4D1E A;  1TTX A;  1REC A;  2CNP A;  1NUB A;  4YGE B;  1NCZ A;  4HSZ A;  1ZMZ A;  1M31 A;  1SRA A;  1KQM B;  2LLS A;  3WHT B;  1A29 A;  1BMO A;  1SCM C;  1CFD A;  3ZNI A;  4QJ5 B;  2K2F A;  1OOJ A;  1RTP 1;  5DKQ A;  4MEW A;  2LHL A;  1SCM B;  1L7Z A;  1YUS A;  2ZFD A;  4C0J A;  2O5G A;  4IL1 A;  3SG4 A;  2H61 C;  4FTG A;  1YTZ C;  3AAJ A;  1KSO A;  2Q91 A;  5D69 A;  1LIN A;  4GGF C;  1AUI B;  2H61 A;  3EK8 A;  3PAL A;  5G08 A;  3I5F C;  1XFU O;  1CM4 A;  3OB1 B;  1MXL C;  1G4Y R;  4GGF A;  1QX2 A;  2GGM A;  2WCB A;  1CFP A;  2KQY A;  2M0R A;  1RK9 A;  2L98 A;  3GOF A;  2SAS A;  3KHE A;  3PAT A;  3OX5 A;  4PE7 A;  1BT6 A;  1N2D A;  1CFF A;  1G33 A;  1H8B A;  1KFX L;  1OZS A;  1V1F A;  4UPG A;  1DF0 B;  1BG1 A;  2VRG A;  1LXF C;  3A4U B;  2BKI B;  4E68 A;  2I18 A;  3FWB A;  1KK8 C;  2F8P A;  1QIW A;  1UUR A;  1KWO C;  2CBL A;  2G2B A;  3WHU B;  1JUO A;  1QAS A;  2K2A A;  3CTN A;  3NSO A;  1SL8 A;  1B8R A;  3CR5 X;  1KK8 B;  1F4Q A;  1K8U A;  1KWO B;  5AXI A;  2DOQ A;  2F3Z A;  1SW8 A;  4GUK A;  4A4C A;  2CCM A;  1CDM A;  3RLZ A;  1EG3 A;  1S6I A;  1DVI A;  4ZCV A;  2JTZ A;  1IQ5 A;  3K21 A;  2O60 A;  2ZND A;  1KFU S;  2L0P A;  3ZWH A;  1ZUZ A;  1FF1 A;  1YRU B;  4I5K A;  2M1U A;  4MN0 A;  4PE4 A;  2FCD A;  1BR1 B;  4YGA A;  4NQG A;  3TS5 C;  1K2H A;  1QVI Y;  2H2K A;  5CPV A;  1MQ1 A;  3CWG A;  1QAT A;  2JNX A;  2E30 A;  3TS5 B;  1A2X A;  1K9P A;  1TRF A;  4WQ3 A;  3SIB A;  2L50 A;  5CSJ A;  4N1G A;  5JOL A;  2L4I A;  2AMI A;  3GK2 A;  2M49 B;  1M45 A;  1CMF A;  2BBN A;  2MAZ A;  3JTD C;  4PE1 A;  1KSM A;  1SYM A;  4DS7 A;  3PFV A;  5KSZ A;  4ICB A;  1J7Q A;  1EJ3 A;  3I5H C;  5DKN A;  4NDD A;  2LAN A;  2WOS A;  5I8N A;  4YRU A;  5J3X A;  3VGO A;  3I5H B;  1HQV A;  3LK1 A;  1XK4 C;  1N0Y A;  3GK4 X;  2KYF A;  4JQ0 D;  1SCV A;  2JT8 A;  2M7L A;  4I5J A;  1WDC C;  2OPO A;  1XK4 A;  3PN7 B;  2ISD A;  3IF7 A;  4GFT A;  1K95 A;  2BCA A;  1DJY A;  2HF5 A;  2ZRS A;  1TNQ A;  1J7R A;  1HT9 A;  1G8I A;  2LV7 A;  5AAN A;  2JTT A;  2KGB C;  2PAS A;  1S5G Z;  4MZL A;  4P2Y B;  1F4O A;  1WLM A;  2Y1N A;  4ORB B;  1B8C A;  3D0Y A;  1UHI A;  2KOT A;  3CR2 A;  2LUC A;  2V53 A;  3VRQ A;  1BF5 A;  2ZKM X;  4MSP A;  1S26 D;  1U5I B;  2NCO A;  1MWN A;  2WCE A;  3O6B A;  2LC5 A;  1A75 A;  2JWW A;  1SK6 D;  1B7T Y;  3BOW A;  3NXA A;  3DVM A;  2PAL A;  3FWC A;  2GV5 A;  1CM1 A;  2EC6 C;  3O2P A;  1K96 A;  4YGC B;  2K0J A;  4GAO A;  1MF8 B;  1W7J B;  2LVI A;  2HET A;  2LVJ A;  2ZRT A;  4N5X A;  1KFU L;  3SG3 A;  1AHR A;  1K9K A;  1J7P A;  2JPT A;  2MJW B;  1J7O A;  2WCF A;  1BU3 A;  2MLF C;  1QLS A;  1AJ4 A;  3BQ3 A;  2TN4 A;  3EKJ A;  1PVB A;  1TCO B;  1YVL A;  1F8H A;  3OX6 A;  3SIA A;  1CDP A;  2COL B;  3SG6 A;  1C07 A;  1B9A A;  4GGN A;  1F55 A;  3PSR A;  5B8I B;  4M2P A;  5F6T A;  1F70 A;  1PUL A;  2WC8 A;  1QXP A;  1SY9 A;  1SBJ A;  1NX1 A;  4I5N B;  1JC2 A;  4TNC A;  1JSA A;  4MVF A;  4PHJ A;  1CLM A;  1Y1X A;  1BR4 B;  5HYD A;  4OR9 B;  3I5F B;  3O78 A;  1IJ5 A;  3KPX A;  5CSN A;  1L2O C;  2P6B B;  3ICB A;  2LHI A;  1AJ5 A;  4QJ3 B;  2B1U A;  1CMG A;  1S36 A;  3DD4 A;  4C0K A;  1QTX A;  3CGA A;  4YGB B;  5K89 A;  1UHN A;  1XO5 A;  5JJG A;  1J1D A;  1B8L A;  1WRL A;  2JT0 A;  5TNC A;  3HX4 A;  2HPS A;  2FJU B;  1S3P A;  3OP0 A;  2EGD A;  2AAO A;  2KYC A;  3IQQ A;  3F45 A;  1FI6 A;  4R1E A;  1S6J A;  1S6C A;  5AER A;  1OMV A;  1SNL A;  1BJF A;  1KCY A;  2QPT A;  2BE6 A;  1W7I B;  1OMD A;  3EVV A;  2KAV A;  3D10 A;  4OCI A;  5HLO A;  1B4C A;  1PK0 D;  2LNK A;  2LP2 A;  1TN4 A;  3FS7 A;  2KI6 C;  4CFR A;  1J1E A;  2KFG A;  2KNE A;  4YI8 A;  3JVT C;  4JWQ A;  1IKU A;  1JF2 A;  1PAL A;  1OMR A;  1UP5 A;  1XYD A;  4XYN A;  1DJG A;  2FOT A;  2MBX A;  2KAX A;  3JVT B;  5ER5 A;  2K7D A;  2KAY A;  3DVK A;  2KGR A;  4C0L A;  2BKH B;  4ORA B;  2JXL A;  4ZCU A;  1QV1 A;  1B47 A;  1QX5 B;  2OTG C;  3WXA A;  2G9B A;  2L4H A;  1BLQ A;  4DRW A;  4QJ4 B;  4M2Q A;  1ALW A;  1TIZ A;  1QV0 A;  2L5X B;  2ZNE A;  2LLT A;  2LCP A;  1RJV A;  1EH2 A;  1MUX A;  3JTD B;  3SJS A;  2K8M B;  1R2U A;  1YX7 A;  2M97 A;  1NYA A;  1TNX A;  2I7A A;  2WND A;  1ALV A;  3HCM A;  3VRR A;  1CDL A;  1UHH A;  3BXK A;  1B1G A;  2BEC A;  2LE9 B;  1M63 B;  2M3W A;  1LKJ A;  1ODB A;  4M2O A;  1XFY O;  2M7N A;  1SR6 C;  3PLF B;  1XVJ A;  1DTL A;  2KFF A;  4OV2 A;  4MLW A;  3AKB A;  4PE0 A;  4XJK A;  3O4Y A;  1DT7 B;  3KEV A;  1YRT B;  1SR6 B;  1DGU A;  2HQW A;  2LP3 A;  1WDC B;  1QX7 A;  1V1G A;  1NSH A;  2I2R E;  3BUM B;  4DIR A;  1E8A A;  3SG2 A;  2LUX A;  2LAP A;  2LVV A;  1KQV A;  2KQ6 A;  2QAC A;  1OQP A;  1C7W A;  2KSP A;  5ER4 X;  2R2I A;  1TNW A;  3BUW B;  3GK1 A;  3M0W A;  3EVR A;  5KU1 A;  3D0Y B;  1K90 D;  2BE4 A;  2BL0 C;  4HRE E;  1IH0 A;  2FCE A;  4CLN A;  2PVB A;  3TZ1 A;  1UHJ A;  4ORC B;  5HKW A;  1PVA A;  1PSB A;  4AOM A;  2KDH A;  1A75 B;  4PHN A;  1DJW A;  3I5I C;  3BOW B;  4NDC A;  4HRG A;  1QJT A;  1TCF A;  1YVH A;  5FYX A;  1GGW A;  1R6P A;  5I2Q A;  1JFK A;  5I2L A;  3DVE A;  4MRX A;  1AP4 A;  3DF0 B;  1IWQ A;  1NX2 A;  1S5G Y;  3DF0 A;  1KK7 Z;  3VRO A;  1YUR A;  2NCP A;  4GNK B;  1M39 A;  4ETO A;  2JXC A;  2EC6 B;  2BCB A;  1IJ6 A;  2Y1M A;  1BOD A;  3AAK A;  2KI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...