2OS8C

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 37
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C02
2O5GA 4I5LB 2WOSA 4MZJA 1SNLA 1X02A 3D10A 1S1EA 5GQQC 1YVHA 1S5GZ 2GV5A 3VROA 5CSIA 1J1EA 1UHNA 1CDMA 1IWQA 2JXLA 4I5NB 1QVIZ 2KGBC 1WDCC 1LVCD 5PALA 4BY4A 1PULA 1ODBA 3CWGA 4GAOA 1DTLA 1CTRA 2ZNEA 1DJIA 3EVVA 2M97A 2K7DA 2WCEA 5AXIA 4YGBB 2RGIA 1K8UA 3BXKA 3ICBA 3O6BA 2LM5A 1YX8A 4HRHA 3FS7A 1DMOA 2K7OA 4Q04A 1WRZA 1DF0A 4ORBB 1J7OA 1HT9A 3I5GC 4YGAA 1SW8A 3JVTC 2G9BA 2NCPA 2KI6C 3BYAA 4F0ZB 1F70A 1XFUO 2AMIA 2OS8C 3DF0B 1UUSA 2F3ZA 4MN0A 3EKHA 1YX7A 3FWCA 4OCIA 3OB1B 1PRWA 3TS5C 2KGRA 2E30A 4N1FA 2KQYA 5HKYA 1A29A 3E3RA 1CFFA 1Y1AA 2Q4UA 5CSFA 2PALA 3AAKA 3F45A 1IGVA 3LK1A 4XYNA 2R2IA 1ALVA 2ZN9A 4YBHB 2EC6B 3FIAA 1GJYA 3I5HB 4XJKB 5CSNA 3EK7A 1LINA 2KI6D 4PE7A 4PDZA 2K2FA 1B7TY 4QJ3B 3CR4X 3GOFA 2BCAA 1U5IB 1WRKA 5D7FA 5KSZA 1GGZA 1PVAA 1ALWA 2CNPA 2MRDA 4YI8A 2CXJA 1B8LA 1G33A 2OTGC 1L2OC 2I18A 2NCOA 1RJVA 4MVFA 4DRWA 2FCDA 1K9UA 3OX5A 2QACA 2LLSA 2MHHA 4PHMA 1OMVA 2NZ0A 5DKNA 3TDIA 1K94A 4R1EA 2M7NA 1F54A 1TOPA 2SCPA 1KQVA 3EKJA 1B7TZ 3RM1A 4MRXA 2BKIB 1KWOC 1NX1A 2D8NA 3DD4A 3SIAA 1EL4A 2H2KA 2TN4A 2KI4B 2LMUA 1SPYA 5HLOA 5I8NA 3LCPC 4PE0A 1K2HA 1CDNA 1JC2A 1KCYA 2JT3A 2L4HA 1XA5A 4NQGA 4PHNA 1IG5A 2JU0A 2ZRSA 3RLZA 1SCMC 1AVSA 1MQ1A 1XFZO 2PMYA 2COLB 5AANA 2ISDA 1UHJA 4MSPA 1QXPA 1NUBA 3OP0A 1KK7Y 3KEVA 2LANA 3GK4X 1QTXA 5F6TA 2KNEA 1TNPA 4ORCB 3CLNA 4HSZA 2JC2A 4ORAB 1MF8B 4CFQA 4PCWA 4A4BA 4MEWA 1G8IA 5AEQA 2M1UA 3D0YB 2MLFC 2JTTA 4MZLA 4P5OE 2JULA 2JZIA 2OS8B 3LL8B 1CM4A 4OVNF 1MHOA 4ETOA 1TN4A 1UP5A 1IKUA 1S5GY 1ZACA 1UHHA 2FJUB 3O78A 2LVJA 1NCYA 1SKTA 2Q91A 4WQ3A 1DJZA 1V1FA 1SY9A 1CDPA 1OQPA 1CFDA 1KK7Z 2Y1MA 1K95A 2VRGA 3OX6A 1DVIA 4DIRA 1J7RA 2PRUA 1OSAA 1CM1A 1SL9A 2LC5A 3KHEA 1KSOA 1KQMC 1XO5A 1M31A 2Y4QA 2KYCA 1S36A 1LA3A 1SR6B 1XFYO 3I5FC 2MA2A 1AJ4A 1NCXA 3A8RA 2LLTA 1RECA 1TNXA 4CLNA 1FF1A 1TNQA 1B4CA 1SBJA 3AAJA 2L5XB 1QV0A 2CCMA 2SASA 4QJ4B 4GGFA 1NPQA 4A4CA 1K9KA 1WLZA 4FTGA 5I2QA 1SCVA 2KHNA 1JF0A 2WNDA 3TUYC 1B1GA 1MUXA 1DF0B 2KAYA 3LK0A 1UURA 5DKQA 2MBXA 3BQ3A 1DJYA 1CMGA 2CTNA 2HQWA 1BR4B 3I5IB 1G4YR 1F71A 4AQJA 1N2DA 1D1OA 1RFJA 4ICBA 1QASA 3CS1A 3SG2A 1J7PA 1UWOA 3CZTX 1JWDA 3O2PA 1KFXS 1B9AA 1PSRA 1TCOB 1W7IB 1F55A 2M8UA 1A4PA 3AKAA 1BJFA 2HQ8A 2JQ6A 2KFFA 1FI6A 1H8BA 3PN7B 2JT0A 2KYFA 3DVJA 1C07A 1YR5A 1H4BA 1A75A 3IQOA 1JSAA 2WORA 3HX4A 2M1KB 4CFRA 2LE9B 2I2RE 1DGUA 1AUIB 1YUSA 5J3XA 1DGVA 2KFGA 1F8HA 2MJWB 1KK8B 2KAXA 1UHIA 4WRIA 3BOWA 4OR9B 4CIDA 4NDCA 4PHKA 1M63B 4GGFC 3LLEA 5JOLA 4DS7A 1FBVA 2LMTA 2WC8A 2ZNDA 1N65A 2L50A 2JRFA 2K2AA 1XFXO 2LVKA 2K61A 1QJTA 2BL0B 1CLBA 1UHKA 1OOJA 1K9PA 3C1VA 3JTDC 1SK6D 1IJ5A 3H4SE 5B8IB 2E6WA 4IL1A 3PM8A 4GNKB 3VRRA 3HCMA 5ER5A 2BCXA 1CLLA 1CLMA 1Y1UA 4I5KA 1WY9A 2KBMA 1YRTB 2KDHA 1CDLA 2HPSA 1S6CA 2M0RA 4JQ0D 4UPGA 1NSHA 1WDCB 1R6PA 1DJWA 1B47A 1C7VA 2BBNA 1BF5A 2KOTA 1OZOA 1TCFA 2LHIA 1DJGA 1B8RA 1MWNA 2L51A 3CR5X 1QX2A 5DKRA 3GK1A 1SL8A 1N0YA 1PALA 1XFVO 2JNFA 1NCZA 2LUXA 1XYDA 2P6BB 1GGWA 3I5GB 1AP4A 1PSBA 3JVTB 1JUOA 4M2PA 4PHJA 1NX3A 3EK4A 3CGAA 3KO0A 1C7WA 5AERA 2F33A 4E68A 5HKZA 2Y5IA 3TS5B 2FCEA 4PE4A 1IH0A 2PSRA 3BUXB 2K0JA 2BE4A 3NSIA 4ZCUA 2LHLA 1IRJA 2K8MB 2KFHA 1V1GA 1XK4C 2M3WA 4MBEA 2B1UA 2EC6C 2F2OA 3TDZA 3I5HC 1F4QA 2A4JA 2JT8A 4GBAA 2JPTA 5D69A 2WCFA 1CFPA 3VGOA 3NSKA 2LUCA 2LVIA 1F4OA 1MR8A 3K21A 1OMRA 1AK8A 1K90D 1IQ5A 1Y6WA 1DJXA 2OTGB 3SG7A 1A2XA 4JWQA 1L2OB 3DVMA 5FYXA 1YUTA 1AHRA 1XVJA 1Y1XA 2EHBA 5HLVA 3NSOA 3O4YA 1SYMA 1KFXL 2LNKA 2MLEC 1KFUS 1GQMA 2FOTA 3MSEB 2EGDA 2F3YA 3PLFB 1YTZC 2JOJA 1JFJA 2AUCA 1EJ3A 1QS7A 4NDBA 5HKWA 1KWOB 1J1DA 2K7CA 4AQIA 2BCBA 2H61C 4C0KA 4MZKA 1OMDA 2KI4C 4WQ2A 3TDUA 3OB2B 1EG3A 2GGMA 1QV1A 5G08A 4HREE 3PFVA 3SG6A 3M0WA 1SL7A 1WRLA 3ZNIA 4YGCB 1M45A 1K93D 2OPOA 2M7LA 1SCMB 3SJSA 4M2OA 1A75B 3VRQA 4DUQA 1A03A 3BUNB 5TNCA 1BG1A 1QLSA 1S3PA 1JF2A 1W7JB 3BUOB 2CBLA 1ZFSA 1QLKA 4MLWA 1IQ3A 2BBMA 4USLA 2KBIA 1LKJA 1TRFA 1OZSA 4ZCVA 5AFPA 1MXLC 1LXFC 1YVLA 4YI9A 1FI5A 1BR1B 3WHTB 3BOWB 1JBAA 2M9GA 1J55A 1NYAA 1QX5B 4MRYA 3PSRA 3DF0A 1J7QA 1EH2A 2LAPA 2KSPA 1NIWA 1QIVA 4QJ5B 4YGDB 1PVBA 2LMVA 3CTNA 1Y0VH 5I2LA 1PK0D 2ZRTA 4U8DA 2NXQA 1NX2A 4PE1A 2AAOA 1DJHA 4C0JA 3NSLA 1XK4A 1TTXA 1M46A 1KQMB 1YRUB 3WHUB 3CR2A 2K7BA 4XJKA 3EK8A 2JTZA 1SR6C 4N1GA 5I2OA 3I5FB 5CSJA 2LVVA 1U5IA 3OHMB 3WXAA 4OV2A 1Q80A 2F8PA 2JNXA 2V53A 3DVEA 1WLMA 1YUUA 2HETA 2M29A 5CPVA 4HRGA 3WNXB 2M49B 2ZN8A 4YGEB 2LLUA 2BECA 1EXRA 1QX7A 4NDDA 2LP3A 3SIBA 4D1EA 3QRXA 2KAVA 5JJGA 1BLQA 1ZOTB 1NP8A 1CNPA 2L98A 3GK2A 3SG4A 3TUYB 4AOMA 1CKKA 3SG3A 5K89A 4N5XA 1LA0A 2L4IA 3BUWB 2I94A 2NLNA 5HYDA 2JWWA 3ZWHA 1FPWA 3PALA 1BT6A 2L0PA 3I5IC 1BOCA 2PASA 2PVBA 3DVKA 3VRPA 3IQQA 1DT7B 3BUMB 4C0LA 2H61A 1FW4A 2CT9A 5BPJA 3VRNA 3JTDB 1QIWA 3A4UB 4GUKA 1HQVA 2F2PA 3AKBA 3NXAA 4YRUA 1S6JA 2L2EA 2KQ6A 1KSMA 4FQOA 1CB1A 3SG5A 1AJ5A 4JPZB 3PN7C 1OE9B 1BODA 1E8AA 1RK9A 2QPTA 3EVUA 2LP2A 1NWDA 1K96A 1ZMZA 2Y1NA 1CFCA 4M2QA 1YURA 3IF7A 2G2BA 1BMOA 1RTP1 1L7ZA 1EG4A 2I7AA 1KFUL 1XFWO 1IJ6A 2HF5A 4I5JA 3EVRA 1JFKA 3KF9A 2BE6A 5KU1A 2MAZA 4P2YB 1M39A 3PATA 2JXCA 1VRKA 2IS9A 5KTYA 2O60A 3D0YA 1KK8C 4GPLB 1MXEA 4PALA 1R2UA 1BU3A 3TZ1A 4DCKA 5IBWA 1SRAA 2LV7A 2WCBA 1B8CA 2BKHB 4L9MA 1CMFA 1TNWA 1ZUZA 1NX0A 5ER4X 2ZKMX 3FWBA 1QVIY 4BY5A 1SMGA 2DOQA 1TIZA 2LCPA 4GFTA 4CPVA 1RWYA 3KPXA 1RROA 1S26D 4OKHA 4GGNA 4TNCA 1S6IA 2BL0C 1QATA 2GGZA 2ZFDA
chains in the Genus database with same CATH superfamily
2O5GA 4I5LB 2WOSA 4MZJA 1SNLA 1X02A 3D10A 1S1EA 5GQQC 1YVHA 1S5GZ 2GV5A 3VROA 5CSIA 1J1EA 1UHNA 1CDMA 1IWQA 2JXLA 4I5NB 1QVIZ 2KGBC 1WDCC 1LVCD 1T14A 5PALA 4BY4A 1PULA 1ODBA 3CWGA 4GAOA 1DTLA 3CYZA 1CTRA 2ZNEA 1DJIA 3EVVA 2M97A 2K7DA 2WCEA 5AXIA 4YGBB 2RGIA 1K8UA 3BXKA 3ICBA 5EL2A 3O6BA 2LM5A 1YX8A 3NGVA 3FS7A 4HRHA 1DMOA 1OW4A 2K7OA 3PJIA 4Q04A 1WRZA 1Z4HA 1DF0A 4PT1A 4ORBB 1J7OA 1HT9A 1OOGA 3I5GC 4YGAA 1SW8A 3JVTC 2G9BA 3UO9A 2NCPA 2KI6C 3BYAA 4F0ZB 1F70A 1DEKA 1XFUO 2AMIA 2OS8C 3DF0B 3UNWA 1UUSA 2F3ZA 4MN0A 3EKHA 1YX7A 3FWCA 3B86A 3OB1B 1PRWA 4OCIA 3TS5C 2KGRA 2E30A 4N1FA 2KQYA 5HKYA 1A29A 3E3RA 1CFFA 1Y1AA 2Q4UA 5CSFA 2GTEA 2PALA 3AAKA 1IGVA 3DZTA 3F45A 3LK1A 3PM2A 4XYNA 2R2IA 1OOIX 5D3OA 1ALVA 2ZN9A 4YBHB 2EC6B 3FIAA 1GJYA 3I5HB 4XJKB 5CSNA 3EK7A 1LINA 2KI6D 3D77A 4PE7A 4PDZA 2K2FA 1B7TY 4QJ3B 3CR4X 3GOFA 2BCAA 1U5IB 1WRKA 5D7FA 5KSZA 1GGZA 1PVAA 1ALWA 2CNPA 2MRDA 4YI8A 5I94A 2CXJA 1B8LA 3S0FA 1G33A 2OTGC 3B7AA 1L2OC 2I18A 2NCOA 1RJVA 4MVFA 4DRWA 2FCDA 1K9UA 3OX5A 2QACA 2LLSA 2MHHA 2WCKA 3OGNA 4PHMA 1OMVA 3BFBA 2NZ0A 3D73A 5DKNA 1K94A 3FE6A 4IJ7A 4R1EA 2M7NA 3TDIA 3NHIA 1F54A 1TOPA 2SCPA 1KQVA 3EKJA 1B7TZ 3RM1A 4MRXA 2BKIB 1KWOC 1NX1A 2D8NA 3D76A 3DD4A 3SIAA 1OOHA 1EL4A 3BJHA 2H2KA 2TN4A 3K1EA 2KI4B 2LMUA 5FI7A 1SPYA 5HLOA 5I8NA 3LCPC 4PE0A 1K2HA 1CDNA 1JC2A 1KCYA 2JT3A 2L4HA 1XA5A 4NQGA 4PHNA 1IG5A 2JU0A 2ZRSA 3RLZA 1SCMC 1AVSA 1MQ1A 1XFZO 2PMYA 2COLB 5AANA 2ISDA 1UHJA 4MSPA 1QXPA 3NHTA 1NUBA 3OP0A 1KK7Y 3KEVA 2LANA 2QEOA 3GK4X 1QTXA 5F6TA 2KNEA 1TNPA 2ERBA 4ORCB 3CLNA 4HSZA 2JC2A 4ORAB 1MF8B 4CFQA 4PCWA 4A4BA 4MEWA 1G8IA 5AEQA 2M1UA 3D0YB 2MLFC 2JTTA 4MZLA 4P5OE 1IIOA 2JULA 2JZIA 1GM0A 2OS8B 3LL8B 1CM4A 4OVNF 1MHOA 4ETOA 1TN4A 1UP5A 3SS3A 1IKUA 1S5GY 1ZACA 1UHHA 2FJUB 3O78A 2LVJA 1NCYA 1SKTA 2Q91A 4WQ3A 1DJZA 2L2CA 1V1FA 1SY9A 1CDPA 1OQPA 1CFDA 1KK7Z 2Y1MA 1K95A 2VRGA 2H8VA 1DVIA 3OX6A 4DIRA 1J7RA 2PRUA 1OSAA 1C3ZA 1CM1A 1SL9A 2LC5A 3KHEA 1KSOA 2WC5A 1KQMC 1XO5A 3Q8IA 1M31A 1TUJA 2Y4QA 2KYCA 1S36A 1LA3A 1SR6B 1XFYO 3I5FC 2MA2A 2WCMA 3N7HA 1AJ4A 2KLDA 1NCXA 3A8RA 2LLTA 1RECA 1TNXA 4CLNA 1FF1A 2WC6A 1TNQA 3SS5A 1B4CA 1SBJA 3AAJA 2L5XB 1QV0A 2CCMA 2SASA 4QJ4B 4GGFA 1NPQA 4A4CA 1K9KA 1WLZA 4FTGA 5I2QA 1SCVA 3B6XA 2KHNA 1JF0A 2WNDA 3TUYC 1B1GA 1MUXA 1DF0B 2KAYA 3LK0A 1UURA 5DKQA 3V2LA 2MBXA 3BQ3A 1DJYA 1TUZA 4OZDA 1CMGA 2CTNA 3L4AA 2HQWA 3D74A 1BR4B 2WCHA 3I5IB 1G4YR 1F71A 4AQJA 1N2DA 1D1OA 1RFJA 4ICBA 1QASA 3CS1A 3FE9A 3SG2A 1J7PA 1UWOA 3CZTX 1JWDA 3O2PA 1KFXS 1B9AA 1PSRA 1TCOB 1W7IB 1F55A 2M8UA 1A4PA 3B88A 3AKAA 1BJFA 3S0DA 2HQ8A 2JQ6A 2KFFA 1FI6A 1H8BA 3PN7B 2JT0A 2KYFA 3DVJA 1C07A 1YR5A 1H4BA 1A75A 3IQOA 1JSAA 2WORA 3HX4A 2M1KB 3DXLA 4CFRA 2LE9B 2I2RE 1DGUA 2WCJA 1AUIB 1YUSA 5J3XA 1DGVA 2KFGA 3VB1A 1QWVA 1DC1A 2QDIA 1F8HA 2P70A 2MJWB 1KK8B 2KAXA 1UHIA 4WRIA 3BOWA 4OR9B 4CIDA 4NDCA 4PHKA 1M63B 3QMEA 4GGFC 3LLEA 3OBVA 1DELA 5JOLA 1FBVA 4DS7A 2LMTA 2WC8A 3EG5B 2ZNDA 1N65A 2L50A 2JRFA 2K2AA 1SSEB 1XFXO 2LVKA 2K61A 1QJTA 1Z2CB 2BL0B 1UHKA 1OOJA 3CZ2A 2KPHA 1K9PA 1CLBA 2JPOA 3C1VA 1SK6D 1IJ5A 3H4SE 3JTDC 5B8IB 5DICA 2BNXA 2E6WA 4IL1A 3PM8A 4GNKB 3VRRA 3HCMA 5ER5A 2BCXA 1CLLA 1CLMA 1Y1UA 4I5KA 1WY9A 2KBMA 3L47A 1YRTB 2KDHA 1CDLA 2HPSA 1S6CA 2M0RA 4JQ0D 4UPGA 1NSHA 1WDCB 2PQLA 1R6PA 1DJWA 2QEVA 1B47A 1C7VA 2BBNA 1BF5A 3BFHA 2KOTA 1OZOA 1TCFA 2LHIA 1DJGA 2L5YA 1B8RA 1MWNA 2L51A 3CR5X 1QX2A 5DKRA 3GK1A 1SL8A 1N0YA 1PALA 1XFVO 2JNFA 3O4XA 1NCZA 2LUXA 1XYDA 2P6BB 1GGWA 3R1PA 3I5GB 3RZSA 1AP4A 1PSBA 3JVTB 1JUOA 4M2PA 4PHJA 1NX3A 3EK4A 3CGAA 3KO0A 1C7WA 5AERA 1LS8A 2F33A 4E68A 5HKZA 2Y5IA 5HL1A 3TS5B 2FCEA 4PE4A 1IH0A 2PSRA 3BUXB 2PYQA 2K0JA 2BE4A 3NSIA 4ZCUA 2LHLA 1IRJA 2K8MB 2KFHA 1V1GA 1XK4C 2M3WA 4MBEA 2B1UA 2EC6C 2F2OA 3TDZA 3I5HC 1F4QA 2A4JA 2JT8A 4GBAA 4KYNA 2JPTA 5D69A 2WCFA 1CFPA 3VGOA 3NSKA 2LUCA 2LVIA 1F4OA 1MR8A 3K21A 1OMRA 1AK8A 1K90D 1C3YA 1IQ5A 1Y6WA 1DJXA 2OTGB 3SG7A 1A2XA 4JWQA 2QEHA 1L2OB 3DVMA 5FYXA 1YUTA 3CDNA 1AHRA 1XVJA 1Y1XA 2EHBA 5HLVA 3R1OA 3NSOA 3O4YA 1SYMA 1KFXL 2LNKA 4FQTA 2MLEC 1KFUS 1GQMA 4F7FA 2FOTA 3MSEB 2EGDA 2F3YA 3PLFB 4INXA 1YTZC 2JOJA 1JFJA 1EJ3A 2AUCA 1QS7A 4NDBA 5HKWA 1KWOB 1J1DA 2K7CA 4AQIA 2BCBA 2H61C 4C0KA 4MZKA 1OMDA 2KI4C 4WQ2A 3TDUA 3OB2B 1EG3A 2GGMA 1QV1A 5G08A 3R1VA 4HREE 3PFVA 3SG6A 3M0WA 1SL7A 1WRLA 3ZNIA 4YGCB 1M45A 1K93D 2OPOA 2M7LA 1SCMB 3SJSA 3DYEA 4M2OA 1A75B 3VRQA 2WCLA 4DUQA 1A03A 3BUNB 5TNCA 1BG1A 1QLSA 1S3PA 1JF2A 1W7JB 3BUOB 3S0GA 2CBLA 1ZFSA 2P71A 4INWA 1QLKA 4MLWA 1IQ3A 2KLEA 2BBMA 4USLA 2KBIA 1LKJA 1TRFA 1OZSA 3S0BA 4ZCVA 5AFPA 1MXLC 1LXFC 1YVLA 2YGUA 4YI9A 1FI5A 1BR1B 3WHTB 5FI6A 3BOWB 1JBAA 2M9GA 1OOFA 1J55A 1NYAA 5FI2A 1QX5B 2FJYA 4MRYA 1W9ZA 3PSRA 3DF0A 3L4LA 1J7QA 3CABA 2LAPA 1EH2A 2KSPA 1NIWA 1QIVA 4QJ5B 4YGDB 1PVBA 2LMVA 3CTNA 1Y0VH 5I2LA 1PK0D 2ZRTA 4U8DA 2NXQA 1ORGA 1NX2A 3SS4A 4PE1A 2AAOA 1DJHA 4C0JA 3NSLA 1XK4A 1TTXA 1M46A 1KQMB 1YRUB 3WHUB 3CR2A 2K7BA 4XJKA 3EK8A 2JTZA 1SR6C 4N1GA 5I2OA 3I5FB 5CSJA 2LVVA 1U5IA 3OHMB 3WXAA 4OV2A 1Q80A 2F8PA 2JNXA 2V53A 3DVEA 1WLMA 1YUUA 2HETA 2M29A 5CPVA 2QEBA 4HRGA 3DY9A 3WNXB 2M49B 2ZN8A 4YGEB 2LLUA 2BECA 1EXRA 1QX7A 4NDDA 2LP3A 3SIBA 4D1EA 3QRXA 2KAVA 5JJGA 1BLQA 1ZOTB 1NP8A 1CNPA 2L98A 3GK2A 3CZ1A 3SG4A 3TUYB 1XFRA 4AOMA 3SG3A 5K89A 1CKKA 4N5XA 1LA0A 2L4IA 1P28A 3BUWB 2I94A 2NLNA 5HYDA 2JWWA 2K60A 3ZWHA 3BFAA 3PALA 1FPWA 1TWOA 1BT6A 2L0PA 3I5IC 1BOCA 2PASA 2PVBA 3DVKA 3VRPA 3D75A 3IQQA 1DT7B 3BUMB 4C0LA 2H61A 1FW4A 2CT9A 5BPJA 3VRNA 3JTDB 1QIWA 3A4UB 4GUKA 4JKTA 1HQVA 2F2PA 3AKBA 3NXAA 4YRUA 1S6JA 2L2EA 3R72A 2KQ6A 1KSMA 4FQOA 1CB1A 3SG5A 1AJ5A 4JPZB 3PN7C 1OE9B 1BODA 1E8AA 1RK9A 2QPTA 3EVUA 2LP2A 1NWDA 3S0EA 1K96A 1ZMZA 2Y1NA 1CFCA 4M2QA 1YURA 3FE8A 3IF7A 2G2BA 1BMOA 3D78A 1RTP1 1L7ZA 1EG4A 2I7AA 4JD9A 1KFUL 1XFWO 1IJ6A 2HF5A 4I5JA 3EVRA 1JFKA 3KF9A 2BE6A 5KU1A 2MAZA 4P2YB 1M39A 3PATA 2JXCA 1DQEA 1VRKA 2IS9A 5KTYA 2O60A 3IVTA 3D0YA 1KK8C 4GPLB 1MXEA 4PALA 1R2UA 1BU3A 3TZ1A 4DCKA 5IBWA 3S0AA 2BAPA 1SRAA 2LV7A 2WCBA 1B8CA 2BKHB 4L9MA 1CMFA 1TNWA 1ZUZA 1NX0A 5ER4X 2ZKMX 3FWBA 1QVIY 3B87A 4BY5A 1SMGA 2DOQA 1TIZA 2LCPA 4GFTA 4CPVA 1RWYA 3KPXA 1RROA 1S26D 3CZ0A 4GGNA 4OKHA 4TNCA 1S6IA 2BL0C 1QATA 2GGZA 2ZFDA
chains in the Genus database with same CATH topology
2O5GA 4I5LB 2WOSA 4MZJA 1SNLA 1X02A 3D10A 1S1EA 5GQQC 1YVHA 1S5GZ 2GV5A 3VROA 5CSIA 1J1EA 1UHNA 1CDMA 1IWQA 2JXLA 4I5NB 1QVIZ 2KGBC 1WDCC 1LVCD 5PALA 4BY4A 1PULA 1ODBA 3CWGA 4GAOA 1DTLA 1CTRA 2ZNEA 1DJIA 3EVVA 2M97A 2K7DA 2WCEA 5AXIA 4YGBB 2RGIA 1K8UA 3BXKA 3ICBA 3O6BA 2LM5A 1YX8A 4HRHA 3FS7A 1DMOA 2K7OA 4Q04A 1WRZA 1DF0A 4ORBB 1J7OA 1HT9A 3I5GC 4YGAA 1SW8A 3JVTC 2G9BA 2NCPA 2KI6C 3BYAA 4F0ZB 1F70A 1XFUO 2AMIA 2OS8C 3DF0B 1UUSA 2F3ZA 4MN0A 3EKHA 1YX7A 3FWCA 4OCIA 3OB1B 1PRWA 3TS5C 2KGRA 2E30A 4N1FA 2KQYA 5HKYA 1A29A 3E3RA 1CFFA 1Y1AA 2Q4UA 5CSFA 2PALA 3AAKA 3F45A 1IGVA 3LK1A 4XYNA 2R2IA 1ALVA 2ZN9A 4YBHB 2EC6B 3FIAA 1GJYA 3I5HB 4XJKB 5CSNA 3EK7A 1LINA 2KI6D 4PE7A 4PDZA 2K2FA 1B7TY 4QJ3B 3CR4X 3GOFA 2BCAA 1U5IB 1WRKA 5D7FA 5KSZA 1GGZA 1PVAA 1ALWA 2CNPA 2MRDA 4YI8A 2CXJA 1B8LA 1G33A 2OTGC 1L2OC 2I18A 2NCOA 1RJVA 4MVFA 4DRWA 2FCDA 1K9UA 3OX5A 2QACA 2LLSA 2MHHA 4PHMA 1OMVA 2NZ0A 5DKNA 3TDIA 1K94A 4R1EA 2M7NA 1F54A 1TOPA 2SCPA 1KQVA 3EKJA 1B7TZ 3RM1A 4MRXA 2BKIB 1KWOC 1NX1A 2D8NA 3DD4A 3SIAA 1EL4A 2H2KA 2TN4A 2KI4B 2LMUA 1SPYA 5HLOA 5I8NA 3LCPC 4PE0A 1K2HA 1CDNA 1JC2A 1KCYA 2JT3A 2L4HA 1XA5A 4NQGA 4PHNA 1IG5A 2JU0A 2ZRSA 3RLZA 1SCMC 1AVSA 1MQ1A 1XFZO 2PMYA 2COLB 5AANA 2ISDA 1UHJA 4MSPA 1QXPA 1NUBA 3OP0A 1KK7Y 3KEVA 2LANA 3GK4X 1QTXA 5F6TA 2KNEA 1TNPA 4ORCB 3CLNA 4HSZA 2JC2A 4ORAB 1MF8B 4CFQA 4PCWA 4A4BA 4MEWA 1G8IA 5AEQA 2M1UA 3D0YB 2MLFC 2JTTA 4MZLA 4P5OE 2JULA 2JZIA 2OS8B 3LL8B 1CM4A 4OVNF 1MHOA 4ETOA 1TN4A 1UP5A 1IKUA 1S5GY 1ZACA 1UHHA 2FJUB 3O78A 2LVJA 1NCYA 1SKTA 2Q91A 4WQ3A 1DJZA 1V1FA 1SY9A 1CDPA 1OQPA 1CFDA 1KK7Z 2Y1MA 1K95A 2VRGA 3OX6A 1DVIA 4DIRA 1J7RA 2PRUA 1OSAA 1CM1A 1SL9A 2LC5A 3KHEA 1KSOA 1KQMC 1XO5A 1M31A 2Y4QA 2KYCA 1S36A 1LA3A 1SR6B 1XFYO 3I5FC 2MA2A 1AJ4A 1NCXA 3A8RA 2LLTA 1RECA 1TNXA 4CLNA 1FF1A 1TNQA 1B4CA 1SBJA 3AAJA 2L5XB 1QV0A 2CCMA 2SASA 4QJ4B 4GGFA 1NPQA 4A4CA 1K9KA 1WLZA 4FTGA 5I2QA 1SCVA 2KHNA 1JF0A 2WNDA 3TUYC 1B1GA 1MUXA 1DF0B 2KAYA 3LK0A 1UURA 5DKQA 2MBXA 3BQ3A 1DJYA 1CMGA 2CTNA 2HQWA 1BR4B 3I5IB 1G4YR 1F71A 4AQJA 1N2DA 1D1OA 1RFJA 4ICBA 1QASA 3CS1A 3SG2A 1J7PA 1UWOA 3CZTX 1JWDA 3O2PA 1KFXS 1B9AA 1PSRA 1TCOB 1W7IB 1F55A 2M8UA 1A4PA 3AKAA 1BJFA 2HQ8A 2JQ6A 2KFFA 1FI6A 1H8BA 3PN7B 2JT0A 2KYFA 3DVJA 1C07A 1YR5A 1H4BA 1A75A 3IQOA 1JSAA 2WORA 3HX4A 2M1KB 4CFRA 2LE9B 2I2RE 1DGUA 1AUIB 1YUSA 5J3XA 1DGVA 2KFGA 1F8HA 2MJWB 1KK8B 2KAXA 1UHIA 4WRIA 3BOWA 4OR9B 4CIDA 4NDCA 4PHKA 1M63B 4GGFC 3LLEA 5JOLA 4DS7A 1FBVA 2LMTA 2WC8A 2ZNDA 1N65A 2L50A 2JRFA 2K2AA 1XFXO 2LVKA 2K61A 1QJTA 2BL0B 1CLBA 1UHKA 1OOJA 1K9PA 3C1VA 3JTDC 1SK6D 1IJ5A 3H4SE 5B8IB 2E6WA 4IL1A 3PM8A 4GNKB 3VRRA 3HCMA 5ER5A 2BCXA 1CLLA 1CLMA 1Y1UA 4I5KA 1WY9A 2KBMA 1YRTB 2KDHA 1CDLA 2HPSA 1S6CA 2M0RA 4JQ0D 4UPGA 1NSHA 1WDCB 1R6PA 1DJWA 1B47A 1C7VA 2BBNA 1BF5A 2KOTA 1OZOA 1TCFA 2LHIA 1DJGA 1B8RA 1MWNA 2L51A 3CR5X 1QX2A 5DKRA 3GK1A 1SL8A 1N0YA 1PALA 1XFVO 2JNFA 1NCZA 2LUXA 1XYDA 2P6BB 1GGWA 3I5GB 1AP4A 1PSBA 3JVTB 1JUOA 4M2PA 4PHJA 1NX3A 3EK4A 3CGAA 3KO0A 1C7WA 5AERA 2F33A 4E68A 5HKZA 2Y5IA 3TS5B 2FCEA 4PE4A 1IH0A 2PSRA 3BUXB 2K0JA 2BE4A 3NSIA 4ZCUA 2LHLA 1IRJA 2K8MB 2KFHA 1V1GA 1XK4C 2M3WA 4MBEA 2B1UA 2EC6C 2F2OA 3TDZA 3I5HC 1F4QA 2A4JA 2JT8A 4GBAA 2JPTA 5D69A 2WCFA 1CFPA 3VGOA 3NSKA 2LUCA 2LVIA 1F4OA 1MR8A 3K21A 1OMRA 1AK8A 1K90D 1IQ5A 1Y6WA 1DJXA 2OTGB 3SG7A 1A2XA 4JWQA 1L2OB 3DVMA 5FYXA 1YUTA 1AHRA 1XVJA 1Y1XA 2EHBA 5HLVA 3NSOA 3O4YA 1SYMA 1KFXL 2LNKA 2MLEC 1KFUS 1GQMA 2FOTA 3MSEB 2EGDA 2F3YA 3PLFB 1YTZC 2JOJA 1JFJA 2AUCA 1EJ3A 1QS7A 4NDBA 5HKWA 1KWOB 1J1DA 2K7CA 4AQIA 2BCBA 2H61C 4C0KA 4MZKA 1OMDA 2KI4C 4WQ2A 3TDUA 3OB2B 1EG3A 2GGMA 1QV1A 5G08A 4HREE 3PFVA 3SG6A 3M0WA 1SL7A 1WRLA 3ZNIA 4YGCB 1M45A 1K93D 2OPOA 2M7LA 1SCMB 3SJSA 4M2OA 1A75B 3VRQA 4DUQA 1A03A 3BUNB 5TNCA 1BG1A 1QLSA 1S3PA 1JF2A 1W7JB 3BUOB 2CBLA 1ZFSA 1QLKA 4MLWA 1IQ3A 2BBMA 4USLA 2KBIA 1LKJA 1TRFA 1OZSA 4ZCVA 5AFPA 1MXLC 1LXFC 1YVLA 4YI9A 1FI5A 1BR1B 3WHTB 3BOWB 1JBAA 2M9GA 1J55A 1NYAA 1QX5B 4MRYA 3PSRA 3DF0A 1J7QA 1EH2A 2LAPA 2KSPA 1NIWA 1QIVA 4QJ5B 4YGDB 1PVBA 2LMVA 3CTNA 1Y0VH 5I2LA 1PK0D 2ZRTA 4U8DA 2NXQA 1NX2A 4PE1A 2AAOA 1DJHA 4C0JA 3NSLA 1XK4A 1TTXA 1M46A 1KQMB 1YRUB 3WHUB 3CR2A 2K7BA 4XJKA 3EK8A 2JTZA 1SR6C 4N1GA 5I2OA 3I5FB 5CSJA 2LVVA 1U5IA 3OHMB 3WXAA 4OV2A 1Q80A 2F8PA 2JNXA 2V53A 3DVEA 1WLMA 1YUUA 2HETA 2M29A 5CPVA 4HRGA 3WNXB 2M49B 2ZN8A 4YGEB 2LLUA 2BECA 1EXRA 1QX7A 4NDDA 2LP3A 3SIBA 4D1EA 3QRXA 2KAVA 5JJGA 1BLQA 1ZOTB 1NP8A 1CNPA 2L98A 3GK2A 3SG4A 3TUYB 4AOMA 1CKKA 3SG3A 5K89A 4N5XA 1LA0A 2L4IA 3BUWB 2I94A 2NLNA 5HYDA 2JWWA 3ZWHA 1FPWA 3PALA 1BT6A 2L0PA 3I5IC 1BOCA 2PASA 2PVBA 3DVKA 3VRPA 3IQQA 1DT7B 3BUMB 4C0LA 2H61A 1FW4A 2CT9A 5BPJA 3VRNA 3JTDB 1QIWA 3A4UB 4GUKA 1HQVA 2F2PA 3AKBA 3NXAA 4YRUA 1S6JA 2L2EA 2KQ6A 1KSMA 4FQOA 1CB1A 3SG5A 1AJ5A 4JPZB 3PN7C 1OE9B 1BODA 1E8AA 1RK9A 2QPTA 3EVUA 2LP2A 1NWDA 1K96A 1ZMZA 2Y1NA 1CFCA 4M2QA 1YURA 3IF7A 2G2BA 1BMOA 1RTP1 1L7ZA 1EG4A 2I7AA 1KFUL 1XFWO 1IJ6A 2HF5A 4I5JA 3EVRA 1JFKA 3KF9A 2BE6A 5KU1A 2MAZA 4P2YB 1M39A 3PATA 2JXCA 1VRKA 2IS9A 5KTYA 2O60A 3D0YA 1KK8C 4GPLB 1MXEA 4PALA 1R2UA 1BU3A 3TZ1A 4DCKA 5IBWA 1SRAA 2LV7A 2WCBA 1B8CA 2BKHB 4L9MA 1CMFA 1TNWA 1ZUZA 1NX0A 5ER4X 2ZKMX 3FWBA 1QVIY 4BY5A 1SMGA 2DOQA 1TIZA 2LCPA 4GFTA 4CPVA 1RWYA 3KPXA 1RROA 1S26D 4OKHA 4GGNA 4TNCA 1S6IA 2BL0C 1QATA 2GGZA 2ZFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5G A;  4I5L B;  2WOS A;  4MZJ A;  1SNL A;  1X02 A;  3D10 A;  1S1E A;  5GQQ C;  1YVH A;  1S5G Z;  2GV5 A;  3VRO A;  5CSI A;  1J1E A;  1UHN A;  1CDM A;  1IWQ A;  2JXL A;  4I5N B;  1QVI Z;  2KGB C;  1WDC C;  1LVC D;  5PAL A;  4BY4 A;  1PUL A;  1ODB A;  3CWG A;  4GAO A;  1DTL A;  1CTR A;  2ZNE A;  1DJI A;  3EVV A;  2M97 A;  2K7D A;  2WCE A;  5AXI A;  4YGB B;  2RGI A;  1K8U A;  3BXK A;  3ICB A;  3O6B A;  2LM5 A;  1YX8 A;  4HRH A;  3FS7 A;  1DMO A;  2K7O A;  4Q04 A;  1WRZ A;  1DF0 A;  4ORB B;  1J7O A;  1HT9 A;  3I5G C;  4YGA A;  1SW8 A;  3JVT C;  2G9B A;  2NCP A;  2KI6 C;  3BYA A;  4F0Z B;  1F70 A;  1XFU O;  2AMI A;  2OS8 C;  3DF0 B;  1UUS A;  2F3Z A;  4MN0 A;  3EKH A;  1YX7 A;  3FWC A;  4OCI A;  3OB1 B;  1PRW A;  3TS5 C;  2KGR A;  2E30 A;  4N1F A;  2KQY A;  5HKY A;  1A29 A;  3E3R A;  1CFF A;  1Y1A A;  2Q4U A;  5CSF A;  2PAL A;  3AAK A;  3F45 A;  1IGV A;  3LK1 A;  4XYN A;  2R2I A;  1ALV A;  2ZN9 A;  4YBH B;  2EC6 B;  3FIA A;  1GJY A;  3I5H B;  4XJK B;  5CSN A;  3EK7 A;  1LIN A;  2KI6 D;  4PE7 A;  4PDZ A;  2K2F A;  1B7T Y;  4QJ3 B;  3CR4 X;  3GOF A;  2BCA A;  1U5I B;  1WRK A;  5D7F A;  5KSZ A;  1GGZ A;  1PVA A;  1ALW A;  2CNP A;  2MRD A;  4YI8 A;  2CXJ A;  1B8L A;  1G33 A;  2OTG C;  1L2O C;  2I18 A;  2NCO A;  1RJV A;  4MVF A;  4DRW A;  2FCD A;  1K9U A;  3OX5 A;  2QAC A;  2LLS A;  2MHH A;  4PHM A;  1OMV A;  2NZ0 A;  5DKN A;  3TDI A;  1K94 A;  4R1E A;  2M7N A;  1F54 A;  1TOP A;  2SCP A;  1KQV A;  3EKJ A;  1B7T Z;  3RM1 A;  4MRX A;  2BKI B;  1KWO C;  1NX1 A;  2D8N A;  3DD4 A;  3SIA A;  1EL4 A;  2H2K A;  2TN4 A;  2KI4 B;  2LMU A;  1SPY A;  5HLO A;  5I8N A;  3LCP C;  4PE0 A;  1K2H A;  1CDN A;  1JC2 A;  1KCY A;  2JT3 A;  2L4H A;  1XA5 A;  4NQG A;  4PHN A;  1IG5 A;  2JU0 A;  2ZRS A;  3RLZ A;  1SCM C;  1AVS A;  1MQ1 A;  1XFZ O;  2PMY A;  2COL B;  5AAN A;  2ISD A;  1UHJ A;  4MSP A;  1QXP A;  1NUB A;  3OP0 A;  1KK7 Y;  3KEV A;  2LAN A;  3GK4 X;  1QTX A;  5F6T A;  2KNE A;  1TNP A;  4ORC B;  3CLN A;  4HSZ A;  2JC2 A;  4ORA B;  1MF8 B;  4CFQ A;  4PCW A;  4A4B A;  4MEW A;  1G8I A;  5AEQ A;  2M1U A;  3D0Y B;  2MLF C;  2JTT A;  4MZL A;  4P5O E;  2JUL A;  2JZI A;  2OS8 B;  3LL8 B;  1CM4 A;  4OVN F;  1MHO A;  4ETO A;  1TN4 A;  1UP5 A;  1IKU A;  1S5G Y;  1ZAC A;  1UHH A;  2FJU B;  3O78 A;  2LVJ A;  1NCY A;  1SKT A;  2Q91 A;  4WQ3 A;  1DJZ A;  1V1F A;  1SY9 A;  1CDP A;  1OQP A;  1CFD A;  1KK7 Z;  2Y1M A;  1K95 A;  2VRG A;  3OX6 A;  1DVI A;  4DIR A;  1J7R A;  2PRU A;  1OSA A;  1CM1 A;  1SL9 A;  2LC5 A;  3KHE A;  1KSO A;  1KQM C;  1XO5 A;  1M31 A;  2Y4Q A;  2KYC A;  1S36 A;  1LA3 A;  1SR6 B;  1XFY O;  3I5F C;  2MA2 A;  1AJ4 A;  1NCX A;  3A8R A;  2LLT A;  1REC A;  1TNX A;  4CLN A;  1FF1 A;  1TNQ A;  1B4C A;  1SBJ A;  3AAJ A;  2L5X B;  1QV0 A;  2CCM A;  2SAS A;  4QJ4 B;  4GGF A;  1NPQ A;  4A4C A;  1K9K A;  1WLZ A;  4FTG A;  5I2Q A;  1SCV A;  2KHN A;  1JF0 A;  2WND A;  3TUY C;  1B1G A;  1MUX A;  1DF0 B;  2KAY A;  3LK0 A;  1UUR A;  5DKQ A;  2MBX A;  3BQ3 A;  1DJY A;  1CMG A;  2CTN A;  2HQW A;  1BR4 B;  3I5I B;  1G4Y R;  1F71 A;  4AQJ A;  1N2D A;  1D1O A;  1RFJ A;  4ICB A;  1QAS A;  3CS1 A;  3SG2 A;  1J7P A;  1UWO A;  3CZT X;  1JWD A;  3O2P A;  1KFX S;  1B9A A;  1PSR A;  1TCO B;  1W7I B;  1F55 A;  2M8U A;  1A4P A;  3AKA A;  1BJF A;  2HQ8 A;  2JQ6 A;  2KFF A;  1FI6 A;  1H8B A;  3PN7 B;  2JT0 A;  2KYF A;  3DVJ A;  1C07 A;  1YR5 A;  1H4B A;  1A75 A;  3IQO A;  1JSA A;  2WOR A;  3HX4 A;  2M1K B;  4CFR A;  2LE9 B;  2I2R E;  1DGU A;  1AUI B;  1YUS A;  5J3X A;  1DGV A;  2KFG A;  1F8H A;  2MJW B;  1KK8 B;  2KAX A;  1UHI A;  4WRI A;  3BOW A;  4OR9 B;  4CID A;  4NDC A;  4PHK A;  1M63 B;  4GGF C;  3LLE A;  5JOL A;  4DS7 A;  1FBV A;  2LMT A;  2WC8 A;  2ZND A;  1N65 A;  2L50 A;  2JRF A;  2K2A A;  1XFX O;  2LVK A;  2K61 A;  1QJT A;  2BL0 B;  1CLB A;  1UHK A;  1OOJ A;  1K9P A;  3C1V A;  3JTD C;  1SK6 D;  1IJ5 A;  3H4S E;  5B8I B;  2E6W A;  4IL1 A;  3PM8 A;  4GNK B;  3VRR A;  3HCM A;  5ER5 A;  2BCX A;  1CLL A;  1CLM A;  1Y1U A;  4I5K A;  1WY9 A;  2KBM A;  1YRT B;  2KDH A;  1CDL A;  2HPS A;  1S6C A;  2M0R A;  4JQ0 D;  4UPG A;  1NSH A;  1WDC B;  1R6P A;  1DJW A;  1B47 A;  1C7V A;  2BBN A;  1BF5 A;  2KOT A;  1OZO A;  1TCF A;  2LHI A;  1DJG A;  1B8R A;  1MWN A;  2L51 A;  3CR5 X;  1QX2 A;  5DKR A;  3GK1 A;  1SL8 A;  1N0Y A;  1PAL A;  1XFV O;  2JNF A;  1NCZ A;  2LUX A;  1XYD A;  2P6B B;  1GGW A;  3I5G B;  1AP4 A;  1PSB A;  3JVT B;  1JUO A;  4M2P A;  4PHJ A;  1NX3 A;  3EK4 A;  3CGA A;  3KO0 A;  1C7W A;  5AER A;  2F33 A;  4E68 A;  5HKZ A;  2Y5I A;  3TS5 B;  2FCE A;  4PE4 A;  1IH0 A;  2PSR A;  3BUX B;  2K0J A;  2BE4 A;  3NSI A;  4ZCU A;  2LHL A;  1IRJ A;  2K8M B;  2KFH A;  1V1G A;  1XK4 C;  2M3W A;  4MBE A;  2B1U A;  2EC6 C;  2F2O A;  3TDZ A;  3I5H C;  1F4Q A;  2A4J A;  2JT8 A;  4GBA A;  2JPT A;  5D69 A;  2WCF A;  1CFP A;  3VGO A;  3NSK A;  2LUC A;  2LVI A;  1F4O A;  1MR8 A;  3K21 A;  1OMR A;  1AK8 A;  1K90 D;  1IQ5 A;  1Y6W A;  1DJX A;  2OTG B;  3SG7 A;  1A2X A;  4JWQ A;  1L2O B;  3DVM A;  5FYX A;  1YUT A;  1AHR A;  1XVJ A;  1Y1X A;  2EHB A;  5HLV A;  3NSO A;  3O4Y A;  1SYM A;  1KFX L;  2LNK A;  2MLE C;  1KFU S;  1GQM A;  2FOT A;  3MSE B;  2EGD A;  2F3Y A;  3PLF B;  1YTZ C;  2JOJ A;  1JFJ A;  2AUC A;  1EJ3 A;  1QS7 A;  4NDB A;  5HKW A;  1KWO B;  1J1D A;  2K7C A;  4AQI A;  2BCB A;  2H61 C;  4C0K A;  4MZK A;  1OMD A;  2KI4 C;  4WQ2 A;  3TDU A;  3OB2 B;  1EG3 A;  2GGM A;  1QV1 A;  5G08 A;  4HRE E;  3PFV A;  3SG6 A;  3M0W A;  1SL7 A;  1WRL A;  3ZNI A;  4YGC B;  1M45 A;  1K93 D;  2OPO A;  2M7L A;  1SCM B;  3SJS A;  4M2O A;  1A75 B;  3VRQ A;  4DUQ A;  1A03 A;  3BUN B;  5TNC A;  1BG1 A;  1QLS A;  1S3P A;  1JF2 A;  1W7J B;  3BUO B;  2CBL A;  1ZFS A;  1QLK A;  4MLW A;  1IQ3 A;  2BBM A;  4USL A;  2KBI A;  1LKJ A;  1TRF A;  1OZS A;  4ZCV A;  5AFP A;  1MXL C;  1LXF C;  1YVL A;  4YI9 A;  1FI5 A;  1BR1 B;  3WHT B;  3BOW B;  1JBA A;  2M9G A;  1J55 A;  1NYA A;  1QX5 B;  4MRY A;  3PSR A;  3DF0 A;  1J7Q A;  1EH2 A;  2LAP A;  2KSP A;  1NIW A;  1QIV A;  4QJ5 B;  4YGD B;  1PVB A;  2LMV A;  3CTN A;  1Y0V H;  5I2L A;  1PK0 D;  2ZRT A;  4U8D A;  2NXQ A;  1NX2 A;  4PE1 A;  2AAO A;  1DJH A;  4C0J A;  3NSL A;  1XK4 A;  1TTX A;  1M46 A;  1KQM B;  1YRU B;  3WHU B;  3CR2 A;  2K7B A;  4XJK A;  3EK8 A;  2JTZ A;  1SR6 C;  4N1G A;  5I2O A;  3I5F B;  5CSJ A;  2LVV A;  1U5I A;  3OHM B;  3WXA A;  4OV2 A;  1Q80 A;  2F8P A;  2JNX A;  2V53 A;  3DVE A;  1WLM A;  1YUU A;  2HET A;  2M29 A;  5CPV A;  4HRG A;  3WNX B;  2M49 B;  2ZN8 A;  4YGE B;  2LLU A;  2BEC A;  1EXR A;  1QX7 A;  4NDD A;  2LP3 A;  3SIB A;  4D1E A;  3QRX A;  2KAV A;  5JJG A;  1BLQ A;  1ZOT B;  1NP8 A;  1CNP A;  2L98 A;  3GK2 A;  3SG4 A;  3TUY B;  4AOM A;  1CKK A;  3SG3 A;  5K89 A;  4N5X A;  1LA0 A;  2L4I A;  3BUW B;  2I94 A;  2NLN A;  5HYD A;  2JWW A;  3ZWH A;  1FPW A;  3PAL A;  1BT6 A;  2L0P A;  3I5I C;  1BOC A;  2PAS A;  2PVB A;  3DVK A;  3VRP A;  3IQQ A;  1DT7 B;  3BUM B;  4C0L A;  2H61 A;  1FW4 A;  2CT9 A;  5BPJ A;  3VRN A;  3JTD B;  1QIW A;  3A4U B;  4GUK A;  1HQV A;  2F2P A;  3AKB A;  3NXA A;  4YRU A;  1S6J A;  2L2E A;  2KQ6 A;  1KSM A;  4FQO A;  1CB1 A;  3SG5 A;  1AJ5 A;  4JPZ B;  3PN7 C;  1OE9 B;  1BOD A;  1E8A A;  1RK9 A;  2QPT A;  3EVU A;  2LP2 A;  1NWD A;  1K96 A;  1ZMZ A;  2Y1N A;  1CFC A;  4M2Q A;  1YUR A;  3IF7 A;  2G2B A;  1BMO A;  1RTP 1;  1L7Z A;  1EG4 A;  2I7A A;  1KFU L;  1XFW O;  1IJ6 A;  2HF5 A;  4I5J A;  3EVR A;  1JFK A;  3KF9 A;  2BE6 A;  5KU1 A;  2MAZ A;  4P2Y B;  1M39 A;  3PAT A;  2JXC A;  1VRK A;  2IS9 A;  5KTY A;  2O60 A;  3D0Y A;  1KK8 C;  4GPL B;  1MXE A;  4PAL A;  1R2U A;  1BU3 A;  3TZ1 A;  4DCK A;  5IBW A;  1SRA A;  2LV7 A;  2WCB A;  1B8C A;  2BKH B;  4L9M A;  1CMF A;  1TNW A;  1ZUZ A;  1NX0 A;  5ER4 X;  2ZKM X;  3FWB A;  1QVI Y;  4BY5 A;  1SMG A;  2DOQ A;  1TIZ A;  2LCP A;  4GFT A;  4CPV A;  1RWY A;  3KPX A;  1RRO A;  1S26 D;  4OKH A;  4GGN A;  4TNC A;  1S6I A;  2BL0 C;  1QAT A;  2GGZ A;  2ZFD A; 
#chains in the Genus database with same CATH topology
 2O5G A;  4I5L B;  2WOS A;  4MZJ A;  1SNL A;  1X02 A;  3D10 A;  1S1E A;  5GQQ C;  1YVH A;  1S5G Z;  2GV5 A;  3VRO A;  5CSI A;  1J1E A;  1UHN A;  1CDM A;  1IWQ A;  2JXL A;  4I5N B;  1QVI Z;  2KGB C;  1WDC C;  1LVC D;  1T14 A;  5PAL A;  4BY4 A;  1PUL A;  1ODB A;  3CWG A;  4GAO A;  1DTL A;  3CYZ A;  1CTR A;  2ZNE A;  1DJI A;  3EVV A;  2M97 A;  2K7D A;  2WCE A;  5AXI A;  4YGB B;  2RGI A;  1K8U A;  3BXK A;  3ICB A;  5EL2 A;  3O6B A;  2LM5 A;  1YX8 A;  3NGV A;  3FS7 A;  4HRH A;  1DMO A;  1OW4 A;  2K7O A;  3PJI A;  4Q04 A;  1WRZ A;  1Z4H A;  1DF0 A;  4PT1 A;  4ORB B;  1J7O A;  1HT9 A;  1OOG A;  3I5G C;  4YGA A;  1SW8 A;  3JVT C;  2G9B A;  3UO9 A;  2NCP A;  2KI6 C;  3BYA A;  4F0Z B;  1F70 A;  1DEK A;  1XFU O;  2AMI A;  2OS8 C;  3DF0 B;  3UNW A;  1UUS A;  2F3Z A;  4MN0 A;  3EKH A;  1YX7 A;  3FWC A;  3B86 A;  3OB1 B;  1PRW A;  4OCI A;  3TS5 C;  2KGR A;  2E30 A;  4N1F A;  2KQY A;  5HKY A;  1A29 A;  3E3R A;  1CFF A;  1Y1A A;  2Q4U A;  5CSF A;  2GTE A;  2PAL A;  3AAK A;  1IGV A;  3DZT A;  3F45 A;  3LK1 A;  3PM2 A;  4XYN A;  2R2I A;  1OOI X;  5D3O A;  1ALV A;  2ZN9 A;  4YBH B;  2EC6 B;  3FIA A;  1GJY A;  3I5H B;  4XJK B;  5CSN A;  3EK7 A;  1LIN A;  2KI6 D;  3D77 A;  4PE7 A;  4PDZ A;  2K2F A;  1B7T Y;  4QJ3 B;  3CR4 X;  3GOF A;  2BCA A;  1U5I B;  1WRK A;  5D7F A;  5KSZ A;  1GGZ A;  1PVA A;  1ALW A;  2CNP A;  2MRD A;  4YI8 A;  5I94 A;  2CXJ A;  1B8L A;  3S0F A;  1G33 A;  2OTG C;  3B7A A;  1L2O C;  2I18 A;  2NCO A;  1RJV A;  4MVF A;  4DRW A;  2FCD A;  1K9U A;  3OX5 A;  2QAC A;  2LLS A;  2MHH A;  2WCK A;  3OGN A;  4PHM A;  1OMV A;  3BFB A;  2NZ0 A;  3D73 A;  5DKN A;  1K94 A;  3FE6 A;  4IJ7 A;  4R1E A;  2M7N A;  3TDI A;  3NHI A;  1F54 A;  1TOP A;  2SCP A;  1KQV A;  3EKJ A;  1B7T Z;  3RM1 A;  4MRX A;  2BKI B;  1KWO C;  1NX1 A;  2D8N A;  3D76 A;  3DD4 A;  3SIA A;  1OOH A;  1EL4 A;  3BJH A;  2H2K A;  2TN4 A;  3K1E A;  2KI4 B;  2LMU A;  5FI7 A;  1SPY A;  5HLO A;  5I8N A;  3LCP C;  4PE0 A;  1K2H A;  1CDN A;  1JC2 A;  1KCY A;  2JT3 A;  2L4H A;  1XA5 A;  4NQG A;  4PHN A;  1IG5 A;  2JU0 A;  2ZRS A;  3RLZ A;  1SCM C;  1AVS A;  1MQ1 A;  1XFZ O;  2PMY A;  2COL B;  5AAN A;  2ISD A;  1UHJ A;  4MSP A;  1QXP A;  3NHT A;  1NUB A;  3OP0 A;  1KK7 Y;  3KEV A;  2LAN A;  2QEO A;  3GK4 X;  1QTX A;  5F6T A;  2KNE A;  1TNP A;  2ERB A;  4ORC B;  3CLN A;  4HSZ A;  2JC2 A;  4ORA B;  1MF8 B;  4CFQ A;  4PCW A;  4A4B A;  4MEW A;  1G8I A;  5AEQ A;  2M1U A;  3D0Y B;  2MLF C;  2JTT A;  4MZL A;  4P5O E;  1IIO A;  2JUL A;  2JZI A;  1GM0 A;  2OS8 B;  3LL8 B;  1CM4 A;  4OVN F;  1MHO A;  4ETO A;  1TN4 A;  1UP5 A;  3SS3 A;  1IKU A;  1S5G Y;  1ZAC A;  1UHH A;  2FJU B;  3O78 A;  2LVJ A;  1NCY A;  1SKT A;  2Q91 A;  4WQ3 A;  1DJZ A;  2L2C A;  1V1F A;  1SY9 A;  1CDP A;  1OQP A;  1CFD A;  1KK7 Z;  2Y1M A;  1K95 A;  2VRG A;  2H8V A;  1DVI A;  3OX6 A;  4DIR A;  1J7R A;  2PRU A;  1OSA A;  1C3Z A;  1CM1 A;  1SL9 A;  2LC5 A;  3KHE A;  1KSO A;  2WC5 A;  1KQM C;  1XO5 A;  3Q8I A;  1M31 A;  1TUJ A;  2Y4Q A;  2KYC A;  1S36 A;  1LA3 A;  1SR6 B;  1XFY O;  3I5F C;  2MA2 A;  2WCM A;  3N7H A;  1AJ4 A;  2KLD A;  1NCX A;  3A8R A;  2LLT A;  1REC A;  1TNX A;  4CLN A;  1FF1 A;  2WC6 A;  1TNQ A;  3SS5 A;  1B4C A;  1SBJ A;  3AAJ A;  2L5X B;  1QV0 A;  2CCM A;  2SAS A;  4QJ4 B;  4GGF A;  1NPQ A;  4A4C A;  1K9K A;  1WLZ A;  4FTG A;  5I2Q A;  1SCV A;  3B6X A;  2KHN A;  1JF0 A;  2WND A;  3TUY C;  1B1G A;  1MUX A;  1DF0 B;  2KAY A;  3LK0 A;  1UUR A;  5DKQ A;  3V2L A;  2MBX A;  3BQ3 A;  1DJY A;  1TUZ A;  4OZD A;  1CMG A;  2CTN A;  3L4A A;  2HQW A;  3D74 A;  1BR4 B;  2WCH A;  3I5I B;  1G4Y R;  1F71 A;  4AQJ A;  1N2D A;  1D1O A;  1RFJ A;  4ICB A;  1QAS A;  3CS1 A;  3FE9 A;  3SG2 A;  1J7P A;  1UWO A;  3CZT X;  1JWD A;  3O2P A;  1KFX S;  1B9A A;  1PSR A;  1TCO B;  1W7I B;  1F55 A;  2M8U A;  1A4P A;  3B88 A;  3AKA A;  1BJF A;  3S0D A;  2HQ8 A;  2JQ6 A;  2KFF A;  1FI6 A;  1H8B A;  3PN7 B;  2JT0 A;  2KYF A;  3DVJ A;  1C07 A;  1YR5 A;  1H4B A;  1A75 A;  3IQO A;  1JSA A;  2WOR A;  3HX4 A;  2M1K B;  3DXL A;  4CFR A;  2LE9 B;  2I2R E;  1DGU A;  2WCJ A;  1AUI B;  1YUS A;  5J3X A;  1DGV A;  2KFG A;  3VB1 A;  1QWV A;  1DC1 A;  2QDI A;  1F8H A;  2P70 A;  2MJW B;  1KK8 B;  2KAX A;  1UHI A;  4WRI A;  3BOW A;  4OR9 B;  4CID A;  4NDC A;  4PHK A;  1M63 B;  3QME A;  4GGF C;  3LLE A;  3OBV A;  1DEL A;  5JOL A;  1FBV A;  4DS7 A;  2LMT A;  2WC8 A;  3EG5 B;  2ZND A;  1N65 A;  2L50 A;  2JRF A;  2K2A A;  1SSE B;  1XFX O;  2LVK A;  2K61 A;  1QJT A;  1Z2C B;  2BL0 B;  1UHK A;  1OOJ A;  3CZ2 A;  2KPH A;  1K9P A;  1CLB A;  2JPO A;  3C1V A;  1SK6 D;  1IJ5 A;  3H4S E;  3JTD C;  5B8I B;  5DIC A;  2BNX A;  2E6W A;  4IL1 A;  3PM8 A;  4GNK B;  3VRR A;  3HCM A;  5ER5 A;  2BCX A;  1CLL A;  1CLM A;  1Y1U A;  4I5K A;  1WY9 A;  2KBM A;  3L47 A;  1YRT B;  2KDH A;  1CDL A;  2HPS A;  1S6C A;  2M0R A;  4JQ0 D;  4UPG A;  1NSH A;  1WDC B;  2PQL A;  1R6P A;  1DJW A;  2QEV A;  1B47 A;  1C7V A;  2BBN A;  1BF5 A;  3BFH A;  2KOT A;  1OZO A;  1TCF A;  2LHI A;  1DJG A;  2L5Y A;  1B8R A;  1MWN A;  2L51 A;  3CR5 X;  1QX2 A;  5DKR A;  3GK1 A;  1SL8 A;  1N0Y A;  1PAL A;  1XFV O;  2JNF A;  3O4X A;  1NCZ A;  2LUX A;  1XYD A;  2P6B B;  1GGW A;  3R1P A;  3I5G B;  3RZS A;  1AP4 A;  1PSB A;  3JVT B;  1JUO A;  4M2P A;  4PHJ A;  1NX3 A;  3EK4 A;  3CGA A;  3KO0 A;  1C7W A;  5AER A;  1LS8 A;  2F33 A;  4E68 A;  5HKZ A;  2Y5I A;  5HL1 A;  3TS5 B;  2FCE A;  4PE4 A;  1IH0 A;  2PSR A;  3BUX B;  2PYQ A;  2K0J A;  2BE4 A;  3NSI A;  4ZCU A;  2LHL A;  1IRJ A;  2K8M B;  2KFH A;  1V1G A;  1XK4 C;  2M3W A;  4MBE A;  2B1U A;  2EC6 C;  2F2O A;  3TDZ A;  3I5H C;  1F4Q A;  2A4J A;  2JT8 A;  4GBA A;  4KYN A;  2JPT A;  5D69 A;  2WCF A;  1CFP A;  3VGO A;  3NSK A;  2LUC A;  2LVI A;  1F4O A;  1MR8 A;  3K21 A;  1OMR A;  1AK8 A;  1K90 D;  1C3Y A;  1IQ5 A;  1Y6W A;  1DJX A;  2OTG B;  3SG7 A;  1A2X A;  4JWQ A;  2QEH A;  1L2O B;  3DVM A;  5FYX A;  1YUT A;  3CDN A;  1AHR A;  1XVJ A;  1Y1X A;  2EHB A;  5HLV A;  3R1O A;  3NSO A;  3O4Y A;  1SYM A;  1KFX L;  2LNK A;  4FQT A;  2MLE C;  1KFU S;  1GQM A;  4F7F A;  2FOT A;  3MSE B;  2EGD A;  2F3Y A;  3PLF B;  4INX A;  1YTZ C;  2JOJ A;  1JFJ A;  1EJ3 A;  2AUC A;  1QS7 A;  4NDB A;  5HKW A;  1KWO B;  1J1D A;  2K7C A;  4AQI A;  2BCB A;  2H61 C;  4C0K A;  4MZK A;  1OMD A;  2KI4 C;  4WQ2 A;  3TDU A;  3OB2 B;  1EG3 A;  2GGM A;  1QV1 A;  5G08 A;  3R1V A;  4HRE E;  3PFV A;  3SG6 A;  3M0W A;  1SL7 A;  1WRL A;  3ZNI A;  4YGC B;  1M45 A;  1K93 D;  2OPO A;  2M7L A;  1SCM B;  3SJS A;  3DYE A;  4M2O A;  1A75 B;  3VRQ A;  2WCL A;  4DUQ A;  1A03 A;  3BUN B;  5TNC A;  1BG1 A;  1QLS A;  1S3P A;  1JF2 A;  1W7J B;  3BUO B;  3S0G A;  2CBL A;  1ZFS A;  2P71 A;  4INW A;  1QLK A;  4MLW A;  1IQ3 A;  2KLE A;  2BBM A;  4USL A;  2KBI A;  1LKJ A;  1TRF A;  1OZS A;  3S0B A;  4ZCV A;  5AFP A;  1MXL C;  1LXF C;  1YVL A;  2YGU A;  4YI9 A;  1FI5 A;  1BR1 B;  3WHT B;  5FI6 A;  3BOW B;  1JBA A;  2M9G A;  1OOF A;  1J55 A;  1NYA A;  5FI2 A;  1QX5 B;  2FJY A;  4MRY A;  1W9Z A;  3PSR A;  3DF0 A;  3L4L A;  1J7Q A;  3CAB A;  2LAP A;  1EH2 A;  2KSP A;  1NIW A;  1QIV A;  4QJ5 B;  4YGD B;  1PVB A;  2LMV A;  3CTN A;  1Y0V H;  5I2L A;  1PK0 D;  2ZRT A;  4U8D A;  2NXQ A;  1ORG A;  1NX2 A;  3SS4 A;  4PE1 A;  2AAO A;  1DJH A;  4C0J A;  3NSL A;  1XK4 A;  1TTX A;  1M46 A;  1KQM B;  1YRU B;  3WHU B;  3CR2 A;  2K7B A;  4XJK A;  3EK8 A;  2JTZ A;  1SR6 C;  4N1G A;  5I2O A;  3I5F B;  5CSJ A;  2LVV A;  1U5I A;  3OHM B;  3WXA A;  4OV2 A;  1Q80 A;  2F8P A;  2JNX A;  2V53 A;  3DVE A;  1WLM A;  1YUU A;  2HET A;  2M29 A;  5CPV A;  2QEB A;  4HRG A;  3DY9 A;  3WNX B;  2M49 B;  2ZN8 A;  4YGE B;  2LLU A;  2BEC A;  1EXR A;  1QX7 A;  4NDD A;  2LP3 A;  3SIB A;  4D1E A;  3QRX A;  2KAV A;  5JJG A;  1BLQ A;  1ZOT B;  1NP8 A;  1CNP A;  2L98 A;  3GK2 A;  3CZ1 A;  3SG4 A;  3TUY B;  1XFR A;  4AOM A;  3SG3 A;  5K89 A;  1CKK A;  4N5X A;  1LA0 A;  2L4I A;  1P28 A;  3BUW B;  2I94 A;  2NLN A;  5HYD A;  2JWW A;  2K60 A;  3ZWH A;  3BFA A;  3PAL A;  1FPW A;  1TWO A;  1BT6 A;  2L0P A;  3I5I C;  1BOC A;  2PAS A;  2PVB A;  3DVK A;  3VRP A;  3D75 A;  3IQQ A;  1DT7 B;  3BUM B;  4C0L A;  2H61 A;  1FW4 A;  2CT9 A;  5BPJ A;  3VRN A;  3JTD B;  1QIW A;  3A4U B;  4GUK A;  4JKT A;  1HQV A;  2F2P A;  3AKB A;  3NXA A;  4YRU A;  1S6J A;  2L2E A;  3R72 A;  2KQ6 A;  1KSM A;  4FQO A;  1CB1 A;  3SG5 A;  1AJ5 A;  4JPZ B;  3PN7 C;  1OE9 B;  1BOD A;  1E8A A;  1RK9 A;  2QPT A;  3EVU A;  2LP2 A;  1NWD A;  3S0E A;  1K96 A;  1ZMZ A;  2Y1N A;  1CFC A;  4M2Q A;  1YUR A;  3FE8 A;  3IF7 A;  2G2B A;  1BMO A;  3D78 A;  1RTP 1;  1L7Z A;  1EG4 A;  2I7A A;  4JD9 A;  1KFU L;  1XFW O;  1IJ6 A;  2HF5 A;  4I5J A;  3EVR A;  1JFK A;  3KF9 A;  2BE6 A;  5KU1 A;  2MAZ A;  4P2Y B;  1M39 A;  3PAT A;  2JXC A;  1DQE A;  1VRK A;  2IS9 A;  5KTY A;  2O60 A;  3IVT A;  3D0Y A;  1KK8 C;  4GPL B;  1MXE A;  4PAL A;  1R2U A;  1BU3 A;  3TZ1 A;  4DCK A;  5IBW A;  3S0A A;  2BAP A;  1SRA A;  2LV7 A;  2WCB A;  1B8C A;  2BKH B;  4L9M A;  1CMF A;  1TNW A;  1ZUZ A;  1NX0 A;  5ER4 X;  2ZKM X;  3FWB A;  1QVI Y;  3B87 A;  4BY5 A;  1SMG A;  2DOQ A;  1TIZ A;  2LCP A;  4GFT A;  4CPV A;  1RWY A;  3KPX A;  1RRO A;  1S26 D;  3CZ0 A;  4GGN A;  4OKH A;  4TNC A;  1S6I A;  2BL0 C;  1QAT A;  2GGZ A;  2ZFD A; 
#chains in the Genus database with same CATH homology
 2O5G A;  4I5L B;  2WOS A;  4MZJ A;  1SNL A;  1X02 A;  3D10 A;  1S1E A;  5GQQ C;  1YVH A;  1S5G Z;  2GV5 A;  3VRO A;  5CSI A;  1J1E A;  1UHN A;  1CDM A;  1IWQ A;  2JXL A;  4I5N B;  1QVI Z;  2KGB C;  1WDC C;  1LVC D;  5PAL A;  4BY4 A;  1PUL A;  1ODB A;  3CWG A;  4GAO A;  1DTL A;  1CTR A;  2ZNE A;  1DJI A;  3EVV A;  2M97 A;  2K7D A;  2WCE A;  5AXI A;  4YGB B;  2RGI A;  1K8U A;  3BXK A;  3ICB A;  3O6B A;  2LM5 A;  1YX8 A;  4HRH A;  3FS7 A;  1DMO A;  2K7O A;  4Q04 A;  1WRZ A;  1DF0 A;  4ORB B;  1J7O A;  1HT9 A;  3I5G C;  4YGA A;  1SW8 A;  3JVT C;  2G9B A;  2NCP A;  2KI6 C;  3BYA A;  4F0Z B;  1F70 A;  1XFU O;  2AMI A;  2OS8 C;  3DF0 B;  1UUS A;  2F3Z A;  4MN0 A;  3EKH A;  1YX7 A;  3FWC A;  4OCI A;  3OB1 B;  1PRW A;  3TS5 C;  2KGR A;  2E30 A;  4N1F A;  2KQY A;  5HKY A;  1A29 A;  3E3R A;  1CFF A;  1Y1A A;  2Q4U A;  5CSF A;  2PAL A;  3AAK A;  3F45 A;  1IGV A;  3LK1 A;  4XYN A;  2R2I A;  1ALV A;  2ZN9 A;  4YBH B;  2EC6 B;  3FIA A;  1GJY A;  3I5H B;  4XJK B;  5CSN A;  3EK7 A;  1LIN A;  2KI6 D;  4PE7 A;  4PDZ A;  2K2F A;  1B7T Y;  4QJ3 B;  3CR4 X;  3GOF A;  2BCA A;  1U5I B;  1WRK A;  5D7F A;  5KSZ A;  1GGZ A;  1PVA A;  1ALW A;  2CNP A;  2MRD A;  4YI8 A;  2CXJ A;  1B8L A;  1G33 A;  2OTG C;  1L2O C;  2I18 A;  2NCO A;  1RJV A;  4MVF A;  4DRW A;  2FCD A;  1K9U A;  3OX5 A;  2QAC A;  2LLS A;  2MHH A;  4PHM A;  1OMV A;  2NZ0 A;  5DKN A;  3TDI A;  1K94 A;  4R1E A;  2M7N A;  1F54 A;  1TOP A;  2SCP A;  1KQV A;  3EKJ A;  1B7T Z;  3RM1 A;  4MRX A;  2BKI B;  1KWO C;  1NX1 A;  2D8N A;  3DD4 A;  3SIA A;  1EL4 A;  2H2K A;  2TN4 A;  2KI4 B;  2LMU A;  1SPY A;  5HLO A;  5I8N A;  3LCP C;  4PE0 A;  1K2H A;  1CDN A;  1JC2 A;  1KCY A;  2JT3 A;  2L4H A;  1XA5 A;  4NQG A;  4PHN A;  1IG5 A;  2JU0 A;  2ZRS A;  3RLZ A;  1SCM C;  1AVS A;  1MQ1 A;  1XFZ O;  2PMY A;  2COL B;  5AAN A;  2ISD A;  1UHJ A;  4MSP A;  1QXP A;  1NUB A;  3OP0 A;  1KK7 Y;  3KEV A;  2LAN A;  3GK4 X;  1QTX A;  5F6T A;  2KNE A;  1TNP A;  4ORC B;  3CLN A;  4HSZ A;  2JC2 A;  4ORA B;  1MF8 B;  4CFQ A;  4PCW A;  4A4B A;  4MEW A;  1G8I A;  5AEQ A;  2M1U A;  3D0Y B;  2MLF C;  2JTT A;  4MZL A;  4P5O E;  2JUL A;  2JZI A;  2OS8 B;  3LL8 B;  1CM4 A;  4OVN F;  1MHO A;  4ETO A;  1TN4 A;  1UP5 A;  1IKU A;  1S5G Y;  1ZAC A;  1UHH A;  2FJU B;  3O78 A;  2LVJ A;  1NCY A;  1SKT A;  2Q91 A;  4WQ3 A;  1DJZ A;  1V1F A;  1SY9 A;  1CDP A;  1OQP A;  1CFD A;  1KK7 Z;  2Y1M A;  1K95 A;  2VRG A;  3OX6 A;  1DVI A;  4DIR A;  1J7R A;  2PRU A;  1OSA A;  1CM1 A;  1SL9 A;  2LC5 A;  3KHE A;  1KSO A;  1KQM C;  1XO5 A;  1M31 A;  2Y4Q A;  2KYC A;  1S36 A;  1LA3 A;  1SR6 B;  1XFY O;  3I5F C;  2MA2 A;  1AJ4 A;  1NCX A;  3A8R A;  2LLT A;  1REC A;  1TNX A;  4CLN A;  1FF1 A;  1TNQ A;  1B4C A;  1SBJ A;  3AAJ A;  2L5X B;  1QV0 A;  2CCM A;  2SAS A;  4QJ4 B;  4GGF A;  1NPQ A;  4A4C A;  1K9K A;  1WLZ A;  4FTG A;  5I2Q A;  1SCV A;  2KHN A;  1JF0 A;  2WND A;  3TUY C;  1B1G A;  1MUX A;  1DF0 B;  2KAY A;  3LK0 A;  1UUR A;  5DKQ A;  2MBX A;  3BQ3 A;  1DJY A;  1CMG A;  2CTN A;  2HQW A;  1BR4 B;  3I5I B;  1G4Y R;  1F71 A;  4AQJ A;  1N2D A;  1D1O A;  1RFJ A;  4ICB A;  1QAS A;  3CS1 A;  3SG2 A;  1J7P A;  1UWO A;  3CZT X;  1JWD A;  3O2P A;  1KFX S;  1B9A A;  1PSR A;  1TCO B;  1W7I B;  1F55 A;  2M8U A;  1A4P A;  3AKA A;  1BJF A;  2HQ8 A;  2JQ6 A;  2KFF A;  1FI6 A;  1H8B A;  3PN7 B;  2JT0 A;  2KYF A;  3DVJ A;  1C07 A;  1YR5 A;  1H4B A;  1A75 A;  3IQO A;  1JSA A;  2WOR A;  3HX4 A;  2M1K B;  4CFR A;  2LE9 B;  2I2R E;  1DGU A;  1AUI B;  1YUS A;  5J3X A;  1DGV A;  2KFG A;  1F8H A;  2MJW B;  1KK8 B;  2KAX A;  1UHI A;  4WRI A;  3BOW A;  4OR9 B;  4CID A;  4NDC A;  4PHK A;  1M63 B;  4GGF C;  3LLE A;  5JOL A;  4DS7 A;  1FBV A;  2LMT A;  2WC8 A;  2ZND A;  1N65 A;  2L50 A;  2JRF A;  2K2A A;  1XFX O;  2LVK A;  2K61 A;  1QJT A;  2BL0 B;  1CLB A;  1UHK A;  1OOJ A;  1K9P A;  3C1V A;  3JTD C;  1SK6 D;  1IJ5 A;  3H4S E;  5B8I B;  2E6W A;  4IL1 A;  3PM8 A;  4GNK B;  3VRR A;  3HCM A;  5ER5 A;  2BCX A;  1CLL A;  1CLM A;  1Y1U A;  4I5K A;  1WY9 A;  2KBM A;  1YRT B;  2KDH A;  1CDL A;  2HPS A;  1S6C A;  2M0R A;  4JQ0 D;  4UPG A;  1NSH A;  1WDC B;  1R6P A;  1DJW A;  1B47 A;  1C7V A;  2BBN A;  1BF5 A;  2KOT A;  1OZO A;  1TCF A;  2LHI A;  1DJG A;  1B8R A;  1MWN A;  2L51 A;  3CR5 X;  1QX2 A;  5DKR A;  3GK1 A;  1SL8 A;  1N0Y A;  1PAL A;  1XFV O;  2JNF A;  1NCZ A;  2LUX A;  1XYD A;  2P6B B;  1GGW A;  3I5G B;  1AP4 A;  1PSB A;  3JVT B;  1JUO A;  4M2P A;  4PHJ A;  1NX3 A;  3EK4 A;  3CGA A;  3KO0 A;  1C7W A;  5AER A;  2F33 A;  4E68 A;  5HKZ A;  2Y5I A;  3TS5 B;  2FCE A;  4PE4 A;  1IH0 A;  2PSR A;  3BUX B;  2K0J A;  2BE4 A;  3NSI A;  4ZCU A;  2LHL A;  1IRJ A;  2K8M B;  2KFH A;  1V1G A;  1XK4 C;  2M3W A;  4MBE A;  2B1U A;  2EC6 C;  2F2O A;  3TDZ A;  3I5H C;  1F4Q A;  2A4J A;  2JT8 A;  4GBA A;  2JPT A;  5D69 A;  2WCF A;  1CFP A;  3VGO A;  3NSK A;  2LUC A;  2LVI A;  1F4O A;  1MR8 A;  3K21 A;  1OMR A;  1AK8 A;  1K90 D;  1IQ5 A;  1Y6W A;  1DJX A;  2OTG B;  3SG7 A;  1A2X A;  4JWQ A;  1L2O B;  3DVM A;  5FYX A;  1YUT A;  1AHR A;  1XVJ A;  1Y1X A;  2EHB A;  5HLV A;  3NSO A;  3O4Y A;  1SYM A;  1KFX L;  2LNK A;  2MLE C;  1KFU S;  1GQM A;  2FOT A;  3MSE B;  2EGD A;  2F3Y A;  3PLF B;  1YTZ C;  2JOJ A;  1JFJ A;  2AUC A;  1EJ3 A;  1QS7 A;  4NDB A;  5HKW A;  1KWO B;  1J1D A;  2K7C A;  4AQI A;  2BCB A;  2H61 C;  4C0K A;  4MZK A;  1OMD A;  2KI4 C;  4WQ2 A;  3TDU A;  3OB2 B;  1EG3 A;  2GGM A;  1QV1 A;  5G08 A;  4HRE E;  3PFV A;  3SG6 A;  3M0W A;  1SL7 A;  1WRL A;  3ZNI A;  4YGC B;  1M45 A;  1K93 D;  2OPO A;  2M7L A;  1SCM B;  3SJS A;  4M2O A;  1A75 B;  3VRQ A;  4DUQ A;  1A03 A;  3BUN B;  5TNC A;  1BG1 A;  1QLS A;  1S3P A;  1JF2 A;  1W7J B;  3BUO B;  2CBL A;  1ZFS A;  1QLK A;  4MLW A;  1IQ3 A;  2BBM A;  4USL A;  2KBI A;  1LKJ A;  1TRF A;  1OZS A;  4ZCV A;  5AFP A;  1MXL C;  1LXF C;  1YVL A;  4YI9 A;  1FI5 A;  1BR1 B;  3WHT B;  3BOW B;  1JBA A;  2M9G A;  1J55 A;  1NYA A;  1QX5 B;  4MRY A;  3PSR A;  3DF0 A;  1J7Q A;  1EH2 A;  2LAP A;  2KSP A;  1NIW A;  1QIV A;  4QJ5 B;  4YGD B;  1PVB A;  2LMV A;  3CTN A;  1Y0V H;  5I2L A;  1PK0 D;  2ZRT A;  4U8D A;  2NXQ A;  1NX2 A;  4PE1 A;  2AAO A;  1DJH A;  4C0J A;  3NSL A;  1XK4 A;  1TTX A;  1M46 A;  1KQM B;  1YRU B;  3WHU B;  3CR2 A;  2K7B A;  4XJK A;  3EK8 A;  2JTZ A;  1SR6 C;  4N1G A;  5I2O A;  3I5F B;  5CSJ A;  2LVV A;  1U5I A;  3OHM B;  3WXA A;  4OV2 A;  1Q80 A;  2F8P A;  2JNX A;  2V53 A;  3DVE A;  1WLM A;  1YUU A;  2HET A;  2M29 A;  5CPV A;  4HRG A;  3WNX B;  2M49 B;  2ZN8 A;  4YGE B;  2LLU A;  2BEC A;  1EXR A;  1QX7 A;  4NDD A;  2LP3 A;  3SIB A;  4D1E A;  3QRX A;  2KAV A;  5JJG A;  1BLQ A;  1ZOT B;  1NP8 A;  1CNP A;  2L98 A;  3GK2 A;  3SG4 A;  3TUY B;  4AOM A;  1CKK A;  3SG3 A;  5K89 A;  4N5X A;  1LA0 A;  2L4I A;  3BUW B;  2I94 A;  2NLN A;  5HYD A;  2JWW A;  3ZWH A;  1FPW A;  3PAL A;  1BT6 A;  2L0P A;  3I5I C;  1BOC A;  2PAS A;  2PVB A;  3DVK A;  3VRP A;  3IQQ A;  1DT7 B;  3BUM B;  4C0L A;  2H61 A;  1FW4 A;  2CT9 A;  5BPJ A;  3VRN A;  3JTD B;  1QIW A;  3A4U B;  4GUK A;  1HQV A;  2F2P A;  3AKB A;  3NXA A;  4YRU A;  1S6J A;  2L2E A;  2KQ6 A;  1KSM A;  4FQO A;  1CB1 A;  3SG5 A;  1AJ5 A;  4JPZ B;  3PN7 C;  1OE9 B;  1BOD A;  1E8A A;  1RK9 A;  2QPT A;  3EVU A;  2LP2 A;  1NWD A;  1K96 A;  1ZMZ A;  2Y1N A;  1CFC A;  4M2Q A;  1YUR A;  3IF7 A;  2G2B A;  1BMO A;  1RTP 1;  1L7Z A;  1EG4 A;  2I7A A;  1KFU L;  1XFW O;  1IJ6 A;  2HF5 A;  4I5J A;  3EVR A;  1JFK A;  3KF9 A;  2BE6 A;  5KU1 A;  2MAZ A;  4P2Y B;  1M39 A;  3PAT A;  2JXC A;  1VRK A;  2IS9 A;  5KTY A;  2O60 A;  3D0Y A;  1KK8 C;  4GPL B;  1MXE A;  4PAL A;  1R2U A;  1BU3 A;  3TZ1 A;  4DCK A;  5IBW A;  1SRA A;  2LV7 A;  2WCB A;  1B8C A;  2BKH B;  4L9M A;  1CMF A;  1TNW A;  1ZUZ A;  1NX0 A;  5ER4 X;  2ZKM X;  3FWB A;  1QVI Y;  4BY5 A;  1SMG A;  2DOQ A;  1TIZ A;  2LCP A;  4GFT A;  4CPV A;  1RWY A;  3KPX A;  1RRO A;  1S26 D;  4OKH A;  4GGN A;  4TNC A;  1S6I A;  2BL0 C;  1QAT A;  2GGZ A;  2ZFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...