2OS8C

Rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
PKLSQDEIDDLKEVFELFDFWDGRDGAVDAFKIGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTYADYMEAFKTFDREGQGFISGAELRHVLSGLGERLSDEEVDEIINLTDLQEDLEGNVKYEEFVKKVMTGPYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin heavy chain
publication title Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor.
pubmed doi rcsb
molecule tags Contractile protein
total genus 37
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 2os8C02
1YVHA 2LMTA 2WOSA 2KHNA 4MZJA 1F54A 1BT6A 2KI6D 2LLSA 1OZOA 1RECA 2BCAA 2OTGB 1QJTA 3FS7A 1QX5B 5JJGA 4MZLA 2VRGA 3EKJA 1YR5A 4HSZA 3KEVA 1Y1XA 3CR5X 4MSPA 2CNPA 2KAXA 3PM8A 3AAKA 2KYCA 3ZWHA 4NDDA 4PHKA 1DT7B 1DVIA 1A75A 1DJIA 1WLZA 2JXCA 2NCOA 1YUTA 2KFFA 4CFQA 4MZKA 1W7IB 2BL0C 1K94A 1M63B 2HETA 5IBWA 1JWDA 3CS1A 1QASA 4YGDB 3VRPA 2DOQA 5HKWA 1CKKA 3WHUB 4ORAB 3TZ1A 4AOMA 2JZIA 2LHLA 3MSEB 1CDMA 2E30A 3BUXB 2M7NA 4JPZB 2ZN8A 4HRGA 2KOTA 1MR8A 2KI4C 2MBXA 1TIZA 1CNPA 1TRFA 1G4YR 1JFKA 1WRKA 4NDCA 1J7QA 5G08A 2LVIA 1SL9A 1IWQA 2L4IA 1K93D 1BOCA 4USLA 3NSLA 2FCEA 3BXKA 1F55A 1NCYA 3E3RA 3EK4A 1PK0D 4GUKA 2M29A 2BL0B 2M7LA 1RROA 2KAYA 5ER4X 4AQJA 4GNKB 1PVAA 1E8AA 1EL4A 1HT9A 1AJ5A 1MXEA 4OKHA 4QJ5B 1L2OC 3SG4A 4N1GA 1NYAA 1M45A 3BOWA 1NCXA 4DRWA 1ZMZA 1XO5A 4C0KA 4YRUA 3I5IC 3BUMB 1G33A 5CSNA 2PMYA 2CT9A 3PN7C 3I5GC 2KI4B 5HYDA 3VRQA 2AMIA 1CFPA 2LVVA 3GK4X 2WCEA 4L9MA 2I94A 2Y4QA 1JF0A 3LK1A 1JC2A 1OQPA 1J1DA 3TDIA 1TN4A 1IRJA 1NCZA 2R2IA 4ICBA 2Q91A 1IH0A 1DJYA 2SCPA 1TNXA 1CLBA 2GGMA 2KSPA 4DS7A 3SG3A 1JSAA 2ZKMX 1DF0A 1L2OB 1NSHA 1DJGA 1EJ3A 4ORCB 3IQQA 4A4BA 4E68A 1KK7Z 1Q80A 1KQVA 2LCPA 1QX2A 1XVJA 1QX7A 3I5IB 4C0LA 1J7PA 2Y5IA 3PFVA 3IQOA 1R2UA 3I5GB 1AP4A 3BYAA 1B8RA 1B4CA 1S5GZ 1ALVA 5CSJA 1KK7Y 2EC6C 3OHMB 5ER5A 2BBNA 2JQ6A 2JT0A 4PHMA 1B9AA 3CTNA 3SG5A 4CPVA 1TTXA 4WQ2A 2OPOA 1LXFC 4ORBB 2TN4A 2NXQA 1S5GY 4YI9A 2KFHA 1CLMA 2LC5A 1YVLA 4GPLB 1V1FA 4XJKA 4DUQA 4ZCVA 1SBJA 2LANA 1MWNA 1L7ZA 2RGIA 1BU3A 1YX8A 5AXIA 1DJHA 1S36A 3AKAA 2I7AA 4HRHA 1LA3A 2LUXA 3KPXA 2F8PA 4N1FA 3IF7A 1PRWA 1QVIY 3A8RA 3C1VA 1ZOTB 1KWOC 3D0YA 3O78A 4F0ZB 1YX7A 1M46A 2EC6B 4JQ0D 3SIBA 1BODA 2BKHB 2V53A 3ZNIA 1UHIA 1MF8B 1SL7A 4ZCUA 1B1GA 1CDPA 1DJWA 2K7DA 4NDBA 4PHJA 5CSIA 1IQ5A 1LVCD 4NQGA 2D8NA 2CBLA 4Q04A 3PALA 1EG3A 1K2HA 4CFRA 1GGZA 4GGNA 1BF5A 2QACA 4OCIA 4OR9B 4P2YB 2FOTA 1DF0B 2CCMA 3O2PA 1B8CA 3KHEA 3CZTX 1GGWA 1IJ6A 1MXLC 5AFPA 2JNXA 4N5XA 1S1EA 1PVBA 1BJFA 1KWOB 1UURA 1FI6A 2OS8C 3OX6A 1NUBA 1PSRA 1U5IB 1B8LA 1Y6WA 1ZACA 3PATA 2FJUB 3EK7A 4YI8A 5AERA 5KU1A 2ZRSA 5F6TA 2JC2A 1XK4A 2F33A 1NPQA 1EG4A 2B1UA 3K21A 4A4CA 1KQMC 4YGBB 5DKRA 1AVSA 4PHNA 4UPGA 3TUYC 2JRFA 3AKBA 2KQYA 3OP0A 2FCDA 1XFXO 1CFDA 3BUNB 1UHJA 1S6CA 1SPYA 3TDZA 2E6WA 2Y1MA 1DJXA 2G9BA 4GBAA 1SCMC 2JPTA 2LAPA 5FYXA 1K9KA 1PULA 3SG6A 3SJSA 1SR6C 1C7VA 2BCXA 2KI6C 2OS8B 3JTDC 4I5JA 2M8UA 2L5XB 1XFUO 2HQ8A 2KFGA 2JT3A 1BLQA 2BE6A 1QXPA 2WORA 1DMOA 2LP3A 2MHHA 4MRYA 1K9PA 1SKTA 1SK6D 2F3ZA 1Y1UA 1Y0VH 1B47A 2F2OA 1CB1A 2KYFA 1ODBA 1NP8A 1D1OA 1KQMB 4PALA 1OZSA 3ICBA 2PASA 1NWDA 3TUYB 1IJ5A 1SMGA 2KGRA 1DGVA 1K9UA 2LVKA 1TNQA 2F2PA 4M2OA 2KDHA 1N65A 3BQ3A 1A75B 1CMGA 1EH2A 1FBVA 3I5FC 4I5KA 5HLOA 5PALA 2MJWB 5DKNA 1SCMB 1V1GA 2WNDA 4TNCA 1BG1A 5I2OA 1RJVA 3GK2A 4XYNA 1SRAA 1SR6B 1F4OA 4GFTA 1MQ1A 2L2EA 5KTYA 3JTDB 3JVTC 1KFUS 1RWYA 1RFJA 2JULA 1YUUA 4I5NB 1GJYA 1LA0A 1FPWA 2H2KA 3HCMA 2IS9A 3DD4A 1CLLA 1G8IA 4YGCB 2JTZA 3DVJA 3PN7B 4M2PA 2BECA 5JOLA 2ISDA 4ETOA 1IKUA 1FW4A 1X02A 2LNKA 1RK9A 4BY4A 1OMRA 1IQ3A 1JUOA 1OSAA 2EHBA 2O5GA 3D10A 3TDUA 4CLNA 2HQWA 3OX5A 5HLVA 5B8IB 4IL1A 3WXAA 3CR4X 3O6BA 4YGAA 2KNEA 1MUXA 3I5FB 4QJ4B 4PE7A 4M2QA 1BMOA 3EKHA 2BBMA 2GV5A 5I8NA 5I2QA 1S3PA 3JVTB 2L98A 2NCPA 2LVJA 2O60A 4WRIA 1K90D 2L50A 3A4UB 3BOWB 2SASA 3DVMA 3TS5C 4YGEB 4OV2A 1F71A 1A2XA 1SW8A 1GQMA 1M31A 3KF9A 1N0YA 3CR2A 3NSKA 1W7JB 3H4SE 5CPVA 5D7FA 1BR1B 2MAZA 1S6JA 2M1UA 1S26D 5AANA 1QIWA 2CXJA 1CTRA 3FWBA 2HF5A 4GGFA 5J3XA 2I18A 1NIWA 1BR4B 1OOJA 3QRXA 5GQQC 3SG7A 1RTP1 3DVKA 1AUIB 1PSBA 4MVFA 1TCFA 1XFZO 1Y1AA 2M49B 3PSRA 4BY5A 3HX4A 2JNFA 1HQVA 3LK0A 2K2AA 2H61A 1PALA 4PE1A 2PVBA 2K8MB 1K8UA 3TS5B 4U8DA 4CIDA 1YTZC 1J7OA 1EXRA 5K89A 1N2DA 2M1KB 1CDLA 1KSOA 2COLB 1TNWA 1AHRA 1KFXS 1TCOB 1UUSA 4PE4A 1R6PA 4PCWA 3DF0A 4PE0A 1QLSA 3O4YA 2BE4A 2KBIA 1DTLA 1MHOA 5AEQA 1TOPA 1KCYA 1A4PA 1F4QA 1AJ4A 5HKZA 1F70A 1WLMA 2NZ0A 4GGFC 1CM4A 3DVEA 4HREE 4PDZA 2ZNDA 1OMDA 3EVVA 4XJKB 1A29A 1DJZA 1SCVA 1J7RA 2PRUA 1SL8A 3LCPC 2ZFDA 2PSRA 1J55A 3GK1A 2ZN9A 1UP5A 1NX0A 2H61C 2KGBC 4FTGA 1B7TZ 1A03A 2CTNA 3CWGA 1ZFSA 1OE9B 1YRUB 4WQ3A 1K95A 4R1EA 2G2BA 2LLTA 4JWQA 1LINA 4MBEA 2WCBA 2K0JA 3CLNA 1NX3A 1QIVA 2M9GA 1UHNA 3D0YB 2P6BB 4GAOA 2K7BA 1UHHA 2AUCA 2HPSA 2KQ6A 3M0WA 3NSIA 2WC8A 2LHIA 2JT8A 1B7TY 1OMVA 1XA5A 2WCFA 3FIAA 3FWCA 1XYDA 1JFJA 1C7WA 1CDNA 1NX1A 3EVRA 1M39A 3GOFA 3EK8A 3VRRA 1XK4C 1QS7A 1ALWA 3OB2B 2LMVA 3WNXB 1KFUL 2ZRTA 2K7OA 1ZUZA 2JTTA 3RM1A 1WDCC 2AAOA 4QJ3B 1XFYO 2LP2A 1FF1A 1TNPA 1CMFA 2JXLA 1QV1A 3SG2A 3BUWB 2KBMA 2LV7A 1QLKA 1AK8A 1XFVO 2LMUA 3NSOA 2JWWA 1WRZA 1YUSA 2L4HA 2BKIB 1UWOA 5HKYA 3DF0B 3CGAA 1VRKA 2Y1NA 4MN0A 2KAVA 3EVUA 2MA2A 4DIRA 1UHKA 2K2FA 3KO0A 3PLFB 5KSZA 1YRTB 2I2RE 5CSFA 5BPJA 3VRNA 1SNLA 2K7CA 2M97A 1DGUA 1WDCB 2K61A 1KK8C 3LL8B 1WRLA 1LKJA 3I5HC 4DCKA 1K96A 2M3WA 2MLFC 2LM5A 3VGOA 4MRXA 1H4BA 3LLEA 1JBAA 2F3YA 3BUOB 1U5IA 2L0PA 3RLZA 4D1EA 1C07A 3OB1B 2LLUA 4FQOA 2LUCA 1S6IA 2OTGC 2ZNEA 1CM1A 2NLNA 1YURA 1WY9A 3NXAA 2QPTA 4YBHB 1QVIZ 3F45A 2L51A 3SIAA 4P5OE 4AQIA 1SYMA 1NX2A 4I5LB 1CFFA 3AAJA 5TNCA 2BCBA 2A4JA 2LE9B 1H8BA 2MRDA 4C0JA 4OVNF 2EGDA 1KK8B 1F8HA 2Q4UA 5DKQA 1XFWO 1J1EA 3I5HB 1IGVA 4MLWA 2M0RA 5D69A 3VROA 1KSMA 1QV0A 1QTXA 1SY9A 2JU0A 3WHTB 1CFCA 1FI5A 5I2LA 2JOJA 1JF2A 1KFXL 2GGZA 1QATA 2PALA 2MLEC 4MEWA 1IG5A
chains in the Genus database with same CATH superfamily
1YVHA 2LMTA 2WOSA 2KHNA 4MZJA 1F54A 1BT6A 2KI6D 2LLSA 1OZOA 1RECA 3R1VA 2BCAA 2OTGB 1QJTA 3FS7A 1QX5B 3S0GA 5JJGA 4MZLA 2VRGA 3EKJA 4F7FA 5FI6A 1YR5A 4HSZA 3KEVA 1Y1XA 2JPOA 3CR5X 4MSPA 2CNPA 2KAXA 3PM8A 3AAKA 2KYCA 3ZWHA 4NDDA 4PHKA 1DT7B 1DVIA 1A75A 2YGUA 1DJIA 1WLZA 2JXCA 3NGVA 2NCOA 2WCKA 5FI7A 3CZ0A 1YUTA 2KFFA 3DY9A 4CFQA 4MZKA 1W7IB 2BL0C 1K94A 1M63B 2HETA 3S0FA 5IBWA 2PQLA 1JWDA 3EG5B 3CS1A 1QASA 4YGDB 3VRPA 2DOQA 5HKWA 1CKKA 3WHUB 4ORAB 3TZ1A 4AOMA 2QDIA 2JZIA 2LHLA 3B88A 3MSEB 1CDMA 2E30A 3BUXB 2M7NA 4JPZB 2ZN8A 4HRGA 2KOTA 1MR8A 2KI4C 2MBXA 1TIZA 1CNPA 3OGNA 1TRFA 1G4YR 1JFKA 1WRKA 4NDCA 1J7QA 5G08A 2LVIA 1SL9A 1IWQA 2L4IA 1K93D 1BOCA 4USLA 3NSLA 5HL1A 2FCEA 3BXKA 1F55A 1NCYA 3E3RA 3EK4A 1PK0D 4GUKA 2M29A 2BL0B 2M7LA 1RROA 2KAYA 5ER4X 4AQJA 4GNKB 1PVAA 1E8AA 1EL4A 1HT9A 1AJ5A 1MXEA 4OKHA 4QJ5B 1L2OC 3SG4A 4N1GA 2WCHA 1NYAA 1M45A 3BOWA 1NCXA 4DRWA 1ZMZA 1XO5A 4C0KA 4YRUA 3I5IC 3BUMB 1G33A 3BFAA 2PMYA 5CSNA 2CT9A 3PN7C 3I5GC 2KI4B 5HYDA 3VRQA 2AMIA 3CDNA 3PJIA 1CFPA 2LVVA 3GK4X 2WCEA 3S0BA 4L9MA 3OBVA 2I94A 2Y4QA 1JF0A 3LK1A 1JC2A 1OQPA 1J1DA 3FE6A 1TN4A 1IRJA 1NCZA 2GTEA 2R2IA 4ICBA 3TDIA 5D3OA 2Q91A 1IH0A 1DJYA 2SCPA 3R72A 1TNXA 1CLBA 2GGMA 2KSPA 2QEBA 4DS7A 3R1PA 3SG3A 2WC5A 1JSAA 2ZKMX 1DF0A 1L2OB 1NSHA 1DJGA 1EJ3A 4ORCB 2KLDA 3IQQA 4A4BA 4E68A 1KK7Z 1Q80A 1TWOA 1KQVA 2LCPA 1QX2A 1XVJA 1QX7A 3I5IB 4C0LA 1J7PA 2Y5IA 3PFVA 3IQOA 1R2UA 3I5GB 1AP4A 3BYAA 1B8RA 1B4CA 1S5GZ 1ALVA 5I94A 5CSJA 1KK7Y 2EC6C 1DELA 3OHMB 5ER5A 2BBNA 2JQ6A 2JT0A 4PHMA 1B9AA 3CTNA 3SG5A 3D74A 4CPVA 1TTXA 4WQ2A 2OPOA 1LXFC 4ORBB 2TN4A 2NXQA 1S5GY 4YI9A 2KFHA 1CLMA 2LC5A 1YVLA 4GPLB 5EL2A 1V1FA 4XJKA 4DUQA 4ZCVA 1SBJA 3D77A 2P70A 2LANA 2L5YA 1MWNA 1L7ZA 2RGIA 1BU3A 1YX8A 3BFBA 1DJHA 5AXIA 1S36A 3AKAA 2I7AA 4HRHA 1LA3A 2LUXA 3KPXA 2F8PA 4N1FA 3BFHA 3IF7A 1PRWA 1QVIY 3A8RA 3C1VA 1CFCA 1ZOTB 1KWOC 3D0YA 3O78A 4F0ZB 1YX7A 1M46A 2EC6B 4JQ0D 3SIBA 1BODA 2BKHB 2V53A 4OZDA 3ZNIA 2KPHA 1UHIA 1MF8B 1SL7A 4ZCUA 1B1GA 1CDPA 5FI2A 1DJWA 2K7DA 4NDBA 4PHJA 5CSIA 1IQ5A 1SSEB 1LVCD 1DQEA 4NQGA 2D8NA 2CBLA 4Q04A 3PALA 1EG3A 1K2HA 4CFRA 1GGZA 4GGNA 1BF5A 2QACA 4IJ7A 4OCIA 4OR9B 2FOTA 4P2YB 1DF0B 2CCMA 3O2PA 1B8CA 3KHEA 3CZTX 1GGWA 1IJ6A 1MXLC 5AFPA 2JNXA 2WC6A 1S1EA 1PVBA 3DYEA 4N5XA 1BJFA 1KWOB 1UURA 1FI6A 2OS8C 3OX6A 1NUBA 1PSRA 1U5IB 1B8LA 1Y6WA 1ZACA 3PATA 2FJUB 3EK7A 4YI8A 5AERA 2WCJA 5KU1A 1OW4A 2ZRSA 5F6TA 2JC2A 1XK4A 2F33A 1NPQA 1EG4A 2B1UA 3K21A 4A4CA 1KQMC 4YGBB 5DKRA 1AVSA 4PHNA 4UPGA 3TUYC 2JRFA 3AKBA 2KQYA 3OP0A 2FCDA 1XFXO 1CFDA 3BUNB 1UHJA 1S6CA 2BAPA 1SPYA 3TDZA 2E6WA 2Y1MA 1DJXA 2G9BA 4GBAA 1SCMC 2JPTA 2LAPA 3QMEA 1K9KA 1PULA 5FYXA 3SG6A 3SJSA 3BJHA 1SR6C 1C3ZA 2BCXA 1C7VA 2KI6C 2OS8B 3JTDC 4I5JA 2M8UA 2L5XB 1XFUO 2HQ8A 2KFGA 2JT3A 1BLQA 2BE6A 1QXPA 2WORA 1DMOA 2LP3A 2MHHA 4MRYA 1K9PA 1SKTA 1SK6D 2F3ZA 1Y1UA 1Y0VH 1B47A 3L47A 2F2OA 3UO9A 2KYFA 1CB1A 1ODBA 1NP8A 1D1OA 1KQMB 1W9ZA 4PALA 1OZSA 3ICBA 2PASA 1NWDA 3D75A 3TUYB 3NHTA 1IJ5A 1SMGA 2KGRA 1DGVA 1K9UA 2LVKA 1TNQA 2F2PA 4M2OA 2KDHA 1N65A 3BQ3A 1A75B 2PYQA 1CMGA 1FBVA 1EH2A 4JKTA 3I5FC 4I5KA 5HLOA 5PALA 2MJWB 4JD9A 5DKNA 3VB1A 1SCMB 1V1GA 2WNDA 1ORGA 4TNCA 1BG1A 5I2OA 1TUZA 1RJVA 3DXLA 3GK2A 3O4XA 1SRAA 1SR6B 4XYNA 1F4OA 4GFTA 1MQ1A 2L2EA 5KTYA 3JTDB 3JVTC 1KFUS 1RWYA 1RFJA 2JULA 1YUUA 4I5NB 1GJYA 1LA0A 4KYNA 4INXA 1FPWA 2H2KA 3HCMA 2IS9A 3DD4A 1CLLA 1G8IA 4YGCB 2JTZA 3DVJA 3PN7B 4M2PA 2BECA 5JOLA 2ISDA 3UNWA 4ETOA 1FW4A 1IKUA 1X02A 2LNKA 1RK9A 4BY4A 1OMRA 1IQ3A 2QEVA 1JUOA 1OSAA 2EHBA 1XFRA 2O5GA 3D10A 3TDUA 1OOFA 4INWA 2HQWA 4CLNA 3OX5A 5HLVA 5B8IB 4IL1A 3WXAA 3CR4X 3O6BA 4YGAA 2KNEA 1MUXA 3I5FB 4QJ4B 4PE7A 4M2QA 1BMOA 3EKHA 2BBMA 2GV5A 5I8NA 5I2QA 1S3PA 2L2CA 3JVTB 2L98A 2NCPA 2LVJA 2O60A 4WRIA 3K1EA 3D73A 3S0AA 3L4AA 2K60A 1K90D 2L50A 3A4UB 3BOWB 2SASA 3DVMA 3TS5C 4YGEB 4OV2A 1F71A 1A2XA 1OOIX 1SW8A 1GQMA 5DICA 3R1OA 1M31A 3KF9A 1N0YA 2ERBA 3CR2A 3NSKA 3B86A 3CZ1A 1W7JB 3H4SE 5CPVA 3SS3A 5D7FA 1BR1B 1T14A 2MAZA 1S6JA 3RZSA 2M1UA 1S26D 5AANA 1QIWA 2CXJA 1CTRA 3FWBA 2HF5A 4GGFA 5J3XA 2I18A 1NIWA 1BR4B 1OOJA 3QRXA 5GQQC 3SG7A 1RTP1 4FQTA 3DVKA 1AUIB 1PSBA 4MVFA 1TCFA 1XFZO 1Y1AA 2M49B 3PSRA 4BY5A 3HX4A 2JNFA 1HQVA 3LK0A 3PM2A 2K2AA 2H61A 1PALA 2QEHA 4PE1A 2QEOA 2PVBA 2K8MB 1K8UA 3TS5B 4U8DA 3S0EA 1YTZC 4CIDA 1J7OA 1EXRA 2BNXA 5K89A 1N2DA 2M1KB 3B7AA 1CDLA 2P71A 1KSOA 1GM0A 2COLB 1TNWA 1AHRA 1KFXS 1TCOB 1UUSA 4PE4A 1R6PA 4PCWA 3DF0A 4PE0A 2WCLA 1QLSA 3O4YA 2BE4A 2KBIA 1DTLA 1MHOA 5AEQA 1TOPA 1KCYA 1A4PA 1F4QA 1AJ4A 5HKZA 1F70A 1WLMA 2NZ0A 4GGFC 1CM4A 3DVEA 4HREE 4PDZA 2ZNDA 1OMDA 1P28A 2FJYA 3EVVA 4XJKB 1A29A 1DJZA 1SCVA 1J7RA 2PRUA 1SL8A 1Z4HA 2ZFDA 2PSRA 3LCPC 1J55A 3GK1A 1DC1A 2ZN9A 1UP5A 3DZTA 1NX0A 2H61C 2KGBC 4FTGA 1B7TZ 1A03A 2CTNA 5D69A 3CWGA 1ZFSA 1OE9B 1YRUB 4WQ3A 1K95A 4R1EA 2G2BA 2LLTA 4JWQA 1LINA 3B6XA 4MBEA 2WCBA 2K0JA 3CLNA 1C3YA 1NX3A 1OOHA 1QIVA 2M9GA 1UHNA 3D0YB 2P6BB 4GAOA 2K7BA 1UHHA 2AUCA 2HPSA 2KQ6A 3M0WA 3NSIA 2WC8A 2LHIA 2JT8A 1B7TY 1OMVA 1XA5A 2KLEA 2WCFA 3FIAA 3FWCA 1XYDA 1DEKA 1JFJA 1C7WA 1CDNA 1NX1A 3EVRA 3SS4A 1M39A 3GOFA 3EK8A 3VRRA 1XK4C 1QS7A 1ALWA 3OB2B 3FE9A 2LMVA 3WNXB 3S0DA 1LS8A 1KFUL 2ZRTA 2K7OA 1ZUZA 2JTTA 2WCMA 3RM1A 1WDCC 2AAOA 4QJ3B 1XFYO 2LP2A 1OOGA 1FF1A 1TNPA 1CMFA 2JXLA 1QV1A 3SG2A 3BUWB 3B87A 2KBMA 2LV7A 1QWVA 1QLKA 1AK8A 1XFVO 2LMUA 3NSOA 2JWWA 1WRZA 1YUSA 3SS5A 2L4HA 2BKIB 3IVTA 1UWOA 5HKYA 1IIOA 3DF0B 3CGAA 1VRKA 2Y1NA 4MN0A 3CABA 2KAVA 3EVUA 2MA2A 4DIRA 1UHKA 3V2LA 2K2FA 3KO0A 3PLFB 5KSZA 1YRTB 2H8VA 2I2RE 5CSFA 5BPJA 3D76A 3VRNA 1SNLA 3NHIA 2K7CA 2M97A 1DGUA 1WDCB 2K61A 1KK8C 3LL8B 1WRLA 1LKJA 3I5HC 4DCKA 1K96A 2M3WA 2MLFC 2LM5A 3VGOA 3N7HA 4PT1A 4MRXA 1H4BA 3LLEA 1JBAA 2F3YA 3BUOB 1U5IA 2L0PA 3RLZA 4D1EA 1C07A 3OB1B 3CZ2A 2LLUA 4FQOA 2LUCA 1S6IA 2OTGC 2ZNEA 1CM1A 2NLNA 1YURA 1WY9A 3NXAA 2QPTA 3D78A 3CYZA 3Q8IA 1Z2CB 4YBHB 1QVIZ 3F45A 2L51A 3SIAA 4P5OE 4AQIA 1SYMA 1NX2A 4I5LB 1CFFA 3AAJA 5TNCA 2BCBA 2A4JA 2LE9B 1H8BA 2MRDA 4C0JA 4OVNF 2EGDA 1KK8B 1F8HA 2Q4UA 5DKQA 1XFWO 1J1EA 3I5HB 1IGVA 4MLWA 2M0RA 3FE8A 1TUJA 1KSMA 1QV0A 1QTXA 1SY9A 2JU0A 3L4LA 3VROA 3WHTB 5I2LA 1FI5A 2JOJA 1JF2A 1KFXL 2GGZA 1QATA 2PALA 2MLEC 4MEWA 1IG5A
chains in the Genus database with same CATH topology
1YVHA 2LMTA 2WOSA 2KHNA 4MZJA 1F54A 1BT6A 2KI6D 2LLSA 1OZOA 1RECA 2BCAA 2OTGB 1QJTA 3FS7A 1QX5B 5JJGA 4MZLA 2VRGA 3EKJA 1YR5A 4HSZA 3KEVA 1Y1XA 3CR5X 4MSPA 2CNPA 2KAXA 3PM8A 3AAKA 2KYCA 3ZWHA 4NDDA 4PHKA 1DT7B 1DVIA 1A75A 1DJIA 1WLZA 2JXCA 2NCOA 1YUTA 2KFFA 4CFQA 4MZKA 1W7IB 2BL0C 1K94A 1M63B 2HETA 5IBWA 1JWDA 3CS1A 1QASA 4YGDB 3VRPA 2DOQA 5HKWA 1CKKA 3WHUB 4ORAB 3TZ1A 4AOMA 2JZIA 2LHLA 3MSEB 1CDMA 2E30A 3BUXB 2M7NA 4JPZB 2ZN8A 4HRGA 2KOTA 1MR8A 2KI4C 2MBXA 1TIZA 1CNPA 1TRFA 1G4YR 1JFKA 1WRKA 4NDCA 1J7QA 5G08A 2LVIA 1SL9A 1IWQA 2L4IA 1K93D 1BOCA 4USLA 3NSLA 2FCEA 3BXKA 1F55A 1NCYA 3E3RA 3EK4A 1PK0D 4GUKA 2M29A 2BL0B 2M7LA 1RROA 2KAYA 5ER4X 4AQJA 4GNKB 1PVAA 1E8AA 1EL4A 1HT9A 1AJ5A 1MXEA 4OKHA 4QJ5B 1L2OC 3SG4A 4N1GA 1NYAA 1M45A 3BOWA 1NCXA 4DRWA 1ZMZA 1XO5A 4C0KA 4YRUA 3I5IC 3BUMB 1G33A 5CSNA 2PMYA 2CT9A 3PN7C 3I5GC 2KI4B 5HYDA 3VRQA 2AMIA 1CFPA 2LVVA 3GK4X 2WCEA 4L9MA 2I94A 2Y4QA 1JF0A 3LK1A 1JC2A 1OQPA 1J1DA 3TDIA 1TN4A 1IRJA 1NCZA 2R2IA 4ICBA 2Q91A 1IH0A 1DJYA 2SCPA 1TNXA 1CLBA 2GGMA 2KSPA 4DS7A 3SG3A 1JSAA 2ZKMX 1DF0A 1L2OB 1NSHA 1DJGA 1EJ3A 4ORCB 3IQQA 4A4BA 4E68A 1KK7Z 1Q80A 1KQVA 2LCPA 1QX2A 1XVJA 1QX7A 3I5IB 4C0LA 1J7PA 2Y5IA 3PFVA 3IQOA 1R2UA 3I5GB 1AP4A 3BYAA 1B8RA 1B4CA 1S5GZ 1ALVA 5CSJA 1KK7Y 2EC6C 3OHMB 5ER5A 2BBNA 2JQ6A 2JT0A 4PHMA 1B9AA 3CTNA 3SG5A 4CPVA 1TTXA 4WQ2A 2OPOA 1LXFC 4ORBB 2TN4A 2NXQA 1S5GY 4YI9A 2KFHA 1CLMA 2LC5A 1YVLA 4GPLB 1V1FA 4XJKA 4DUQA 4ZCVA 1SBJA 2LANA 1MWNA 1L7ZA 2RGIA 1BU3A 1YX8A 5AXIA 1DJHA 1S36A 3AKAA 2I7AA 4HRHA 1LA3A 2LUXA 3KPXA 2F8PA 4N1FA 3IF7A 1PRWA 1QVIY 3A8RA 3C1VA 1ZOTB 1KWOC 3D0YA 3O78A 4F0ZB 1YX7A 1M46A 2EC6B 4JQ0D 3SIBA 1BODA 2BKHB 2V53A 3ZNIA 1UHIA 1MF8B 1SL7A 4ZCUA 1B1GA 1CDPA 1DJWA 2K7DA 4NDBA 4PHJA 5CSIA 1IQ5A 1LVCD 4NQGA 2D8NA 2CBLA 4Q04A 3PALA 1EG3A 1K2HA 4CFRA 1GGZA 4GGNA 1BF5A 2QACA 4OCIA 4OR9B 4P2YB 2FOTA 1DF0B 2CCMA 3O2PA 1B8CA 3KHEA 3CZTX 1GGWA 1IJ6A 1MXLC 5AFPA 2JNXA 4N5XA 1S1EA 1PVBA 1BJFA 1KWOB 1UURA 1FI6A 2OS8C 3OX6A 1NUBA 1PSRA 1U5IB 1B8LA 1Y6WA 1ZACA 3PATA 2FJUB 3EK7A 4YI8A 5AERA 5KU1A 2ZRSA 5F6TA 2JC2A 1XK4A 2F33A 1NPQA 1EG4A 2B1UA 3K21A 4A4CA 1KQMC 4YGBB 5DKRA 1AVSA 4PHNA 4UPGA 3TUYC 2JRFA 3AKBA 2KQYA 3OP0A 2FCDA 1XFXO 1CFDA 3BUNB 1UHJA 1S6CA 1SPYA 3TDZA 2E6WA 2Y1MA 1DJXA 2G9BA 4GBAA 1SCMC 2JPTA 2LAPA 5FYXA 1K9KA 1PULA 3SG6A 3SJSA 1SR6C 1C7VA 2BCXA 2KI6C 2OS8B 3JTDC 4I5JA 2M8UA 2L5XB 1XFUO 2HQ8A 2KFGA 2JT3A 1BLQA 2BE6A 1QXPA 2WORA 1DMOA 2LP3A 2MHHA 4MRYA 1K9PA 1SKTA 1SK6D 2F3ZA 1Y1UA 1Y0VH 1B47A 2F2OA 1CB1A 2KYFA 1ODBA 1NP8A 1D1OA 1KQMB 4PALA 1OZSA 3ICBA 2PASA 1NWDA 3TUYB 1IJ5A 1SMGA 2KGRA 1DGVA 1K9UA 2LVKA 1TNQA 2F2PA 4M2OA 2KDHA 1N65A 3BQ3A 1A75B 1CMGA 1EH2A 1FBVA 3I5FC 4I5KA 5HLOA 5PALA 2MJWB 5DKNA 1SCMB 1V1GA 2WNDA 4TNCA 1BG1A 5I2OA 1RJVA 3GK2A 4XYNA 1SRAA 1SR6B 1F4OA 4GFTA 1MQ1A 2L2EA 5KTYA 3JTDB 3JVTC 1KFUS 1RWYA 1RFJA 2JULA 1YUUA 4I5NB 1GJYA 1LA0A 1FPWA 2H2KA 3HCMA 2IS9A 3DD4A 1CLLA 1G8IA 4YGCB 2JTZA 3DVJA 3PN7B 4M2PA 2BECA 5JOLA 2ISDA 4ETOA 1IKUA 1FW4A 1X02A 2LNKA 1RK9A 4BY4A 1OMRA 1IQ3A 1JUOA 1OSAA 2EHBA 2O5GA 3D10A 3TDUA 4CLNA 2HQWA 3OX5A 5HLVA 5B8IB 4IL1A 3WXAA 3CR4X 3O6BA 4YGAA 2KNEA 1MUXA 3I5FB 4QJ4B 4PE7A 4M2QA 1BMOA 3EKHA 2BBMA 2GV5A 5I8NA 5I2QA 1S3PA 3JVTB 2L98A 2NCPA 2LVJA 2O60A 4WRIA 1K90D 2L50A 3A4UB 3BOWB 2SASA 3DVMA 3TS5C 4YGEB 4OV2A 1F71A 1A2XA 1SW8A 1GQMA 1M31A 3KF9A 1N0YA 3CR2A 3NSKA 1W7JB 3H4SE 5CPVA 5D7FA 1BR1B 2MAZA 1S6JA 2M1UA 1S26D 5AANA 1QIWA 2CXJA 1CTRA 3FWBA 2HF5A 4GGFA 5J3XA 2I18A 1NIWA 1BR4B 1OOJA 3QRXA 5GQQC 3SG7A 1RTP1 3DVKA 1AUIB 1PSBA 4MVFA 1TCFA 1XFZO 1Y1AA 2M49B 3PSRA 4BY5A 3HX4A 2JNFA 1HQVA 3LK0A 2K2AA 2H61A 1PALA 4PE1A 2PVBA 2K8MB 1K8UA 3TS5B 4U8DA 4CIDA 1YTZC 1J7OA 1EXRA 5K89A 1N2DA 2M1KB 1CDLA 1KSOA 2COLB 1TNWA 1AHRA 1KFXS 1TCOB 1UUSA 4PE4A 1R6PA 4PCWA 3DF0A 4PE0A 1QLSA 3O4YA 2BE4A 2KBIA 1DTLA 1MHOA 5AEQA 1TOPA 1KCYA 1A4PA 1F4QA 1AJ4A 5HKZA 1F70A 1WLMA 2NZ0A 4GGFC 1CM4A 3DVEA 4HREE 4PDZA 2ZNDA 1OMDA 3EVVA 4XJKB 1A29A 1DJZA 1SCVA 1J7RA 2PRUA 1SL8A 3LCPC 2ZFDA 2PSRA 1J55A 3GK1A 2ZN9A 1UP5A 1NX0A 2H61C 2KGBC 4FTGA 1B7TZ 1A03A 2CTNA 3CWGA 1ZFSA 1OE9B 1YRUB 4WQ3A 1K95A 4R1EA 2G2BA 2LLTA 4JWQA 1LINA 4MBEA 2WCBA 2K0JA 3CLNA 1NX3A 1QIVA 2M9GA 1UHNA 3D0YB 2P6BB 4GAOA 2K7BA 1UHHA 2AUCA 2HPSA 2KQ6A 3M0WA 3NSIA 2WC8A 2LHIA 2JT8A 1B7TY 1OMVA 1XA5A 2WCFA 3FIAA 3FWCA 1XYDA 1JFJA 1C7WA 1CDNA 1NX1A 3EVRA 1M39A 3GOFA 3EK8A 3VRRA 1XK4C 1QS7A 1ALWA 3OB2B 2LMVA 3WNXB 1KFUL 2ZRTA 2K7OA 1ZUZA 2JTTA 3RM1A 1WDCC 2AAOA 4QJ3B 1XFYO 2LP2A 1FF1A 1TNPA 1CMFA 2JXLA 1QV1A 3SG2A 3BUWB 2KBMA 2LV7A 1QLKA 1AK8A 1XFVO 2LMUA 3NSOA 2JWWA 1WRZA 1YUSA 2L4HA 2BKIB 1UWOA 5HKYA 3DF0B 3CGAA 1VRKA 2Y1NA 4MN0A 2KAVA 3EVUA 2MA2A 4DIRA 1UHKA 2K2FA 3KO0A 3PLFB 5KSZA 1YRTB 2I2RE 5CSFA 5BPJA 3VRNA 1SNLA 2K7CA 2M97A 1DGUA 1WDCB 2K61A 1KK8C 3LL8B 1WRLA 1LKJA 3I5HC 4DCKA 1K96A 2M3WA 2MLFC 2LM5A 3VGOA 4MRXA 1H4BA 3LLEA 1JBAA 2F3YA 3BUOB 1U5IA 2L0PA 3RLZA 4D1EA 1C07A 3OB1B 2LLUA 4FQOA 2LUCA 1S6IA 2OTGC 2ZNEA 1CM1A 2NLNA 1YURA 1WY9A 3NXAA 2QPTA 4YBHB 1QVIZ 3F45A 2L51A 3SIAA 4P5OE 4AQIA 1SYMA 1NX2A 4I5LB 1CFFA 3AAJA 5TNCA 2BCBA 2A4JA 2LE9B 1H8BA 2MRDA 4C0JA 4OVNF 2EGDA 1KK8B 1F8HA 2Q4UA 5DKQA 1XFWO 1J1EA 3I5HB 1IGVA 4MLWA 2M0RA 5D69A 3VROA 1KSMA 1QV0A 1QTXA 1SY9A 2JU0A 3WHTB 1CFCA 1FI5A 5I2LA 2JOJA 1JF2A 1KFXL 2GGZA 1QATA 2PALA 2MLEC 4MEWA 1IG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVH A;  2LMT A;  2WOS A;  2KHN A;  4MZJ A;  1F54 A;  1BT6 A;  2KI6 D;  2LLS A;  1OZO A;  1REC A;  2BCA A;  2OTG B;  1QJT A;  3FS7 A;  1QX5 B;  5JJG A;  4MZL A;  2VRG A;  3EKJ A;  1YR5 A;  4HSZ A;  3KEV A;  1Y1X A;  3CR5 X;  4MSP A;  2CNP A;  2KAX A;  3PM8 A;  3AAK A;  2KYC A;  3ZWH A;  4NDD A;  4PHK A;  1DT7 B;  1DVI A;  1A75 A;  1DJI A;  1WLZ A;  2JXC A;  2NCO A;  1YUT A;  2KFF A;  4CFQ A;  4MZK A;  1W7I B;  2BL0 C;  1K94 A;  1M63 B;  2HET A;  5IBW A;  1JWD A;  3CS1 A;  1QAS A;  4YGD B;  3VRP A;  2DOQ A;  5HKW A;  1CKK A;  3WHU B;  4ORA B;  3TZ1 A;  4AOM A;  2JZI A;  2LHL A;  3MSE B;  1CDM A;  2E30 A;  3BUX B;  2M7N A;  4JPZ B;  2ZN8 A;  4HRG A;  2KOT A;  1MR8 A;  2KI4 C;  2MBX A;  1TIZ A;  1CNP A;  1TRF A;  1G4Y R;  1JFK A;  1WRK A;  4NDC A;  1J7Q A;  5G08 A;  2LVI A;  1SL9 A;  1IWQ A;  2L4I A;  1K93 D;  1BOC A;  4USL A;  3NSL A;  2FCE A;  3BXK A;  1F55 A;  1NCY A;  3E3R A;  3EK4 A;  1PK0 D;  4GUK A;  2M29 A;  2BL0 B;  2M7L A;  1RRO A;  2KAY A;  5ER4 X;  4AQJ A;  4GNK B;  1PVA A;  1E8A A;  1EL4 A;  1HT9 A;  1AJ5 A;  1MXE A;  4OKH A;  4QJ5 B;  1L2O C;  3SG4 A;  4N1G A;  1NYA A;  1M45 A;  3BOW A;  1NCX A;  4DRW A;  1ZMZ A;  1XO5 A;  4C0K A;  4YRU A;  3I5I C;  3BUM B;  1G33 A;  5CSN A;  2PMY A;  2CT9 A;  3PN7 C;  3I5G C;  2KI4 B;  5HYD A;  3VRQ A;  2AMI A;  1CFP A;  2LVV A;  3GK4 X;  2WCE A;  4L9M A;  2I94 A;  2Y4Q A;  1JF0 A;  3LK1 A;  1JC2 A;  1OQP A;  1J1D A;  3TDI A;  1TN4 A;  1IRJ A;  1NCZ A;  2R2I A;  4ICB A;  2Q91 A;  1IH0 A;  1DJY A;  2SCP A;  1TNX A;  1CLB A;  2GGM A;  2KSP A;  4DS7 A;  3SG3 A;  1JSA A;  2ZKM X;  1DF0 A;  1L2O B;  1NSH A;  1DJG A;  1EJ3 A;  4ORC B;  3IQQ A;  4A4B A;  4E68 A;  1KK7 Z;  1Q80 A;  1KQV A;  2LCP A;  1QX2 A;  1XVJ A;  1QX7 A;  3I5I B;  4C0L A;  1J7P A;  2Y5I A;  3PFV A;  3IQO A;  1R2U A;  3I5G B;  1AP4 A;  3BYA A;  1B8R A;  1B4C A;  1S5G Z;  1ALV A;  5CSJ A;  1KK7 Y;  2EC6 C;  3OHM B;  5ER5 A;  2BBN A;  2JQ6 A;  2JT0 A;  4PHM A;  1B9A A;  3CTN A;  3SG5 A;  4CPV A;  1TTX A;  4WQ2 A;  2OPO A;  1LXF C;  4ORB B;  2TN4 A;  2NXQ A;  1S5G Y;  4YI9 A;  2KFH A;  1CLM A;  2LC5 A;  1YVL A;  4GPL B;  1V1F A;  4XJK A;  4DUQ A;  4ZCV A;  1SBJ A;  2LAN A;  1MWN A;  1L7Z A;  2RGI A;  1BU3 A;  1YX8 A;  5AXI A;  1DJH A;  1S36 A;  3AKA A;  2I7A A;  4HRH A;  1LA3 A;  2LUX A;  3KPX A;  2F8P A;  4N1F A;  3IF7 A;  1PRW A;  1QVI Y;  3A8R A;  3C1V A;  1ZOT B;  1KWO C;  3D0Y A;  3O78 A;  4F0Z B;  1YX7 A;  1M46 A;  2EC6 B;  4JQ0 D;  3SIB A;  1BOD A;  2BKH B;  2V53 A;  3ZNI A;  1UHI A;  1MF8 B;  1SL7 A;  4ZCU A;  1B1G A;  1CDP A;  1DJW A;  2K7D A;  4NDB A;  4PHJ A;  5CSI A;  1IQ5 A;  1LVC D;  4NQG A;  2D8N A;  2CBL A;  4Q04 A;  3PAL A;  1EG3 A;  1K2H A;  4CFR A;  1GGZ A;  4GGN A;  1BF5 A;  2QAC A;  4OCI A;  4OR9 B;  4P2Y B;  2FOT A;  1DF0 B;  2CCM A;  3O2P A;  1B8C A;  3KHE A;  3CZT X;  1GGW A;  1IJ6 A;  1MXL C;  5AFP A;  2JNX A;  4N5X A;  1S1E A;  1PVB A;  1BJF A;  1KWO B;  1UUR A;  1FI6 A;  2OS8 C;  3OX6 A;  1NUB A;  1PSR A;  1U5I B;  1B8L A;  1Y6W A;  1ZAC A;  3PAT A;  2FJU B;  3EK7 A;  4YI8 A;  5AER A;  5KU1 A;  2ZRS A;  5F6T A;  2JC2 A;  1XK4 A;  2F33 A;  1NPQ A;  1EG4 A;  2B1U A;  3K21 A;  4A4C A;  1KQM C;  4YGB B;  5DKR A;  1AVS A;  4PHN A;  4UPG A;  3TUY C;  2JRF A;  3AKB A;  2KQY A;  3OP0 A;  2FCD A;  1XFX O;  1CFD A;  3BUN B;  1UHJ A;  1S6C A;  1SPY A;  3TDZ A;  2E6W A;  2Y1M A;  1DJX A;  2G9B A;  4GBA A;  1SCM C;  2JPT A;  2LAP A;  5FYX A;  1K9K A;  1PUL A;  3SG6 A;  3SJS A;  1SR6 C;  1C7V A;  2BCX A;  2KI6 C;  2OS8 B;  3JTD C;  4I5J A;  2M8U A;  2L5X B;  1XFU O;  2HQ8 A;  2KFG A;  2JT3 A;  1BLQ A;  2BE6 A;  1QXP A;  2WOR A;  1DMO A;  2LP3 A;  2MHH A;  4MRY A;  1K9P A;  1SKT A;  1SK6 D;  2F3Z A;  1Y1U A;  1Y0V H;  1B47 A;  2F2O A;  1CB1 A;  2KYF A;  1ODB A;  1NP8 A;  1D1O A;  1KQM B;  4PAL A;  1OZS A;  3ICB A;  2PAS A;  1NWD A;  3TUY B;  1IJ5 A;  1SMG A;  2KGR A;  1DGV A;  1K9U A;  2LVK A;  1TNQ A;  2F2P A;  4M2O A;  2KDH A;  1N65 A;  3BQ3 A;  1A75 B;  1CMG A;  1EH2 A;  1FBV A;  3I5F C;  4I5K A;  5HLO A;  5PAL A;  2MJW B;  5DKN A;  1SCM B;  1V1G A;  2WND A;  4TNC A;  1BG1 A;  5I2O A;  1RJV A;  3GK2 A;  4XYN A;  1SRA A;  1SR6 B;  1F4O A;  4GFT A;  1MQ1 A;  2L2E A;  5KTY A;  3JTD B;  3JVT C;  1KFU S;  1RWY A;  1RFJ A;  2JUL A;  1YUU A;  4I5N B;  1GJY A;  1LA0 A;  1FPW A;  2H2K A;  3HCM A;  2IS9 A;  3DD4 A;  1CLL A;  1G8I A;  4YGC B;  2JTZ A;  3DVJ A;  3PN7 B;  4M2P A;  2BEC A;  5JOL A;  2ISD A;  4ETO A;  1IKU A;  1FW4 A;  1X02 A;  2LNK A;  1RK9 A;  4BY4 A;  1OMR A;  1IQ3 A;  1JUO A;  1OSA A;  2EHB A;  2O5G A;  3D10 A;  3TDU A;  4CLN A;  2HQW A;  3OX5 A;  5HLV A;  5B8I B;  4IL1 A;  3WXA A;  3CR4 X;  3O6B A;  4YGA A;  2KNE A;  1MUX A;  3I5F B;  4QJ4 B;  4PE7 A;  4M2Q A;  1BMO A;  3EKH A;  2BBM A;  2GV5 A;  5I8N A;  5I2Q A;  1S3P A;  3JVT B;  2L98 A;  2NCP A;  2LVJ A;  2O60 A;  4WRI A;  1K90 D;  2L50 A;  3A4U B;  3BOW B;  2SAS A;  3DVM A;  3TS5 C;  4YGE B;  4OV2 A;  1F71 A;  1A2X A;  1SW8 A;  1GQM A;  1M31 A;  3KF9 A;  1N0Y A;  3CR2 A;  3NSK A;  1W7J B;  3H4S E;  5CPV A;  5D7F A;  1BR1 B;  2MAZ A;  1S6J A;  2M1U A;  1S26 D;  5AAN A;  1QIW A;  2CXJ A;  1CTR A;  3FWB A;  2HF5 A;  4GGF A;  5J3X A;  2I18 A;  1NIW A;  1BR4 B;  1OOJ A;  3QRX A;  5GQQ C;  3SG7 A;  1RTP 1;  3DVK A;  1AUI B;  1PSB A;  4MVF A;  1TCF A;  1XFZ O;  1Y1A A;  2M49 B;  3PSR A;  4BY5 A;  3HX4 A;  2JNF A;  1HQV A;  3LK0 A;  2K2A A;  2H61 A;  1PAL A;  4PE1 A;  2PVB A;  2K8M B;  1K8U A;  3TS5 B;  4U8D A;  4CID A;  1YTZ C;  1J7O A;  1EXR A;  5K89 A;  1N2D A;  2M1K B;  1CDL A;  1KSO A;  2COL B;  1TNW A;  1AHR A;  1KFX S;  1TCO B;  1UUS A;  4PE4 A;  1R6P A;  4PCW A;  3DF0 A;  4PE0 A;  1QLS A;  3O4Y A;  2BE4 A;  2KBI A;  1DTL A;  1MHO A;  5AEQ A;  1TOP A;  1KCY A;  1A4P A;  1F4Q A;  1AJ4 A;  5HKZ A;  1F70 A;  1WLM A;  2NZ0 A;  4GGF C;  1CM4 A;  3DVE A;  4HRE E;  4PDZ A;  2ZND A;  1OMD A;  3EVV A;  4XJK B;  1A29 A;  1DJZ A;  1SCV A;  1J7R A;  2PRU A;  1SL8 A;  3LCP C;  2ZFD A;  2PSR A;  1J55 A;  3GK1 A;  2ZN9 A;  1UP5 A;  1NX0 A;  2H61 C;  2KGB C;  4FTG A;  1B7T Z;  1A03 A;  2CTN A;  3CWG A;  1ZFS A;  1OE9 B;  1YRU B;  4WQ3 A;  1K95 A;  4R1E A;  2G2B A;  2LLT A;  4JWQ A;  1LIN A;  4MBE A;  2WCB A;  2K0J A;  3CLN A;  1NX3 A;  1QIV A;  2M9G A;  1UHN A;  3D0Y B;  2P6B B;  4GAO A;  2K7B A;  1UHH A;  2AUC A;  2HPS A;  2KQ6 A;  3M0W A;  3NSI A;  2WC8 A;  2LHI A;  2JT8 A;  1B7T Y;  1OMV A;  1XA5 A;  2WCF A;  3FIA A;  3FWC A;  1XYD A;  1JFJ A;  1C7W A;  1CDN A;  1NX1 A;  3EVR A;  1M39 A;  3GOF A;  3EK8 A;  3VRR A;  1XK4 C;  1QS7 A;  1ALW A;  3OB2 B;  2LMV A;  3WNX B;  1KFU L;  2ZRT A;  2K7O A;  1ZUZ A;  2JTT A;  3RM1 A;  1WDC C;  2AAO A;  4QJ3 B;  1XFY O;  2LP2 A;  1FF1 A;  1TNP A;  1CMF A;  2JXL A;  1QV1 A;  3SG2 A;  3BUW B;  2KBM A;  2LV7 A;  1QLK A;  1AK8 A;  1XFV O;  2LMU A;  3NSO A;  2JWW A;  1WRZ A;  1YUS A;  2L4H A;  2BKI B;  1UWO A;  5HKY A;  3DF0 B;  3CGA A;  1VRK A;  2Y1N A;  4MN0 A;  2KAV A;  3EVU A;  2MA2 A;  4DIR A;  1UHK A;  2K2F A;  3KO0 A;  3PLF B;  5KSZ A;  1YRT B;  2I2R E;  5CSF A;  5BPJ A;  3VRN A;  1SNL A;  2K7C A;  2M97 A;  1DGU A;  1WDC B;  2K61 A;  1KK8 C;  3LL8 B;  1WRL A;  1LKJ A;  3I5H C;  4DCK A;  1K96 A;  2M3W A;  2MLF C;  2LM5 A;  3VGO A;  4MRX A;  1H4B A;  3LLE A;  1JBA A;  2F3Y A;  3BUO B;  1U5I A;  2L0P A;  3RLZ A;  4D1E A;  1C07 A;  3OB1 B;  2LLU A;  4FQO A;  2LUC A;  1S6I A;  2OTG C;  2ZNE A;  1CM1 A;  2NLN A;  1YUR A;  1WY9 A;  3NXA A;  2QPT A;  4YBH B;  1QVI Z;  3F45 A;  2L51 A;  3SIA A;  4P5O E;  4AQI A;  1SYM A;  1NX2 A;  4I5L B;  1CFF A;  3AAJ A;  5TNC A;  2BCB A;  2A4J A;  2LE9 B;  1H8B A;  2MRD A;  4C0J A;  4OVN F;  2EGD A;  1KK8 B;  1F8H A;  2Q4U A;  5DKQ A;  1XFW O;  1J1E A;  3I5H B;  1IGV A;  4MLW A;  2M0R A;  5D69 A;  3VRO A;  1KSM A;  1QV0 A;  1QTX A;  1SY9 A;  2JU0 A;  3WHT B;  1CFC A;  1FI5 A;  5I2L A;  2JOJ A;  1JF2 A;  1KFX L;  2GGZ A;  1QAT A;  2PAL A;  2MLE C;  4MEW A;  1IG5 A; 
#chains in the Genus database with same CATH topology
 1YVH A;  2LMT A;  2WOS A;  2KHN A;  4MZJ A;  1F54 A;  1BT6 A;  2KI6 D;  2LLS A;  1OZO A;  1REC A;  3R1V A;  2BCA A;  2OTG B;  1QJT A;  3FS7 A;  1QX5 B;  3S0G A;  5JJG A;  4MZL A;  2VRG A;  3EKJ A;  4F7F A;  5FI6 A;  1YR5 A;  4HSZ A;  3KEV A;  1Y1X A;  2JPO A;  3CR5 X;  4MSP A;  2CNP A;  2KAX A;  3PM8 A;  3AAK A;  2KYC A;  3ZWH A;  4NDD A;  4PHK A;  1DT7 B;  1DVI A;  1A75 A;  2YGU A;  1DJI A;  1WLZ A;  2JXC A;  3NGV A;  2NCO A;  2WCK A;  5FI7 A;  3CZ0 A;  1YUT A;  2KFF A;  3DY9 A;  4CFQ A;  4MZK A;  1W7I B;  2BL0 C;  1K94 A;  1M63 B;  2HET A;  3S0F A;  5IBW A;  2PQL A;  1JWD A;  3EG5 B;  3CS1 A;  1QAS A;  4YGD B;  3VRP A;  2DOQ A;  5HKW A;  1CKK A;  3WHU B;  4ORA B;  3TZ1 A;  4AOM A;  2QDI A;  2JZI A;  2LHL A;  3B88 A;  3MSE B;  1CDM A;  2E30 A;  3BUX B;  2M7N A;  4JPZ B;  2ZN8 A;  4HRG A;  2KOT A;  1MR8 A;  2KI4 C;  2MBX A;  1TIZ A;  1CNP A;  3OGN A;  1TRF A;  1G4Y R;  1JFK A;  1WRK A;  4NDC A;  1J7Q A;  5G08 A;  2LVI A;  1SL9 A;  1IWQ A;  2L4I A;  1K93 D;  1BOC A;  4USL A;  3NSL A;  5HL1 A;  2FCE A;  3BXK A;  1F55 A;  1NCY A;  3E3R A;  3EK4 A;  1PK0 D;  4GUK A;  2M29 A;  2BL0 B;  2M7L A;  1RRO A;  2KAY A;  5ER4 X;  4AQJ A;  4GNK B;  1PVA A;  1E8A A;  1EL4 A;  1HT9 A;  1AJ5 A;  1MXE A;  4OKH A;  4QJ5 B;  1L2O C;  3SG4 A;  4N1G A;  2WCH A;  1NYA A;  1M45 A;  3BOW A;  1NCX A;  4DRW A;  1ZMZ A;  1XO5 A;  4C0K A;  4YRU A;  3I5I C;  3BUM B;  1G33 A;  3BFA A;  2PMY A;  5CSN A;  2CT9 A;  3PN7 C;  3I5G C;  2KI4 B;  5HYD A;  3VRQ A;  2AMI A;  3CDN A;  3PJI A;  1CFP A;  2LVV A;  3GK4 X;  2WCE A;  3S0B A;  4L9M A;  3OBV A;  2I94 A;  2Y4Q A;  1JF0 A;  3LK1 A;  1JC2 A;  1OQP A;  1J1D A;  3FE6 A;  1TN4 A;  1IRJ A;  1NCZ A;  2GTE A;  2R2I A;  4ICB A;  3TDI A;  5D3O A;  2Q91 A;  1IH0 A;  1DJY A;  2SCP A;  3R72 A;  1TNX A;  1CLB A;  2GGM A;  2KSP A;  2QEB A;  4DS7 A;  3R1P A;  3SG3 A;  2WC5 A;  1JSA A;  2ZKM X;  1DF0 A;  1L2O B;  1NSH A;  1DJG A;  1EJ3 A;  4ORC B;  2KLD A;  3IQQ A;  4A4B A;  4E68 A;  1KK7 Z;  1Q80 A;  1TWO A;  1KQV A;  2LCP A;  1QX2 A;  1XVJ A;  1QX7 A;  3I5I B;  4C0L A;  1J7P A;  2Y5I A;  3PFV A;  3IQO A;  1R2U A;  3I5G B;  1AP4 A;  3BYA A;  1B8R A;  1B4C A;  1S5G Z;  1ALV A;  5I94 A;  5CSJ A;  1KK7 Y;  2EC6 C;  1DEL A;  3OHM B;  5ER5 A;  2BBN A;  2JQ6 A;  2JT0 A;  4PHM A;  1B9A A;  3CTN A;  3SG5 A;  3D74 A;  4CPV A;  1TTX A;  4WQ2 A;  2OPO A;  1LXF C;  4ORB B;  2TN4 A;  2NXQ A;  1S5G Y;  4YI9 A;  2KFH A;  1CLM A;  2LC5 A;  1YVL A;  4GPL B;  5EL2 A;  1V1F A;  4XJK A;  4DUQ A;  4ZCV A;  1SBJ A;  3D77 A;  2P70 A;  2LAN A;  2L5Y A;  1MWN A;  1L7Z A;  2RGI A;  1BU3 A;  1YX8 A;  3BFB A;  1DJH A;  5AXI A;  1S36 A;  3AKA A;  2I7A A;  4HRH A;  1LA3 A;  2LUX A;  3KPX A;  2F8P A;  4N1F A;  3BFH A;  3IF7 A;  1PRW A;  1QVI Y;  3A8R A;  3C1V A;  1CFC A;  1ZOT B;  1KWO C;  3D0Y A;  3O78 A;  4F0Z B;  1YX7 A;  1M46 A;  2EC6 B;  4JQ0 D;  3SIB A;  1BOD A;  2BKH B;  2V53 A;  4OZD A;  3ZNI A;  2KPH A;  1UHI A;  1MF8 B;  1SL7 A;  4ZCU A;  1B1G A;  1CDP A;  5FI2 A;  1DJW A;  2K7D A;  4NDB A;  4PHJ A;  5CSI A;  1IQ5 A;  1SSE B;  1LVC D;  1DQE A;  4NQG A;  2D8N A;  2CBL A;  4Q04 A;  3PAL A;  1EG3 A;  1K2H A;  4CFR A;  1GGZ A;  4GGN A;  1BF5 A;  2QAC A;  4IJ7 A;  4OCI A;  4OR9 B;  2FOT A;  4P2Y B;  1DF0 B;  2CCM A;  3O2P A;  1B8C A;  3KHE A;  3CZT X;  1GGW A;  1IJ6 A;  1MXL C;  5AFP A;  2JNX A;  2WC6 A;  1S1E A;  1PVB A;  3DYE A;  4N5X A;  1BJF A;  1KWO B;  1UUR A;  1FI6 A;  2OS8 C;  3OX6 A;  1NUB A;  1PSR A;  1U5I B;  1B8L A;  1Y6W A;  1ZAC A;  3PAT A;  2FJU B;  3EK7 A;  4YI8 A;  5AER A;  2WCJ A;  5KU1 A;  1OW4 A;  2ZRS A;  5F6T A;  2JC2 A;  1XK4 A;  2F33 A;  1NPQ A;  1EG4 A;  2B1U A;  3K21 A;  4A4C A;  1KQM C;  4YGB B;  5DKR A;  1AVS A;  4PHN A;  4UPG A;  3TUY C;  2JRF A;  3AKB A;  2KQY A;  3OP0 A;  2FCD A;  1XFX O;  1CFD A;  3BUN B;  1UHJ A;  1S6C A;  2BAP A;  1SPY A;  3TDZ A;  2E6W A;  2Y1M A;  1DJX A;  2G9B A;  4GBA A;  1SCM C;  2JPT A;  2LAP A;  3QME A;  1K9K A;  1PUL A;  5FYX A;  3SG6 A;  3SJS A;  3BJH A;  1SR6 C;  1C3Z A;  2BCX A;  1C7V A;  2KI6 C;  2OS8 B;  3JTD C;  4I5J A;  2M8U A;  2L5X B;  1XFU O;  2HQ8 A;  2KFG A;  2JT3 A;  1BLQ A;  2BE6 A;  1QXP A;  2WOR A;  1DMO A;  2LP3 A;  2MHH A;  4MRY A;  1K9P A;  1SKT A;  1SK6 D;  2F3Z A;  1Y1U A;  1Y0V H;  1B47 A;  3L47 A;  2F2O A;  3UO9 A;  2KYF A;  1CB1 A;  1ODB A;  1NP8 A;  1D1O A;  1KQM B;  1W9Z A;  4PAL A;  1OZS A;  3ICB A;  2PAS A;  1NWD A;  3D75 A;  3TUY B;  3NHT A;  1IJ5 A;  1SMG A;  2KGR A;  1DGV A;  1K9U A;  2LVK A;  1TNQ A;  2F2P A;  4M2O A;  2KDH A;  1N65 A;  3BQ3 A;  1A75 B;  2PYQ A;  1CMG A;  1FBV A;  1EH2 A;  4JKT A;  3I5F C;  4I5K A;  5HLO A;  5PAL A;  2MJW B;  4JD9 A;  5DKN A;  3VB1 A;  1SCM B;  1V1G A;  2WND A;  1ORG A;  4TNC A;  1BG1 A;  5I2O A;  1TUZ A;  1RJV A;  3DXL A;  3GK2 A;  3O4X A;  1SRA A;  1SR6 B;  4XYN A;  1F4O A;  4GFT A;  1MQ1 A;  2L2E A;  5KTY A;  3JTD B;  3JVT C;  1KFU S;  1RWY A;  1RFJ A;  2JUL A;  1YUU A;  4I5N B;  1GJY A;  1LA0 A;  4KYN A;  4INX A;  1FPW A;  2H2K A;  3HCM A;  2IS9 A;  3DD4 A;  1CLL A;  1G8I A;  4YGC B;  2JTZ A;  3DVJ A;  3PN7 B;  4M2P A;  2BEC A;  5JOL A;  2ISD A;  3UNW A;  4ETO A;  1FW4 A;  1IKU A;  1X02 A;  2LNK A;  1RK9 A;  4BY4 A;  1OMR A;  1IQ3 A;  2QEV A;  1JUO A;  1OSA A;  2EHB A;  1XFR A;  2O5G A;  3D10 A;  3TDU A;  1OOF A;  4INW A;  2HQW A;  4CLN A;  3OX5 A;  5HLV A;  5B8I B;  4IL1 A;  3WXA A;  3CR4 X;  3O6B A;  4YGA A;  2KNE A;  1MUX A;  3I5F B;  4QJ4 B;  4PE7 A;  4M2Q A;  1BMO A;  3EKH A;  2BBM A;  2GV5 A;  5I8N A;  5I2Q A;  1S3P A;  2L2C A;  3JVT B;  2L98 A;  2NCP A;  2LVJ A;  2O60 A;  4WRI A;  3K1E A;  3D73 A;  3S0A A;  3L4A A;  2K60 A;  1K90 D;  2L50 A;  3A4U B;  3BOW B;  2SAS A;  3DVM A;  3TS5 C;  4YGE B;  4OV2 A;  1F71 A;  1A2X A;  1OOI X;  1SW8 A;  1GQM A;  5DIC A;  3R1O A;  1M31 A;  3KF9 A;  1N0Y A;  2ERB A;  3CR2 A;  3NSK A;  3B86 A;  3CZ1 A;  1W7J B;  3H4S E;  5CPV A;  3SS3 A;  5D7F A;  1BR1 B;  1T14 A;  2MAZ A;  1S6J A;  3RZS A;  2M1U A;  1S26 D;  5AAN A;  1QIW A;  2CXJ A;  1CTR A;  3FWB A;  2HF5 A;  4GGF A;  5J3X A;  2I18 A;  1NIW A;  1BR4 B;  1OOJ A;  3QRX A;  5GQQ C;  3SG7 A;  1RTP 1;  4FQT A;  3DVK A;  1AUI B;  1PSB A;  4MVF A;  1TCF A;  1XFZ O;  1Y1A A;  2M49 B;  3PSR A;  4BY5 A;  3HX4 A;  2JNF A;  1HQV A;  3LK0 A;  3PM2 A;  2K2A A;  2H61 A;  1PAL A;  2QEH A;  4PE1 A;  2QEO A;  2PVB A;  2K8M B;  1K8U A;  3TS5 B;  4U8D A;  3S0E A;  1YTZ C;  4CID A;  1J7O A;  1EXR A;  2BNX A;  5K89 A;  1N2D A;  2M1K B;  3B7A A;  1CDL A;  2P71 A;  1KSO A;  1GM0 A;  2COL B;  1TNW A;  1AHR A;  1KFX S;  1TCO B;  1UUS A;  4PE4 A;  1R6P A;  4PCW A;  3DF0 A;  4PE0 A;  2WCL A;  1QLS A;  3O4Y A;  2BE4 A;  2KBI A;  1DTL A;  1MHO A;  5AEQ A;  1TOP A;  1KCY A;  1A4P A;  1F4Q A;  1AJ4 A;  5HKZ A;  1F70 A;  1WLM A;  2NZ0 A;  4GGF C;  1CM4 A;  3DVE A;  4HRE E;  4PDZ A;  2ZND A;  1OMD A;  1P28 A;  2FJY A;  3EVV A;  4XJK B;  1A29 A;  1DJZ A;  1SCV A;  1J7R A;  2PRU A;  1SL8 A;  1Z4H A;  2ZFD A;  2PSR A;  3LCP C;  1J55 A;  3GK1 A;  1DC1 A;  2ZN9 A;  1UP5 A;  3DZT A;  1NX0 A;  2H61 C;  2KGB C;  4FTG A;  1B7T Z;  1A03 A;  2CTN A;  5D69 A;  3CWG A;  1ZFS A;  1OE9 B;  1YRU B;  4WQ3 A;  1K95 A;  4R1E A;  2G2B A;  2LLT A;  4JWQ A;  1LIN A;  3B6X A;  4MBE A;  2WCB A;  2K0J A;  3CLN A;  1C3Y A;  1NX3 A;  1OOH A;  1QIV A;  2M9G A;  1UHN A;  3D0Y B;  2P6B B;  4GAO A;  2K7B A;  1UHH A;  2AUC A;  2HPS A;  2KQ6 A;  3M0W A;  3NSI A;  2WC8 A;  2LHI A;  2JT8 A;  1B7T Y;  1OMV A;  1XA5 A;  2KLE A;  2WCF A;  3FIA A;  3FWC A;  1XYD A;  1DEK A;  1JFJ A;  1C7W A;  1CDN A;  1NX1 A;  3EVR A;  3SS4 A;  1M39 A;  3GOF A;  3EK8 A;  3VRR A;  1XK4 C;  1QS7 A;  1ALW A;  3OB2 B;  3FE9 A;  2LMV A;  3WNX B;  3S0D A;  1LS8 A;  1KFU L;  2ZRT A;  2K7O A;  1ZUZ A;  2JTT A;  2WCM A;  3RM1 A;  1WDC C;  2AAO A;  4QJ3 B;  1XFY O;  2LP2 A;  1OOG A;  1FF1 A;  1TNP A;  1CMF A;  2JXL A;  1QV1 A;  3SG2 A;  3BUW B;  3B87 A;  2KBM A;  2LV7 A;  1QWV A;  1QLK A;  1AK8 A;  1XFV O;  2LMU A;  3NSO A;  2JWW A;  1WRZ A;  1YUS A;  3SS5 A;  2L4H A;  2BKI B;  3IVT A;  1UWO A;  5HKY A;  1IIO A;  3DF0 B;  3CGA A;  1VRK A;  2Y1N A;  4MN0 A;  3CAB A;  2KAV A;  3EVU A;  2MA2 A;  4DIR A;  1UHK A;  3V2L A;  2K2F A;  3KO0 A;  3PLF B;  5KSZ A;  1YRT B;  2H8V A;  2I2R E;  5CSF A;  5BPJ A;  3D76 A;  3VRN A;  1SNL A;  3NHI A;  2K7C A;  2M97 A;  1DGU A;  1WDC B;  2K61 A;  1KK8 C;  3LL8 B;  1WRL A;  1LKJ A;  3I5H C;  4DCK A;  1K96 A;  2M3W A;  2MLF C;  2LM5 A;  3VGO A;  3N7H A;  4PT1 A;  4MRX A;  1H4B A;  3LLE A;  1JBA A;  2F3Y A;  3BUO B;  1U5I A;  2L0P A;  3RLZ A;  4D1E A;  1C07 A;  3OB1 B;  3CZ2 A;  2LLU A;  4FQO A;  2LUC A;  1S6I A;  2OTG C;  2ZNE A;  1CM1 A;  2NLN A;  1YUR A;  1WY9 A;  3NXA A;  2QPT A;  3D78 A;  3CYZ A;  3Q8I A;  1Z2C B;  4YBH B;  1QVI Z;  3F45 A;  2L51 A;  3SIA A;  4P5O E;  4AQI A;  1SYM A;  1NX2 A;  4I5L B;  1CFF A;  3AAJ A;  5TNC A;  2BCB A;  2A4J A;  2LE9 B;  1H8B A;  2MRD A;  4C0J A;  4OVN F;  2EGD A;  1KK8 B;  1F8H A;  2Q4U A;  5DKQ A;  1XFW O;  1J1E A;  3I5H B;  1IGV A;  4MLW A;  2M0R A;  3FE8 A;  1TUJ A;  1KSM A;  1QV0 A;  1QTX A;  1SY9 A;  2JU0 A;  3L4L A;  3VRO A;  3WHT B;  5I2L A;  1FI5 A;  2JOJ A;  1JF2 A;  1KFX L;  2GGZ A;  1QAT A;  2PAL A;  2MLE C;  4MEW A;  1IG5 A; 
#chains in the Genus database with same CATH homology
 1YVH A;  2LMT A;  2WOS A;  2KHN A;  4MZJ A;  1F54 A;  1BT6 A;  2KI6 D;  2LLS A;  1OZO A;  1REC A;  2BCA A;  2OTG B;  1QJT A;  3FS7 A;  1QX5 B;  5JJG A;  4MZL A;  2VRG A;  3EKJ A;  1YR5 A;  4HSZ A;  3KEV A;  1Y1X A;  3CR5 X;  4MSP A;  2CNP A;  2KAX A;  3PM8 A;  3AAK A;  2KYC A;  3ZWH A;  4NDD A;  4PHK A;  1DT7 B;  1DVI A;  1A75 A;  1DJI A;  1WLZ A;  2JXC A;  2NCO A;  1YUT A;  2KFF A;  4CFQ A;  4MZK A;  1W7I B;  2BL0 C;  1K94 A;  1M63 B;  2HET A;  5IBW A;  1JWD A;  3CS1 A;  1QAS A;  4YGD B;  3VRP A;  2DOQ A;  5HKW A;  1CKK A;  3WHU B;  4ORA B;  3TZ1 A;  4AOM A;  2JZI A;  2LHL A;  3MSE B;  1CDM A;  2E30 A;  3BUX B;  2M7N A;  4JPZ B;  2ZN8 A;  4HRG A;  2KOT A;  1MR8 A;  2KI4 C;  2MBX A;  1TIZ A;  1CNP A;  1TRF A;  1G4Y R;  1JFK A;  1WRK A;  4NDC A;  1J7Q A;  5G08 A;  2LVI A;  1SL9 A;  1IWQ A;  2L4I A;  1K93 D;  1BOC A;  4USL A;  3NSL A;  2FCE A;  3BXK A;  1F55 A;  1NCY A;  3E3R A;  3EK4 A;  1PK0 D;  4GUK A;  2M29 A;  2BL0 B;  2M7L A;  1RRO A;  2KAY A;  5ER4 X;  4AQJ A;  4GNK B;  1PVA A;  1E8A A;  1EL4 A;  1HT9 A;  1AJ5 A;  1MXE A;  4OKH A;  4QJ5 B;  1L2O C;  3SG4 A;  4N1G A;  1NYA A;  1M45 A;  3BOW A;  1NCX A;  4DRW A;  1ZMZ A;  1XO5 A;  4C0K A;  4YRU A;  3I5I C;  3BUM B;  1G33 A;  5CSN A;  2PMY A;  2CT9 A;  3PN7 C;  3I5G C;  2KI4 B;  5HYD A;  3VRQ A;  2AMI A;  1CFP A;  2LVV A;  3GK4 X;  2WCE A;  4L9M A;  2I94 A;  2Y4Q A;  1JF0 A;  3LK1 A;  1JC2 A;  1OQP A;  1J1D A;  3TDI A;  1TN4 A;  1IRJ A;  1NCZ A;  2R2I A;  4ICB A;  2Q91 A;  1IH0 A;  1DJY A;  2SCP A;  1TNX A;  1CLB A;  2GGM A;  2KSP A;  4DS7 A;  3SG3 A;  1JSA A;  2ZKM X;  1DF0 A;  1L2O B;  1NSH A;  1DJG A;  1EJ3 A;  4ORC B;  3IQQ A;  4A4B A;  4E68 A;  1KK7 Z;  1Q80 A;  1KQV A;  2LCP A;  1QX2 A;  1XVJ A;  1QX7 A;  3I5I B;  4C0L A;  1J7P A;  2Y5I A;  3PFV A;  3IQO A;  1R2U A;  3I5G B;  1AP4 A;  3BYA A;  1B8R A;  1B4C A;  1S5G Z;  1ALV A;  5CSJ A;  1KK7 Y;  2EC6 C;  3OHM B;  5ER5 A;  2BBN A;  2JQ6 A;  2JT0 A;  4PHM A;  1B9A A;  3CTN A;  3SG5 A;  4CPV A;  1TTX A;  4WQ2 A;  2OPO A;  1LXF C;  4ORB B;  2TN4 A;  2NXQ A;  1S5G Y;  4YI9 A;  2KFH A;  1CLM A;  2LC5 A;  1YVL A;  4GPL B;  1V1F A;  4XJK A;  4DUQ A;  4ZCV A;  1SBJ A;  2LAN A;  1MWN A;  1L7Z A;  2RGI A;  1BU3 A;  1YX8 A;  5AXI A;  1DJH A;  1S36 A;  3AKA A;  2I7A A;  4HRH A;  1LA3 A;  2LUX A;  3KPX A;  2F8P A;  4N1F A;  3IF7 A;  1PRW A;  1QVI Y;  3A8R A;  3C1V A;  1ZOT B;  1KWO C;  3D0Y A;  3O78 A;  4F0Z B;  1YX7 A;  1M46 A;  2EC6 B;  4JQ0 D;  3SIB A;  1BOD A;  2BKH B;  2V53 A;  3ZNI A;  1UHI A;  1MF8 B;  1SL7 A;  4ZCU A;  1B1G A;  1CDP A;  1DJW A;  2K7D A;  4NDB A;  4PHJ A;  5CSI A;  1IQ5 A;  1LVC D;  4NQG A;  2D8N A;  2CBL A;  4Q04 A;  3PAL A;  1EG3 A;  1K2H A;  4CFR A;  1GGZ A;  4GGN A;  1BF5 A;  2QAC A;  4OCI A;  4OR9 B;  4P2Y B;  2FOT A;  1DF0 B;  2CCM A;  3O2P A;  1B8C A;  3KHE A;  3CZT X;  1GGW A;  1IJ6 A;  1MXL C;  5AFP A;  2JNX A;  4N5X A;  1S1E A;  1PVB A;  1BJF A;  1KWO B;  1UUR A;  1FI6 A;  2OS8 C;  3OX6 A;  1NUB A;  1PSR A;  1U5I B;  1B8L A;  1Y6W A;  1ZAC A;  3PAT A;  2FJU B;  3EK7 A;  4YI8 A;  5AER A;  5KU1 A;  2ZRS A;  5F6T A;  2JC2 A;  1XK4 A;  2F33 A;  1NPQ A;  1EG4 A;  2B1U A;  3K21 A;  4A4C A;  1KQM C;  4YGB B;  5DKR A;  1AVS A;  4PHN A;  4UPG A;  3TUY C;  2JRF A;  3AKB A;  2KQY A;  3OP0 A;  2FCD A;  1XFX O;  1CFD A;  3BUN B;  1UHJ A;  1S6C A;  1SPY A;  3TDZ A;  2E6W A;  2Y1M A;  1DJX A;  2G9B A;  4GBA A;  1SCM C;  2JPT A;  2LAP A;  5FYX A;  1K9K A;  1PUL A;  3SG6 A;  3SJS A;  1SR6 C;  1C7V A;  2BCX A;  2KI6 C;  2OS8 B;  3JTD C;  4I5J A;  2M8U A;  2L5X B;  1XFU O;  2HQ8 A;  2KFG A;  2JT3 A;  1BLQ A;  2BE6 A;  1QXP A;  2WOR A;  1DMO A;  2LP3 A;  2MHH A;  4MRY A;  1K9P A;  1SKT A;  1SK6 D;  2F3Z A;  1Y1U A;  1Y0V H;  1B47 A;  2F2O A;  1CB1 A;  2KYF A;  1ODB A;  1NP8 A;  1D1O A;  1KQM B;  4PAL A;  1OZS A;  3ICB A;  2PAS A;  1NWD A;  3TUY B;  1IJ5 A;  1SMG A;  2KGR A;  1DGV A;  1K9U A;  2LVK A;  1TNQ A;  2F2P A;  4M2O A;  2KDH A;  1N65 A;  3BQ3 A;  1A75 B;  1CMG A;  1EH2 A;  1FBV A;  3I5F C;  4I5K A;  5HLO A;  5PAL A;  2MJW B;  5DKN A;  1SCM B;  1V1G A;  2WND A;  4TNC A;  1BG1 A;  5I2O A;  1RJV A;  3GK2 A;  4XYN A;  1SRA A;  1SR6 B;  1F4O A;  4GFT A;  1MQ1 A;  2L2E A;  5KTY A;  3JTD B;  3JVT C;  1KFU S;  1RWY A;  1RFJ A;  2JUL A;  1YUU A;  4I5N B;  1GJY A;  1LA0 A;  1FPW A;  2H2K A;  3HCM A;  2IS9 A;  3DD4 A;  1CLL A;  1G8I A;  4YGC B;  2JTZ A;  3DVJ A;  3PN7 B;  4M2P A;  2BEC A;  5JOL A;  2ISD A;  4ETO A;  1IKU A;  1FW4 A;  1X02 A;  2LNK A;  1RK9 A;  4BY4 A;  1OMR A;  1IQ3 A;  1JUO A;  1OSA A;  2EHB A;  2O5G A;  3D10 A;  3TDU A;  4CLN A;  2HQW A;  3OX5 A;  5HLV A;  5B8I B;  4IL1 A;  3WXA A;  3CR4 X;  3O6B A;  4YGA A;  2KNE A;  1MUX A;  3I5F B;  4QJ4 B;  4PE7 A;  4M2Q A;  1BMO A;  3EKH A;  2BBM A;  2GV5 A;  5I8N A;  5I2Q A;  1S3P A;  3JVT B;  2L98 A;  2NCP A;  2LVJ A;  2O60 A;  4WRI A;  1K90 D;  2L50 A;  3A4U B;  3BOW B;  2SAS A;  3DVM A;  3TS5 C;  4YGE B;  4OV2 A;  1F71 A;  1A2X A;  1SW8 A;  1GQM A;  1M31 A;  3KF9 A;  1N0Y A;  3CR2 A;  3NSK A;  1W7J B;  3H4S E;  5CPV A;  5D7F A;  1BR1 B;  2MAZ A;  1S6J A;  2M1U A;  1S26 D;  5AAN A;  1QIW A;  2CXJ A;  1CTR A;  3FWB A;  2HF5 A;  4GGF A;  5J3X A;  2I18 A;  1NIW A;  1BR4 B;  1OOJ A;  3QRX A;  5GQQ C;  3SG7 A;  1RTP 1;  3DVK A;  1AUI B;  1PSB A;  4MVF A;  1TCF A;  1XFZ O;  1Y1A A;  2M49 B;  3PSR A;  4BY5 A;  3HX4 A;  2JNF A;  1HQV A;  3LK0 A;  2K2A A;  2H61 A;  1PAL A;  4PE1 A;  2PVB A;  2K8M B;  1K8U A;  3TS5 B;  4U8D A;  4CID A;  1YTZ C;  1J7O A;  1EXR A;  5K89 A;  1N2D A;  2M1K B;  1CDL A;  1KSO A;  2COL B;  1TNW A;  1AHR A;  1KFX S;  1TCO B;  1UUS A;  4PE4 A;  1R6P A;  4PCW A;  3DF0 A;  4PE0 A;  1QLS A;  3O4Y A;  2BE4 A;  2KBI A;  1DTL A;  1MHO A;  5AEQ A;  1TOP A;  1KCY A;  1A4P A;  1F4Q A;  1AJ4 A;  5HKZ A;  1F70 A;  1WLM A;  2NZ0 A;  4GGF C;  1CM4 A;  3DVE A;  4HRE E;  4PDZ A;  2ZND A;  1OMD A;  3EVV A;  4XJK B;  1A29 A;  1DJZ A;  1SCV A;  1J7R A;  2PRU A;  1SL8 A;  3LCP C;  2ZFD A;  2PSR A;  1J55 A;  3GK1 A;  2ZN9 A;  1UP5 A;  1NX0 A;  2H61 C;  2KGB C;  4FTG A;  1B7T Z;  1A03 A;  2CTN A;  3CWG A;  1ZFS A;  1OE9 B;  1YRU B;  4WQ3 A;  1K95 A;  4R1E A;  2G2B A;  2LLT A;  4JWQ A;  1LIN A;  4MBE A;  2WCB A;  2K0J A;  3CLN A;  1NX3 A;  1QIV A;  2M9G A;  1UHN A;  3D0Y B;  2P6B B;  4GAO A;  2K7B A;  1UHH A;  2AUC A;  2HPS A;  2KQ6 A;  3M0W A;  3NSI A;  2WC8 A;  2LHI A;  2JT8 A;  1B7T Y;  1OMV A;  1XA5 A;  2WCF A;  3FIA A;  3FWC A;  1XYD A;  1JFJ A;  1C7W A;  1CDN A;  1NX1 A;  3EVR A;  1M39 A;  3GOF A;  3EK8 A;  3VRR A;  1XK4 C;  1QS7 A;  1ALW A;  3OB2 B;  2LMV A;  3WNX B;  1KFU L;  2ZRT A;  2K7O A;  1ZUZ A;  2JTT A;  3RM1 A;  1WDC C;  2AAO A;  4QJ3 B;  1XFY O;  2LP2 A;  1FF1 A;  1TNP A;  1CMF A;  2JXL A;  1QV1 A;  3SG2 A;  3BUW B;  2KBM A;  2LV7 A;  1QLK A;  1AK8 A;  1XFV O;  2LMU A;  3NSO A;  2JWW A;  1WRZ A;  1YUS A;  2L4H A;  2BKI B;  1UWO A;  5HKY A;  3DF0 B;  3CGA A;  1VRK A;  2Y1N A;  4MN0 A;  2KAV A;  3EVU A;  2MA2 A;  4DIR A;  1UHK A;  2K2F A;  3KO0 A;  3PLF B;  5KSZ A;  1YRT B;  2I2R E;  5CSF A;  5BPJ A;  3VRN A;  1SNL A;  2K7C A;  2M97 A;  1DGU A;  1WDC B;  2K61 A;  1KK8 C;  3LL8 B;  1WRL A;  1LKJ A;  3I5H C;  4DCK A;  1K96 A;  2M3W A;  2MLF C;  2LM5 A;  3VGO A;  4MRX A;  1H4B A;  3LLE A;  1JBA A;  2F3Y A;  3BUO B;  1U5I A;  2L0P A;  3RLZ A;  4D1E A;  1C07 A;  3OB1 B;  2LLU A;  4FQO A;  2LUC A;  1S6I A;  2OTG C;  2ZNE A;  1CM1 A;  2NLN A;  1YUR A;  1WY9 A;  3NXA A;  2QPT A;  4YBH B;  1QVI Z;  3F45 A;  2L51 A;  3SIA A;  4P5O E;  4AQI A;  1SYM A;  1NX2 A;  4I5L B;  1CFF A;  3AAJ A;  5TNC A;  2BCB A;  2A4J A;  2LE9 B;  1H8B A;  2MRD A;  4C0J A;  4OVN F;  2EGD A;  1KK8 B;  1F8H A;  2Q4U A;  5DKQ A;  1XFW O;  1J1E A;  3I5H B;  1IGV A;  4MLW A;  2M0R A;  5D69 A;  3VRO A;  1KSM A;  1QV0 A;  1QTX A;  1SY9 A;  2JU0 A;  3WHT B;  1CFC A;  1FI5 A;  5I2L A;  2JOJ A;  1JF2 A;  1KFX L;  2GGZ A;  1QAT A;  2PAL A;  2MLE C;  4MEW A;  1IG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...