1G8IA

Crystal structure of human frequenin (neuronal calcium sensor 1)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
182
Chain Sequence
SNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Immunocytochemical localization and crystal structure of human frequenin (neuronal calcium sensor 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 69
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA02
1DJXA 2BCBA 2KI6C 2M0RA 3EK7A 5JJGA 3OP0A 1YRUB 2KI4C 1WRLA 1B9AA 2HPSA 2WOSA 2M1KB 1ALVA 1B7TZ 4MRYA 1S1EA 1OMRA 2K61A 1PULA 2JT3A 2LLSA 1UURA 1SL9A 3AAJA 1BOCA 3PN7C 2K7BA 1K96A 2LVIA 4CPVA 4AQIA 1N65A 4YGEB 2K8MB 1CMFA 1XO5A 1XFVO 2LE9B 1M45A 2JNFA 3FS7A 3I5IC 1DJYA 3RLZA 1S6JA 1NWDA 3H4SE 1B1GA 1XK4A 5BPJA 1IRJA 1WRKA 2L4IA 5AERA 1CDLA 1TRFA 3BUXB 3I5GC 1EH2A 3CLNA 1S6IA 2L0PA 3AKAA 2L2EA 1XFYO 1JFJA 1C7WA 2A4JA 1MXEA 1NX2A 1WLMA 1H4BA 3A4UB 4YGDB 1CDPA 3I5HC 2F3YA 5PALA 1K9KA 1KK7Y 2LCPA 1K9UA 1PK0D 5DKQA 2HETA 2RGIA 3CR5X 4TNCA 3VRPA 4PDZA 1IJ5A 5F6TA 4GAOA 1BMOA 1YTZC 5I2QA 4M2PA 3TS5C 3NXAA 4MRXA 1JSAA 3FWBA 2HF5A 5HLOA 4ORCB 3KEVA 1TCOB 1PSRA 2ZRSA 4I5LB 1CDMA 1NCXA 2KYCA 1Y1XA 2BECA 1J7PA 5FYXA 1U5IA 2E6WA 4PE4A 2JRFA 1RROA 4E68A 1WLZA 1YRTB 1KCYA 1UUSA 4GBAA 1PALA 4DS7A 2M8UA 5CSJA 3TZ1A 1GJYA 1C07A 2CNPA 2H61C 2M3WA 3SIAA 1TOPA 1GGWA 3VRRA 2IS9A 2CT9A 2M97A 1MUXA 1UP5A 1K2HA 5ER5A 5DKRA 2MLEC 2G9BA 1BF5A 5HKWA 4PCWA 1RJVA 1MHOA 1NP8A 3PALA 2MAZA 3O4YA 3OX6A 2AAOA 4C0JA 1SL7A 3FIAA 4OR9B 1G4YR 1ALWA 1AHRA 1ZUZA 4U8DA 2WCEA 4YGBB 1SCVA 1DGVA 1NSHA 3JVTC 3SG4A 2E30A 5AFPA 1PRWA 2V53A 1LINA 2FCEA 3LLEA 1QLKA 2QACA 1S36A 3SJSA 4NDBA 2LVJA 1KK7Z 5D7FA 4WQ2A 2Y1MA 1B47A 4I5KA 2KYFA 4P2YB 2K7CA 2ZN8A 2PRUA 3O6BA 2Y1NA 1TTXA 1QX2A 2AUCA 2SASA 1K93D 4GPLB 1KQMC 2G2BA 1X02A 3SIBA 1TNWA 3GK2A 2PSRA 1CNPA 2PMYA 4JWQA 2LAPA 1UHIA 2F3ZA 3CR4X 1OOJA 1B4CA 1FF1A 1BR4B 1RECA 2LHIA 3EVUA 2LMUA 1QX7A 5CSIA 4M2QA 1DT7B 3F45A 1BODA 1KSOA 2F8PA 5ER4X 1KFXL 2AMIA 4NDCA 1B8LA 1NCYA 1UHKA 3QRXA 4BY5A 2MBXA 1NX1A 2LLUA 4XYNA 2EHBA 2DOQA 3BXKA 2MRDA 3EKHA 2OTGC 3EVVA 3VRQA 2JU0A 4WRIA 4PHMA 2WC8A 3SG5A 3CS1A 1DJIA 1J7QA 4MZLA 1F71A 1ZMZA 1XA5A 3PM8A 1QX5B 2L51A 4P5OE 1Q80A 1KFUL 3DF0B 5J3XA 2M7LA 3AAKA 1DJHA 3O78A 2LP3A 1F4QA 2JT8A 5CPVA 3PN7B 1W7IB 4HRHA 1QASA 1G33A 3BUMB 3MSEB 2R2IA 1IG5A 1ZOTB 2MJWB 1Y1UA 4OKHA 3I5IB 1CFDA 2JT0A 1FBVA 4YI8A 2NXQA 2JTTA 2F33A 2KSPA 2GV5A 3BOWB 5HKZA 1PSBA 1D1OA 1DMOA 1SBJA 3I5GB 5KU1A 4UPGA 2F2PA 3DVKA 4PE1A 3HX4A 3HCMA 2ZKMX 2CBLA 2KDHA 3DF0A 3DVMA 4ZCVA 4YRUA 3I5HB 2JPTA 1YUUA 4D1EA 1FI5A 1QVIY 4I5NB 2K7OA 1CFPA 4GUKA 1U5IB 3OB1B 3VROA 4MVFA 3ZWHA 3LCPC 1PVBA 1JUOA 1BR1B 1EJ3A 1OSAA 1A4PA 1L2OC 5I2LA 2L4HA 2FCDA 1XFZO 1MXLC 3DD4A 1KK8C 2KAXA 1UHNA 3BOWA 3EK4A 2KFHA 1OQPA 2O5GA 2KQYA 4C0LA 1DJGA 1Y6WA 1S26D 2L98A 1EG4A 1EXRA 4Q04A 4DIRA 1JWDA 4MZKA 1AP4A 4DCKA 1SY9A 2BCXA 4WQ3A 3TDZA 4A4BA 5CSNA 2MA2A 3VRNA 1SL8A 4XJKB 4N5XA 1F4OA 1E8AA 1NUBA 3WXAA 3TUYC 4PHKA 1ODBA 1LVCD 1M63B 3VGOA 1HT9A 3PLFB 1IWQA 1N0YA 3LK1A 3IF7A 3EKJA 1OMDA 4DUQA 1YVHA 5CSFA 1C7VA 2CCMA 2LP2A 3JTDC 3CWGA 4AQJA 4YGCB 1JF0A 3EK8A 2EC6C 3SG6A 1SR6C 1BLQA 1J1DA 2NZ0A 1IJ6A 3M0WA 1YX7A 3CZTX 2ZNEA 3JVTB 3PSRA 4XJKA 2LVVA 3PFVA 4GGFC 1AK8A 2GGZA 1KWOC 4ORAB 1SYMA 1XFUO 2H61A 1QS7A 1TIZA 2BBNA 2KBMA 1OE9B 1QV1A 1QVIZ 1SCMC 1MQ1A 4OCIA 3NSKA 4MSPA 4NQGA 2K7DA 5I2OA 3DVEA 1DVIA 2JOJA 1S5GY 4AOMA 4OVNF 3TDIA 2OS8C 3ZNIA 1IH0A 1QTXA 2M1UA 2COLB 1KQMB 1QIVA 1SW8A 3AKBA 5JOLA 4ICBA 1R6PA 1WDCB 2BL0C 1MR8A 1FI6A 1DF0A 2M9GA 1KFXS 1LXFC 2CTNA 1A03A 2PALA 1XYDA 4A4CA 2B1UA 1IGVA 4R1EA 2SCPA 1CDNA 4QJ5B 5GQQC 2M49B 1QV0A 5IBWA 2HQ8A 1QXPA 1YR5A 1F54A 3WHUB 1JBAA 1TNPA 2F2OA 2K2FA 2ZNDA 4JPZB 1FPWA 1KFUS 1AJ4A 2MLFC 4CFRA 2LC5A 1QATA 3BQ3A 1MF8B 2K2AA 2LHLA 1OMVA 1RFJA 2OTGB 4HREE 4PALA 4GGNA 3FWCA 5AANA 3LK0A 1XVJA 3O2PA 1OZOA 4ETOA 4MN0A 3LL8B 4MBEA 2BE4A 1SNLA 2I18A 2KI4B 1IQ3A 1CFFA 1S6CA 1G8IA 1VRKA 2JNXA 4NDDA 4QJ3B 1A29A 2WCBA 4QJ4B 2BE6A 2LM5A 2KFGA 3D0YB 4YI9A 3WNXB 1LA0A 1W7JB 1BJFA 2ISDA 1TCFA 2LVKA 3C1VA 2NCOA 1YUTA 1B8RA 1TN4A 4I5JA 3I5FC 1CLBA 4N1GA 3IQOA 1UHHA 2H2KA 5K89A 2KGRA 4GNKB 1RTP1 1S5GZ 1K9PA 1Y1AA 2BKIB 2LV7A 3EVRA 2M7NA 3GK4X 2KGBC 4USLA 1K94A 1CM4A 3BUNB 4M2OA 1V1GA 2JQ6A 1XK4C 4PE0A 1SPYA 3D0YA 2KAVA 3D10A 3K21A 4GFTA 4L9MA 1F55A 1CMGA 1NCZA 1DJZA 1NX0A 1L2OB 4MLWA 1GGZA 2KOTA 4ZCUA 4HSZA 2JULA 1JF2A 1DTLA 3OX5A 3BUWB 4PE7A 2KBIA 2VRGA 2I7AA 1KK8B 1NX3A 3E3RA 2WNDA 2HQWA 3TS5B 2TN4A 1SRAA 2BBMA 3A8RA 1J1EA 2FOTA 2P6BB 2OPOA 1SMGA 3BUOB 1EL4A 1CFCA 1AJ5A 3WHTB 2LLTA 2JTZA 2L50A 2JC2A 1KSMA 1RK9A 2JWWA 3TUYB 1IKUA 2KHNA 3SG2A 4F0ZB 2FJUB 3TDUA 1AUIB 1CKKA 3NSOA 3PATA 1B8CA 3JTDB 5HYDA 2CXJA 4YGAA 2ZFDA 1EG3A 1ZFSA 1MWNA 4C0KA 1CM1A 1SKTA 2EC6B 2LANA 4JQ0D 1SR6B 2PASA 1S3PA 1JFKA 1H8BA 1K90D 5G08A 1NIWA 3CGAA 4HRGA 4CFQA 2Y4QA 2KNEA 5D69A 1J7RA 3RM1A 1KWOB 2L5XB 2KAYA 2LMVA 1DF0B 1QJTA 1M31A 1J55A 3NSLA 2KQ6A 1IQ5A 1SCMB 2K0JA 5KTYA 1LKJA 2JXLA 1J7OA 2ZRTA 1CLMA 1XFWO 2BCAA 1OZSA 1UWOA 2Y5IA 2OS8B 2M29A 2WCFA 2JXCA 1F70A 4ORBB 5HKYA 3ICBA 1WRZA 1CLLA 5AXIA 2O60A 2KFFA 5HLVA 1QLSA 2BL0B 1K95A 5I8NA 4GGFA 1QIWA 4CIDA 3IQQA 4BY4A 1ZACA 4OV2A 1A2XA 1B7TY 1RWYA 1TNXA 1PVAA 2NLNA 1YX8A 1L7ZA 2LMTA 1FW4A 2LNKA 1NPQA 1XFXO 3CTNA 1HQVA 2JZIA 3GOFA 3GK1A 4IL1A 2I2RE 1F8HA 1A75B 1N2DA 1V1FA 3DVJA 1M39A 3OB2B 3OHMB 1JC2A 2BKHB 1BG1A 2GGMA 2ZN9A 2I94A 4YBHB 1TNQA 3KO0A 2Q91A 5DKNA 1KQVA 4FQOA 3KF9A 2MHHA 1Y0VH 1WDCC 1K8UA 4MZJA 1BU3A 4CLNA 2QPTA 1YURA 2D8NA 1R2UA 2LUXA 1DJWA 1M46A 5AEQA 4DRWA 2PVBA 1BT6A 1WY9A 3NSIA 2KI6D 2LUCA 2EGDA 3KHEA 3KPXA 1AVSA 1A75A 4PHNA 3I5FB 5B8IB 1YVLA 4MEWA 1CB1A 5KSZA 1LA3A 4FTGA 2NCPA 1UHJA 1SK6D 3BYAA 1GQMA 3SG7A 1DGUA 4PHJA 3CR2A 3SG3A 5TNCA 2Q4UA 1YUSA 4N1FA 1CTRA 1NYAA 2WORA
chains in the Genus database with same CATH superfamily
1DJXA 2BCBA 2KI6C 2M0RA 3EK7A 5JJGA 3OP0A 1YRUB 2KI4C 1WRLA 1B9AA 2HPSA 2WOSA 2M1KB 1ALVA 1B7TZ 4MRYA 3FE8A 1S1EA 1OMRA 2K61A 1PULA 2JT3A 2LLSA 1UURA 1SL9A 2YGUA 3AAJA 4FQTA 4HREE 1BOCA 3PN7C 2K7BA 1K96A 2LVIA 3IVTA 4CPVA 1TUJA 1XFRA 1IIOA 4AQIA 1N65A 4YGEB 2K8MB 1CMFA 1XO5A 1XFVO 2LE9B 1M45A 2JNFA 3FS7A 2BAPA 1DJYA 3I5IC 3RLZA 1S6JA 1NWDA 3H4SE 1B1GA 1XK4A 5BPJA 1IRJA 1WRKA 2L4IA 5AERA 1CDLA 1TRFA 3BUXB 3I5GC 1EH2A 3CLNA 1S6IA 2L0PA 3AKAA 1DC1A 2L2EA 1XFYO 1JFJA 1C7WA 2A4JA 1MXEA 1NX2A 1WLMA 1H4BA 3A4UB 4YGDB 1CDPA 3I5HC 2F3YA 5PALA 1K9KA 1KK7Y 3NHTA 2LCPA 1K9UA 1PK0D 5DKQA 2HETA 2RGIA 3CR5X 4TNCA 3VRPA 4PDZA 1IJ5A 5F6TA 2WC5A 4GAOA 1BMOA 1YTZC 5I2QA 4M2PA 3TS5C 3NXAA 2P70A 4MRXA 3D76A 1JSAA 3FWBA 2HF5A 5HLOA 1T14A 2BNXA 4ORCB 3KEVA 1TCOB 1PSRA 2ZRSA 4I5LB 1CDMA 1NCXA 2KYCA 1Y1XA 2BECA 1J7PA 5FYXA 1U5IA 2E6WA 3K1EA 4PE4A 4JKTA 2JRFA 1RROA 4E68A 1WLZA 1YRTB 1KCYA 1UUSA 4GBAA 1PALA 2WC6A 4DS7A 2M8UA 5CSJA 3TZ1A 1GJYA 1C07A 2CNPA 2H61C 2M3WA 3SIAA 1TOPA 1GGWA 3QMEA 3VRRA 2IS9A 3O4XA 3VB1A 2CT9A 2M97A 1MUXA 1UP5A 3S0EA 5ER5A 5DKRA 4F7FA 1K2HA 2MLEC 2G9BA 1BF5A 3SS4A 5HKWA 4PCWA 1RJVA 1MHOA 1NP8A 3D78A 3PALA 3NHIA 2MAZA 3O4YA 3OX6A 2AAOA 4C0JA 1SL7A 3FIAA 4OR9B 1G4YR 1ALWA 1AHRA 1ZUZA 4U8DA 2WCEA 4YGBB 1SCVA 1DGVA 1NSHA 3JVTC 3SG4A 2E30A 5AFPA 1PRWA 2V53A 1LINA 1OOGA 2FCEA 3LLEA 1QLKA 2QACA 1S36A 3SJSA 3EG5B 4NDBA 2LVJA 1KK7Z 1DEKA 5D7FA 4WQ2A 2Y1MA 1B47A 4I5KA 2KYFA 4P2YB 2K7CA 2ZN8A 2PRUA 3B7AA 3O6BA 1QWVA 2Y1NA 2WCMA 1TTXA 1QX2A 2AUCA 2SASA 3NGVA 5HL1A 1K93D 4GPLB 1KQMC 2G2BA 1X02A 3SIBA 1TNWA 3GK2A 2PSRA 1CNPA 2PMYA 4JWQA 2LAPA 1UHIA 2QDIA 3D75A 2F3ZA 3CR4X 1OOJA 2WCKA 1B4CA 1FF1A 1BR4B 3L47A 1RECA 5FI6A 2LHIA 3EVUA 2LMUA 1QX7A 5CSIA 4M2QA 1DT7B 3F45A 1BODA 1KSOA 2F8PA 5ER4X 1KFXL 2AMIA 4NDCA 3CZ0A 1B8LA 1NCYA 1UHKA 3QRXA 4BY5A 2MBXA 1NX1A 2LLUA 4XYNA 2EHBA 2DOQA 3BFHA 3BXKA 2MRDA 3EKHA 2OTGC 3EVVA 2WCLA 3VRQA 2JU0A 4WRIA 4PHMA 2QEHA 2WC8A 3SG5A 3CS1A 1DJIA 1DQEA 4MZLA 3RZSA 1J7QA 1F71A 1ZMZA 1XA5A 2PQLA 3PM8A 1QX5B 2L51A 4P5OE 1Q80A 1KFUL 3DF0B 5J3XA 2M7LA 3AAKA 1DJHA 3O78A 2LP3A 2FJYA 1F4QA 2JT8A 5CPVA 3OGNA 5FI7A 1OOIX 1W7IB 3PN7B 4HRHA 1QASA 1G33A 3BUMB 2H8VA 3MSEB 3BJHA 2R2IA 1IG5A 1ZOTB 2MJWB 1Y1UA 4OKHA 1Z2CB 3I5IB 3PM2A 1CFDA 2JT0A 1FBVA 4YI8A 3UNWA 3S0FA 2NXQA 2JTTA 2F33A 2KSPA 2GV5A 3BOWB 5HKZA 1PSBA 3B87A 1D1OA 1DMOA 1SBJA 3I5GB 5KU1A 4UPGA 2F2PA 3DVKA 4PE1A 3HX4A 3HCMA 2ZKMX 2CBLA 2KDHA 3DF0A 3DVMA 2WCJA 4ZCVA 4YRUA 3I5HB 2JPTA 1YUUA 4D1EA 1FI5A 1QVIY 4I5NB 2K7OA 1CFPA 4GUKA 1U5IB 3OB1B 3VROA 3CDNA 4MVFA 3ZWHA 3LCPC 1PVBA 1JUOA 1BR1B 1EJ3A 1OSAA 1W9ZA 1A4PA 1L2OC 3PJIA 5I2LA 2L4HA 2FCDA 1XFZO 1MXLC 3DD4A 4OZDA 1KK8C 2KAXA 1UHNA 3BOWA 3EK4A 2KFHA 1OQPA 2O5GA 2KQYA 4C0LA 1DJGA 1Y6WA 1S26D 2L98A 1EG4A 1EXRA 4Q04A 4DIRA 1JWDA 4MZKA 1AP4A 4DCKA 1SY9A 2BCXA 4WQ3A 3TDZA 4A4BA 5CSNA 2MA2A 3VRNA 1SL8A 3R72A 4XJKB 4N5XA 3FE9A 1F4OA 1E8AA 1NUBA 3WXAA 3TUYC 4PHKA 1ODBA 1LVCD 1M63B 3VGOA 1HT9A 3PLFB 1IWQA 1N0YA 3LK1A 3IF7A 3EKJA 1OMDA 4DUQA 1TUZA 1YVHA 5CSFA 1C7VA 2CCMA 2LP2A 3JTDC 3CWGA 4AQJA 4YGCB 1JF0A 3BFAA 3EK8A 1OOFA 2EC6C 2WCHA 3SG6A 1SR6C 1BLQA 1J1DA 2NZ0A 1IJ6A 3M0WA 1YX7A 3CZTX 2ZNEA 3JVTB 3PSRA 4XJKA 2P71A 2LVVA 3DXLA 3DY9A 3PFVA 4GGFC 1AK8A 2GGZA 2PYQA 1KWOC 4ORAB 3L4AA 1SYMA 1XFUO 2H61A 1QS7A 1TIZA 2BBNA 2KBMA 1OE9B 1QV1A 1QVIZ 1SCMC 1MQ1A 4OCIA 2QEVA 3NSKA 4MSPA 4NQGA 2K7DA 5I2OA 3DVEA 1DVIA 2JOJA 1S5GY 5FI2A 4OVNF 4AOMA 3CYZA 3TDIA 2OS8C 3ZNIA 1IH0A 1QTXA 2M1UA 3SS3A 2COLB 1KQMB 1QIVA 3R1PA 1SW8A 3AKBA 5JOLA 4ICBA 1R6PA 1WDCB 2BL0C 1MR8A 1FI6A 1DF0A 3S0BA 2M9GA 1KFXS 1LXFC 2CTNA 1TWOA 2PALA 1A03A 4INXA 1XYDA 3R1VA 4A4CA 1IGVA 2B1UA 4R1EA 1Z4HA 2SCPA 1CDNA 4QJ5B 5GQQC 2M49B 1QV0A 5IBWA 2HQ8A 1QXPA 1YR5A 1F54A 3WHUB 1JBAA 3DYEA 1TNPA 2F2OA 2K2FA 1C3YA 2ZNDA 4JPZB 1FPWA 3DZTA 1KFUS 1AJ4A 2MLFC 4CFRA 2LC5A 1QATA 3BQ3A 1MF8B 2K2AA 2LHLA 1OMVA 1RFJA 2OTGB 3FE6A 3Q8IA 4PALA 2KPHA 2JPOA 4GGNA 3FWCA 5AANA 3LK0A 1XVJA 3O2PA 1OZOA 4ETOA 4MN0A 3LL8B 4MBEA 2BE4A 1SNLA 2I18A 2KI4B 1IQ3A 1CFFA 1S6CA 1G8IA 1VRKA 2JNXA 4NDDA 4QJ3B 1A29A 2WCBA 4QJ4B 2BE6A 2KLDA 2KFGA 2LM5A 3D0YB 4YI9A 3WNXB 1LA0A 1W7JB 1P28A 1BJFA 2ISDA 1TCFA 2LVKA 3C1VA 2NCOA 1YUTA 1B8RA 1TN4A 4I5JA 3B86A 3I5FC 1CLBA 4N1GA 3IQOA 1UHHA 2H2KA 5K89A 2KGRA 4GNKB 1RTP1 1S5GZ 1K9PA 1Y1AA 2BKIB 2LV7A 3EVRA 2M7NA 3GK4X 2KGBC 4USLA 1K94A 3V2LA 1CM4A 3BUNB 4M2OA 1V1GA 2JQ6A 1XK4C 4PE0A 1SPYA 3D0YA 2KAVA 3D10A 3K21A 2QEOA 4GFTA 4L9MA 3UO9A 1F55A 1CMGA 1NCZA 1DJZA 1NX0A 1L2OB 4MLWA 1GGZA 2KOTA 4ZCUA 3CABA 4HSZA 2JULA 1JF2A 1DTLA 3OX5A 1OOHA 3BUWB 4PE7A 2KBIA 2VRGA 2I7AA 1KK8B 1NX3A 3E3RA 3D74A 2WNDA 2HQWA 3TS5B 2TN4A 1SRAA 2BBMA 5DICA 3A8RA 1J1EA 2FOTA 2P6BB 2QEBA 2OPOA 1SMGA 3BUOB 1EL4A 1SSEB 1CFCA 1AJ5A 3WHTB 2LLTA 2JTZA 2L50A 2JC2A 1KSMA 1RK9A 2JWWA 3TUYB 1IKUA 2KHNA 3SG2A 4F0ZB 2FJUB 3BFBA 3TDUA 1AUIB 1CKKA 3S0GA 3NSOA 2GTEA 3PATA 1B8CA 3JTDB 5HYDA 2CXJA 4YGAA 2ZFDA 5I94A 1EG3A 1ZFSA 3L4LA 1MWNA 4C0KA 4KYNA 1CM1A 1SKTA 2EC6B 2L5YA 2LANA 1SR6B 2PASA 4JQ0D 1S3PA 5D3OA 1JFKA 1H8BA 1K90D 5G08A 1NIWA 3CGAA 4HRGA 4CFQA 2Y4QA 2KNEA 5D69A 1J7RA 4INWA 3RM1A 1KWOB 1OW4A 2L5XB 2KAYA 2LMVA 1DF0B 3D73A 1QJTA 5EL2A 1M31A 1J55A 3NSLA 2KQ6A 1IQ5A 1SCMB 2K0JA 5KTYA 1LKJA 2JXLA 1J7OA 2ERBA 1ORGA 1CLMA 2KLEA 1XFWO 2ZRTA 2BCAA 4JD9A 1OZSA 1UWOA 2Y5IA 2OS8B 4PT1A 2M29A 2WCFA 2JXCA 1F70A 4ORBB 5HKYA 3ICBA 1GM0A 1WRZA 1CLLA 2K60A 5AXIA 2O60A 2KFFA 5HLVA 1QLSA 2BL0B 1K95A 5I8NA 4GGFA 1QIWA 4CIDA 3IQQA 4BY4A 1ZACA 4OV2A 1A2XA 1B7TY 1RWYA 1TNXA 1PVAA 1C3ZA 2NLNA 1YX8A 1L7ZA 2LMTA 1FW4A 3R1OA 2LNKA 1NPQA 1XFXO 3B88A 1HQVA 2JZIA 3CTNA 3CZ2A 3GOFA 3GK1A 4IL1A 2I2RE 1F8HA 1A75B 1N2DA 1V1FA 3DVJA 1M39A 3OB2B 3OHMB 1JC2A 2BKHB 3D77A 1BG1A 2GGMA 2ZN9A 2I94A 4YBHB 1TNQA 3KO0A 2Q91A 5DKNA 1KQVA 4FQOA 3KF9A 2MHHA 1Y0VH 1WDCC 1K8UA 4IJ7A 4MZJA 1BU3A 4CLNA 2QPTA 1YURA 2D8NA 1R2UA 2LUXA 1DJWA 1M46A 5AEQA 4DRWA 2PVBA 1BT6A 1WY9A 3NSIA 2KI6D 2LUCA 3SS5A 2EGDA 1DELA 3KHEA 3KPXA 1AVSA 1A75A 4PHNA 3I5FB 3S0DA 5B8IB 2L2CA 1YVLA 4MEWA 1CB1A 3S0AA 5KSZA 1LA3A 4FTGA 2NCPA 3CZ1A 1UHJA 1SK6D 3N7HA 3BYAA 1GQMA 3SG7A 1DGUA 4PHJA 3CR2A 3SG3A 5TNCA 2Q4UA 3B6XA 1YUSA 4N1FA 1LS8A 1CTRA 1NYAA 3OBVA 2WORA
chains in the Genus database with same CATH topology
1DJXA 2BCBA 2KI6C 2M0RA 3EK7A 5JJGA 3OP0A 1YRUB 2KI4C 1WRLA 1B9AA 2HPSA 2WOSA 2M1KB 1ALVA 1B7TZ 4MRYA 1S1EA 1OMRA 2K61A 1PULA 2JT3A 2LLSA 1UURA 1SL9A 3AAJA 1BOCA 3PN7C 2K7BA 1K96A 2LVIA 4CPVA 4AQIA 1N65A 4YGEB 2K8MB 1CMFA 1XO5A 1XFVO 2LE9B 1M45A 2JNFA 3FS7A 3I5IC 1DJYA 3RLZA 1S6JA 1NWDA 3H4SE 1B1GA 1XK4A 5BPJA 1IRJA 1WRKA 2L4IA 5AERA 1CDLA 1TRFA 3BUXB 3I5GC 1EH2A 3CLNA 1S6IA 2L0PA 3AKAA 2L2EA 1XFYO 1JFJA 1C7WA 2A4JA 1MXEA 1NX2A 1WLMA 1H4BA 3A4UB 4YGDB 1CDPA 3I5HC 2F3YA 5PALA 1K9KA 1KK7Y 2LCPA 1K9UA 1PK0D 5DKQA 2HETA 2RGIA 3CR5X 4TNCA 3VRPA 4PDZA 1IJ5A 5F6TA 4GAOA 1BMOA 1YTZC 5I2QA 4M2PA 3TS5C 3NXAA 4MRXA 1JSAA 3FWBA 2HF5A 5HLOA 4ORCB 3KEVA 1TCOB 1PSRA 2ZRSA 4I5LB 1CDMA 1NCXA 2KYCA 1Y1XA 2BECA 1J7PA 5FYXA 1U5IA 2E6WA 4PE4A 2JRFA 1RROA 4E68A 1WLZA 1YRTB 1KCYA 1UUSA 4GBAA 1PALA 4DS7A 2M8UA 5CSJA 3TZ1A 1GJYA 1C07A 2CNPA 2H61C 2M3WA 3SIAA 1TOPA 1GGWA 3VRRA 2IS9A 2CT9A 2M97A 1MUXA 1UP5A 1K2HA 5ER5A 5DKRA 2MLEC 2G9BA 1BF5A 5HKWA 4PCWA 1RJVA 1MHOA 1NP8A 3PALA 2MAZA 3O4YA 3OX6A 2AAOA 4C0JA 1SL7A 3FIAA 4OR9B 1G4YR 1ALWA 1AHRA 1ZUZA 4U8DA 2WCEA 4YGBB 1SCVA 1DGVA 1NSHA 3JVTC 3SG4A 2E30A 5AFPA 1PRWA 2V53A 1LINA 2FCEA 3LLEA 1QLKA 2QACA 1S36A 3SJSA 4NDBA 2LVJA 1KK7Z 5D7FA 4WQ2A 2Y1MA 1B47A 4I5KA 2KYFA 4P2YB 2K7CA 2ZN8A 2PRUA 3O6BA 2Y1NA 1TTXA 1QX2A 2AUCA 2SASA 1K93D 4GPLB 1KQMC 2G2BA 1X02A 3SIBA 1TNWA 3GK2A 2PSRA 1CNPA 2PMYA 4JWQA 2LAPA 1UHIA 2F3ZA 3CR4X 1OOJA 1B4CA 1FF1A 1BR4B 1RECA 2LHIA 3EVUA 2LMUA 1QX7A 5CSIA 4M2QA 1DT7B 3F45A 1BODA 1KSOA 2F8PA 5ER4X 1KFXL 2AMIA 4NDCA 1B8LA 1NCYA 1UHKA 3QRXA 4BY5A 2MBXA 1NX1A 2LLUA 4XYNA 2EHBA 2DOQA 3BXKA 2MRDA 3EKHA 2OTGC 3EVVA 3VRQA 2JU0A 4WRIA 4PHMA 2WC8A 3SG5A 3CS1A 1DJIA 1J7QA 4MZLA 1F71A 1ZMZA 1XA5A 3PM8A 1QX5B 2L51A 4P5OE 1Q80A 1KFUL 3DF0B 5J3XA 2M7LA 3AAKA 1DJHA 3O78A 2LP3A 1F4QA 2JT8A 5CPVA 3PN7B 1W7IB 4HRHA 1QASA 1G33A 3BUMB 3MSEB 2R2IA 1IG5A 1ZOTB 2MJWB 1Y1UA 4OKHA 3I5IB 1CFDA 2JT0A 1FBVA 4YI8A 2NXQA 2JTTA 2F33A 2KSPA 2GV5A 3BOWB 5HKZA 1PSBA 1D1OA 1DMOA 1SBJA 3I5GB 5KU1A 4UPGA 2F2PA 3DVKA 4PE1A 3HX4A 3HCMA 2ZKMX 2CBLA 2KDHA 3DF0A 3DVMA 4ZCVA 4YRUA 3I5HB 2JPTA 1YUUA 4D1EA 1FI5A 1QVIY 4I5NB 2K7OA 1CFPA 4GUKA 1U5IB 3OB1B 3VROA 4MVFA 3ZWHA 3LCPC 1PVBA 1JUOA 1BR1B 1EJ3A 1OSAA 1A4PA 1L2OC 5I2LA 2L4HA 2FCDA 1XFZO 1MXLC 3DD4A 1KK8C 2KAXA 1UHNA 3BOWA 3EK4A 2KFHA 1OQPA 2O5GA 2KQYA 4C0LA 1DJGA 1Y6WA 1S26D 2L98A 1EG4A 1EXRA 4Q04A 4DIRA 1JWDA 4MZKA 1AP4A 4DCKA 1SY9A 2BCXA 4WQ3A 3TDZA 4A4BA 5CSNA 2MA2A 3VRNA 1SL8A 4XJKB 4N5XA 1F4OA 1E8AA 1NUBA 3WXAA 3TUYC 4PHKA 1ODBA 1LVCD 1M63B 3VGOA 1HT9A 3PLFB 1IWQA 1N0YA 3LK1A 3IF7A 3EKJA 1OMDA 4DUQA 1YVHA 5CSFA 1C7VA 2CCMA 2LP2A 3JTDC 3CWGA 4AQJA 4YGCB 1JF0A 3EK8A 2EC6C 3SG6A 1SR6C 1BLQA 1J1DA 2NZ0A 1IJ6A 3M0WA 1YX7A 3CZTX 2ZNEA 3JVTB 3PSRA 4XJKA 2LVVA 3PFVA 4GGFC 1AK8A 2GGZA 1KWOC 4ORAB 1SYMA 1XFUO 2H61A 1QS7A 1TIZA 2BBNA 2KBMA 1OE9B 1QV1A 1QVIZ 1SCMC 1MQ1A 4OCIA 3NSKA 4MSPA 4NQGA 2K7DA 5I2OA 3DVEA 1DVIA 2JOJA 1S5GY 4AOMA 4OVNF 3TDIA 2OS8C 3ZNIA 1IH0A 1QTXA 2M1UA 2COLB 1KQMB 1QIVA 1SW8A 3AKBA 5JOLA 4ICBA 1R6PA 1WDCB 2BL0C 1MR8A 1FI6A 1DF0A 2M9GA 1KFXS 1LXFC 2CTNA 1A03A 2PALA 1XYDA 4A4CA 2B1UA 1IGVA 4R1EA 2SCPA 1CDNA 4QJ5B 5GQQC 2M49B 1QV0A 5IBWA 2HQ8A 1QXPA 1YR5A 1F54A 3WHUB 1JBAA 1TNPA 2F2OA 2K2FA 2ZNDA 4JPZB 1FPWA 1KFUS 1AJ4A 2MLFC 4CFRA 2LC5A 1QATA 3BQ3A 1MF8B 2K2AA 2LHLA 1OMVA 1RFJA 2OTGB 4HREE 4PALA 4GGNA 3FWCA 5AANA 3LK0A 1XVJA 3O2PA 1OZOA 4ETOA 4MN0A 3LL8B 4MBEA 2BE4A 1SNLA 2I18A 2KI4B 1IQ3A 1CFFA 1S6CA 1G8IA 1VRKA 2JNXA 4NDDA 4QJ3B 1A29A 2WCBA 4QJ4B 2BE6A 2LM5A 2KFGA 3D0YB 4YI9A 3WNXB 1LA0A 1W7JB 1BJFA 2ISDA 1TCFA 2LVKA 3C1VA 2NCOA 1YUTA 1B8RA 1TN4A 4I5JA 3I5FC 1CLBA 4N1GA 3IQOA 1UHHA 2H2KA 5K89A 2KGRA 4GNKB 1RTP1 1S5GZ 1K9PA 1Y1AA 2BKIB 2LV7A 3EVRA 2M7NA 3GK4X 2KGBC 4USLA 1K94A 1CM4A 3BUNB 4M2OA 1V1GA 2JQ6A 1XK4C 4PE0A 1SPYA 3D0YA 2KAVA 3D10A 3K21A 4GFTA 4L9MA 1F55A 1CMGA 1NCZA 1DJZA 1NX0A 1L2OB 4MLWA 1GGZA 2KOTA 4ZCUA 4HSZA 2JULA 1JF2A 1DTLA 3OX5A 3BUWB 4PE7A 2KBIA 2VRGA 2I7AA 1KK8B 1NX3A 3E3RA 2WNDA 2HQWA 3TS5B 2TN4A 1SRAA 2BBMA 3A8RA 1J1EA 2FOTA 2P6BB 2OPOA 1SMGA 3BUOB 1EL4A 1CFCA 1AJ5A 3WHTB 2LLTA 2JTZA 2L50A 2JC2A 1KSMA 1RK9A 2JWWA 3TUYB 1IKUA 2KHNA 3SG2A 4F0ZB 2FJUB 3TDUA 1AUIB 1CKKA 3NSOA 3PATA 1B8CA 3JTDB 5HYDA 2CXJA 4YGAA 2ZFDA 1EG3A 1ZFSA 1MWNA 4C0KA 1CM1A 1SKTA 2EC6B 2LANA 4JQ0D 1SR6B 2PASA 1S3PA 1JFKA 1H8BA 1K90D 5G08A 1NIWA 3CGAA 4HRGA 4CFQA 2Y4QA 2KNEA 5D69A 1J7RA 3RM1A 1KWOB 2L5XB 2KAYA 2LMVA 1DF0B 1QJTA 1M31A 1J55A 3NSLA 2KQ6A 1IQ5A 1SCMB 2K0JA 5KTYA 1LKJA 2JXLA 1J7OA 2ZRTA 1CLMA 1XFWO 2BCAA 1OZSA 1UWOA 2Y5IA 2OS8B 2M29A 2WCFA 2JXCA 1F70A 4ORBB 5HKYA 3ICBA 1WRZA 1CLLA 5AXIA 2O60A 2KFFA 5HLVA 1QLSA 2BL0B 1K95A 5I8NA 4GGFA 1QIWA 4CIDA 3IQQA 4BY4A 1ZACA 4OV2A 1A2XA 1B7TY 1RWYA 1TNXA 1PVAA 2NLNA 1YX8A 1L7ZA 2LMTA 1FW4A 2LNKA 1NPQA 1XFXO 3CTNA 1HQVA 2JZIA 3GOFA 3GK1A 4IL1A 2I2RE 1F8HA 1A75B 1N2DA 1V1FA 3DVJA 1M39A 3OB2B 3OHMB 1JC2A 2BKHB 1BG1A 2GGMA 2ZN9A 2I94A 4YBHB 1TNQA 3KO0A 2Q91A 5DKNA 1KQVA 4FQOA 3KF9A 2MHHA 1Y0VH 1WDCC 1K8UA 4MZJA 1BU3A 4CLNA 2QPTA 1YURA 2D8NA 1R2UA 2LUXA 1DJWA 1M46A 5AEQA 4DRWA 2PVBA 1BT6A 1WY9A 3NSIA 2KI6D 2LUCA 2EGDA 3KHEA 3KPXA 1AVSA 1A75A 4PHNA 3I5FB 5B8IB 1YVLA 4MEWA 1CB1A 5KSZA 1LA3A 4FTGA 2NCPA 1UHJA 1SK6D 3BYAA 1GQMA 3SG7A 1DGUA 4PHJA 3CR2A 3SG3A 5TNCA 2Q4UA 1YUSA 4N1FA 1CTRA 1NYAA 2WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJX A;  2BCB A;  2KI6 C;  2M0R A;  3EK7 A;  5JJG A;  3OP0 A;  1YRU B;  2KI4 C;  1WRL A;  1B9A A;  2HPS A;  2WOS A;  2M1K B;  1ALV A;  1B7T Z;  4MRY A;  1S1E A;  1OMR A;  2K61 A;  1PUL A;  2JT3 A;  2LLS A;  1UUR A;  1SL9 A;  3AAJ A;  1BOC A;  3PN7 C;  2K7B A;  1K96 A;  2LVI A;  4CPV A;  4AQI A;  1N65 A;  4YGE B;  2K8M B;  1CMF A;  1XO5 A;  1XFV O;  2LE9 B;  1M45 A;  2JNF A;  3FS7 A;  3I5I C;  1DJY A;  3RLZ A;  1S6J A;  1NWD A;  3H4S E;  1B1G A;  1XK4 A;  5BPJ A;  1IRJ A;  1WRK A;  2L4I A;  5AER A;  1CDL A;  1TRF A;  3BUX B;  3I5G C;  1EH2 A;  3CLN A;  1S6I A;  2L0P A;  3AKA A;  2L2E A;  1XFY O;  1JFJ A;  1C7W A;  2A4J A;  1MXE A;  1NX2 A;  1WLM A;  1H4B A;  3A4U B;  4YGD B;  1CDP A;  3I5H C;  2F3Y A;  5PAL A;  1K9K A;  1KK7 Y;  2LCP A;  1K9U A;  1PK0 D;  5DKQ A;  2HET A;  2RGI A;  3CR5 X;  4TNC A;  3VRP A;  4PDZ A;  1IJ5 A;  5F6T A;  4GAO A;  1BMO A;  1YTZ C;  5I2Q A;  4M2P A;  3TS5 C;  3NXA A;  4MRX A;  1JSA A;  3FWB A;  2HF5 A;  5HLO A;  4ORC B;  3KEV A;  1TCO B;  1PSR A;  2ZRS A;  4I5L B;  1CDM A;  1NCX A;  2KYC A;  1Y1X A;  2BEC A;  1J7P A;  5FYX A;  1U5I A;  2E6W A;  4PE4 A;  2JRF A;  1RRO A;  4E68 A;  1WLZ A;  1YRT B;  1KCY A;  1UUS A;  4GBA A;  1PAL A;  4DS7 A;  2M8U A;  5CSJ A;  3TZ1 A;  1GJY A;  1C07 A;  2CNP A;  2H61 C;  2M3W A;  3SIA A;  1TOP A;  1GGW A;  3VRR A;  2IS9 A;  2CT9 A;  2M97 A;  1MUX A;  1UP5 A;  1K2H A;  5ER5 A;  5DKR A;  2MLE C;  2G9B A;  1BF5 A;  5HKW A;  4PCW A;  1RJV A;  1MHO A;  1NP8 A;  3PAL A;  2MAZ A;  3O4Y A;  3OX6 A;  2AAO A;  4C0J A;  1SL7 A;  3FIA A;  4OR9 B;  1G4Y R;  1ALW A;  1AHR A;  1ZUZ A;  4U8D A;  2WCE A;  4YGB B;  1SCV A;  1DGV A;  1NSH A;  3JVT C;  3SG4 A;  2E30 A;  5AFP A;  1PRW A;  2V53 A;  1LIN A;  2FCE A;  3LLE A;  1QLK A;  2QAC A;  1S36 A;  3SJS A;  4NDB A;  2LVJ A;  1KK7 Z;  5D7F A;  4WQ2 A;  2Y1M A;  1B47 A;  4I5K A;  2KYF A;  4P2Y B;  2K7C A;  2ZN8 A;  2PRU A;  3O6B A;  2Y1N A;  1TTX A;  1QX2 A;  2AUC A;  2SAS A;  1K93 D;  4GPL B;  1KQM C;  2G2B A;  1X02 A;  3SIB A;  1TNW A;  3GK2 A;  2PSR A;  1CNP A;  2PMY A;  4JWQ A;  2LAP A;  1UHI A;  2F3Z A;  3CR4 X;  1OOJ A;  1B4C A;  1FF1 A;  1BR4 B;  1REC A;  2LHI A;  3EVU A;  2LMU A;  1QX7 A;  5CSI A;  4M2Q A;  1DT7 B;  3F45 A;  1BOD A;  1KSO A;  2F8P A;  5ER4 X;  1KFX L;  2AMI A;  4NDC A;  1B8L A;  1NCY A;  1UHK A;  3QRX A;  4BY5 A;  2MBX A;  1NX1 A;  2LLU A;  4XYN A;  2EHB A;  2DOQ A;  3BXK A;  2MRD A;  3EKH A;  2OTG C;  3EVV A;  3VRQ A;  2JU0 A;  4WRI A;  4PHM A;  2WC8 A;  3SG5 A;  3CS1 A;  1DJI A;  1J7Q A;  4MZL A;  1F71 A;  1ZMZ A;  1XA5 A;  3PM8 A;  1QX5 B;  2L51 A;  4P5O E;  1Q80 A;  1KFU L;  3DF0 B;  5J3X A;  2M7L A;  3AAK A;  1DJH A;  3O78 A;  2LP3 A;  1F4Q A;  2JT8 A;  5CPV A;  3PN7 B;  1W7I B;  4HRH A;  1QAS A;  1G33 A;  3BUM B;  3MSE B;  2R2I A;  1IG5 A;  1ZOT B;  2MJW B;  1Y1U A;  4OKH A;  3I5I B;  1CFD A;  2JT0 A;  1FBV A;  4YI8 A;  2NXQ A;  2JTT A;  2F33 A;  2KSP A;  2GV5 A;  3BOW B;  5HKZ A;  1PSB A;  1D1O A;  1DMO A;  1SBJ A;  3I5G B;  5KU1 A;  4UPG A;  2F2P A;  3DVK A;  4PE1 A;  3HX4 A;  3HCM A;  2ZKM X;  2CBL A;  2KDH A;  3DF0 A;  3DVM A;  4ZCV A;  4YRU A;  3I5H B;  2JPT A;  1YUU A;  4D1E A;  1FI5 A;  1QVI Y;  4I5N B;  2K7O A;  1CFP A;  4GUK A;  1U5I B;  3OB1 B;  3VRO A;  4MVF A;  3ZWH A;  3LCP C;  1PVB A;  1JUO A;  1BR1 B;  1EJ3 A;  1OSA A;  1A4P A;  1L2O C;  5I2L A;  2L4H A;  2FCD A;  1XFZ O;  1MXL C;  3DD4 A;  1KK8 C;  2KAX A;  1UHN A;  3BOW A;  3EK4 A;  2KFH A;  1OQP A;  2O5G A;  2KQY A;  4C0L A;  1DJG A;  1Y6W A;  1S26 D;  2L98 A;  1EG4 A;  1EXR A;  4Q04 A;  4DIR A;  1JWD A;  4MZK A;  1AP4 A;  4DCK A;  1SY9 A;  2BCX A;  4WQ3 A;  3TDZ A;  4A4B A;  5CSN A;  2MA2 A;  3VRN A;  1SL8 A;  4XJK B;  4N5X A;  1F4O A;  1E8A A;  1NUB A;  3WXA A;  3TUY C;  4PHK A;  1ODB A;  1LVC D;  1M63 B;  3VGO A;  1HT9 A;  3PLF B;  1IWQ A;  1N0Y A;  3LK1 A;  3IF7 A;  3EKJ A;  1OMD A;  4DUQ A;  1YVH A;  5CSF A;  1C7V A;  2CCM A;  2LP2 A;  3JTD C;  3CWG A;  4AQJ A;  4YGC B;  1JF0 A;  3EK8 A;  2EC6 C;  3SG6 A;  1SR6 C;  1BLQ A;  1J1D A;  2NZ0 A;  1IJ6 A;  3M0W A;  1YX7 A;  3CZT X;  2ZNE A;  3JVT B;  3PSR A;  4XJK A;  2LVV A;  3PFV A;  4GGF C;  1AK8 A;  2GGZ A;  1KWO C;  4ORA B;  1SYM A;  1XFU O;  2H61 A;  1QS7 A;  1TIZ A;  2BBN A;  2KBM A;  1OE9 B;  1QV1 A;  1QVI Z;  1SCM C;  1MQ1 A;  4OCI A;  3NSK A;  4MSP A;  4NQG A;  2K7D A;  5I2O A;  3DVE A;  1DVI A;  2JOJ A;  1S5G Y;  4AOM A;  4OVN F;  3TDI A;  2OS8 C;  3ZNI A;  1IH0 A;  1QTX A;  2M1U A;  2COL B;  1KQM B;  1QIV A;  1SW8 A;  3AKB A;  5JOL A;  4ICB A;  1R6P A;  1WDC B;  2BL0 C;  1MR8 A;  1FI6 A;  1DF0 A;  2M9G A;  1KFX S;  1LXF C;  2CTN A;  1A03 A;  2PAL A;  1XYD A;  4A4C A;  2B1U A;  1IGV A;  4R1E A;  2SCP A;  1CDN A;  4QJ5 B;  5GQQ C;  2M49 B;  1QV0 A;  5IBW A;  2HQ8 A;  1QXP A;  1YR5 A;  1F54 A;  3WHU B;  1JBA A;  1TNP A;  2F2O A;  2K2F A;  2ZND A;  4JPZ B;  1FPW A;  1KFU S;  1AJ4 A;  2MLF C;  4CFR A;  2LC5 A;  1QAT A;  3BQ3 A;  1MF8 B;  2K2A A;  2LHL A;  1OMV A;  1RFJ A;  2OTG B;  4HRE E;  4PAL A;  4GGN A;  3FWC A;  5AAN A;  3LK0 A;  1XVJ A;  3O2P A;  1OZO A;  4ETO A;  4MN0 A;  3LL8 B;  4MBE A;  2BE4 A;  1SNL A;  2I18 A;  2KI4 B;  1IQ3 A;  1CFF A;  1S6C A;  1G8I A;  1VRK A;  2JNX A;  4NDD A;  4QJ3 B;  1A29 A;  2WCB A;  4QJ4 B;  2BE6 A;  2LM5 A;  2KFG A;  3D0Y B;  4YI9 A;  3WNX B;  1LA0 A;  1W7J B;  1BJF A;  2ISD A;  1TCF A;  2LVK A;  3C1V A;  2NCO A;  1YUT A;  1B8R A;  1TN4 A;  4I5J A;  3I5F C;  1CLB A;  4N1G A;  3IQO A;  1UHH A;  2H2K A;  5K89 A;  2KGR A;  4GNK B;  1RTP 1;  1S5G Z;  1K9P A;  1Y1A A;  2BKI B;  2LV7 A;  3EVR A;  2M7N A;  3GK4 X;  2KGB C;  4USL A;  1K94 A;  1CM4 A;  3BUN B;  4M2O A;  1V1G A;  2JQ6 A;  1XK4 C;  4PE0 A;  1SPY A;  3D0Y A;  2KAV A;  3D10 A;  3K21 A;  4GFT A;  4L9M A;  1F55 A;  1CMG A;  1NCZ A;  1DJZ A;  1NX0 A;  1L2O B;  4MLW A;  1GGZ A;  2KOT A;  4ZCU A;  4HSZ A;  2JUL A;  1JF2 A;  1DTL A;  3OX5 A;  3BUW B;  4PE7 A;  2KBI A;  2VRG A;  2I7A A;  1KK8 B;  1NX3 A;  3E3R A;  2WND A;  2HQW A;  3TS5 B;  2TN4 A;  1SRA A;  2BBM A;  3A8R A;  1J1E A;  2FOT A;  2P6B B;  2OPO A;  1SMG A;  3BUO B;  1EL4 A;  1CFC A;  1AJ5 A;  3WHT B;  2LLT A;  2JTZ A;  2L50 A;  2JC2 A;  1KSM A;  1RK9 A;  2JWW A;  3TUY B;  1IKU A;  2KHN A;  3SG2 A;  4F0Z B;  2FJU B;  3TDU A;  1AUI B;  1CKK A;  3NSO A;  3PAT A;  1B8C A;  3JTD B;  5HYD A;  2CXJ A;  4YGA A;  2ZFD A;  1EG3 A;  1ZFS A;  1MWN A;  4C0K A;  1CM1 A;  1SKT A;  2EC6 B;  2LAN A;  4JQ0 D;  1SR6 B;  2PAS A;  1S3P A;  1JFK A;  1H8B A;  1K90 D;  5G08 A;  1NIW A;  3CGA A;  4HRG A;  4CFQ A;  2Y4Q A;  2KNE A;  5D69 A;  1J7R A;  3RM1 A;  1KWO B;  2L5X B;  2KAY A;  2LMV A;  1DF0 B;  1QJT A;  1M31 A;  1J55 A;  3NSL A;  2KQ6 A;  1IQ5 A;  1SCM B;  2K0J A;  5KTY A;  1LKJ A;  2JXL A;  1J7O A;  2ZRT A;  1CLM A;  1XFW O;  2BCA A;  1OZS A;  1UWO A;  2Y5I A;  2OS8 B;  2M29 A;  2WCF A;  2JXC A;  1F70 A;  4ORB B;  5HKY A;  3ICB A;  1WRZ A;  1CLL A;  5AXI A;  2O60 A;  2KFF A;  5HLV A;  1QLS A;  2BL0 B;  1K95 A;  5I8N A;  4GGF A;  1QIW A;  4CID A;  3IQQ A;  4BY4 A;  1ZAC A;  4OV2 A;  1A2X A;  1B7T Y;  1RWY A;  1TNX A;  1PVA A;  2NLN A;  1YX8 A;  1L7Z A;  2LMT A;  1FW4 A;  2LNK A;  1NPQ A;  1XFX O;  3CTN A;  1HQV A;  2JZI A;  3GOF A;  3GK1 A;  4IL1 A;  2I2R E;  1F8H A;  1A75 B;  1N2D A;  1V1F A;  3DVJ A;  1M39 A;  3OB2 B;  3OHM B;  1JC2 A;  2BKH B;  1BG1 A;  2GGM A;  2ZN9 A;  2I94 A;  4YBH B;  1TNQ A;  3KO0 A;  2Q91 A;  5DKN A;  1KQV A;  4FQO A;  3KF9 A;  2MHH A;  1Y0V H;  1WDC C;  1K8U A;  4MZJ A;  1BU3 A;  4CLN A;  2QPT A;  1YUR A;  2D8N A;  1R2U A;  2LUX A;  1DJW A;  1M46 A;  5AEQ A;  4DRW A;  2PVB A;  1BT6 A;  1WY9 A;  3NSI A;  2KI6 D;  2LUC A;  2EGD A;  3KHE A;  3KPX A;  1AVS A;  1A75 A;  4PHN A;  3I5F B;  5B8I B;  1YVL A;  4MEW A;  1CB1 A;  5KSZ A;  1LA3 A;  4FTG A;  2NCP A;  1UHJ A;  1SK6 D;  3BYA A;  1GQM A;  3SG7 A;  1DGU A;  4PHJ A;  3CR2 A;  3SG3 A;  5TNC A;  2Q4U A;  1YUS A;  4N1F A;  1CTR A;  1NYA A;  2WOR A; 
#chains in the Genus database with same CATH topology
 1DJX A;  2BCB A;  2KI6 C;  2M0R A;  3EK7 A;  5JJG A;  3OP0 A;  1YRU B;  2KI4 C;  1WRL A;  1B9A A;  2HPS A;  2WOS A;  2M1K B;  1ALV A;  1B7T Z;  4MRY A;  3FE8 A;  1S1E A;  1OMR A;  2K61 A;  1PUL A;  2JT3 A;  2LLS A;  1UUR A;  1SL9 A;  2YGU A;  3AAJ A;  4FQT A;  4HRE E;  1BOC A;  3PN7 C;  2K7B A;  1K96 A;  2LVI A;  3IVT A;  4CPV A;  1TUJ A;  1XFR A;  1IIO A;  4AQI A;  1N65 A;  4YGE B;  2K8M B;  1CMF A;  1XO5 A;  1XFV O;  2LE9 B;  1M45 A;  2JNF A;  3FS7 A;  2BAP A;  1DJY A;  3I5I C;  3RLZ A;  1S6J A;  1NWD A;  3H4S E;  1B1G A;  1XK4 A;  5BPJ A;  1IRJ A;  1WRK A;  2L4I A;  5AER A;  1CDL A;  1TRF A;  3BUX B;  3I5G C;  1EH2 A;  3CLN A;  1S6I A;  2L0P A;  3AKA A;  1DC1 A;  2L2E A;  1XFY O;  1JFJ A;  1C7W A;  2A4J A;  1MXE A;  1NX2 A;  1WLM A;  1H4B A;  3A4U B;  4YGD B;  1CDP A;  3I5H C;  2F3Y A;  5PAL A;  1K9K A;  1KK7 Y;  3NHT A;  2LCP A;  1K9U A;  1PK0 D;  5DKQ A;  2HET A;  2RGI A;  3CR5 X;  4TNC A;  3VRP A;  4PDZ A;  1IJ5 A;  5F6T A;  2WC5 A;  4GAO A;  1BMO A;  1YTZ C;  5I2Q A;  4M2P A;  3TS5 C;  3NXA A;  2P70 A;  4MRX A;  3D76 A;  1JSA A;  3FWB A;  2HF5 A;  5HLO A;  1T14 A;  2BNX A;  4ORC B;  3KEV A;  1TCO B;  1PSR A;  2ZRS A;  4I5L B;  1CDM A;  1NCX A;  2KYC A;  1Y1X A;  2BEC A;  1J7P A;  5FYX A;  1U5I A;  2E6W A;  3K1E A;  4PE4 A;  4JKT A;  2JRF A;  1RRO A;  4E68 A;  1WLZ A;  1YRT B;  1KCY A;  1UUS A;  4GBA A;  1PAL A;  2WC6 A;  4DS7 A;  2M8U A;  5CSJ A;  3TZ1 A;  1GJY A;  1C07 A;  2CNP A;  2H61 C;  2M3W A;  3SIA A;  1TOP A;  1GGW A;  3QME A;  3VRR A;  2IS9 A;  3O4X A;  3VB1 A;  2CT9 A;  2M97 A;  1MUX A;  1UP5 A;  3S0E A;  5ER5 A;  5DKR A;  4F7F A;  1K2H A;  2MLE C;  2G9B A;  1BF5 A;  3SS4 A;  5HKW A;  4PCW A;  1RJV A;  1MHO A;  1NP8 A;  3D78 A;  3PAL A;  3NHI A;  2MAZ A;  3O4Y A;  3OX6 A;  2AAO A;  4C0J A;  1SL7 A;  3FIA A;  4OR9 B;  1G4Y R;  1ALW A;  1AHR A;  1ZUZ A;  4U8D A;  2WCE A;  4YGB B;  1SCV A;  1DGV A;  1NSH A;  3JVT C;  3SG4 A;  2E30 A;  5AFP A;  1PRW A;  2V53 A;  1LIN A;  1OOG A;  2FCE A;  3LLE A;  1QLK A;  2QAC A;  1S36 A;  3SJS A;  3EG5 B;  4NDB A;  2LVJ A;  1KK7 Z;  1DEK A;  5D7F A;  4WQ2 A;  2Y1M A;  1B47 A;  4I5K A;  2KYF A;  4P2Y B;  2K7C A;  2ZN8 A;  2PRU A;  3B7A A;  3O6B A;  1QWV A;  2Y1N A;  2WCM A;  1TTX A;  1QX2 A;  2AUC A;  2SAS A;  3NGV A;  5HL1 A;  1K93 D;  4GPL B;  1KQM C;  2G2B A;  1X02 A;  3SIB A;  1TNW A;  3GK2 A;  2PSR A;  1CNP A;  2PMY A;  4JWQ A;  2LAP A;  1UHI A;  2QDI A;  3D75 A;  2F3Z A;  3CR4 X;  1OOJ A;  2WCK A;  1B4C A;  1FF1 A;  1BR4 B;  3L47 A;  1REC A;  5FI6 A;  2LHI A;  3EVU A;  2LMU A;  1QX7 A;  5CSI A;  4M2Q A;  1DT7 B;  3F45 A;  1BOD A;  1KSO A;  2F8P A;  5ER4 X;  1KFX L;  2AMI A;  4NDC A;  3CZ0 A;  1B8L A;  1NCY A;  1UHK A;  3QRX A;  4BY5 A;  2MBX A;  1NX1 A;  2LLU A;  4XYN A;  2EHB A;  2DOQ A;  3BFH A;  3BXK A;  2MRD A;  3EKH A;  2OTG C;  3EVV A;  2WCL A;  3VRQ A;  2JU0 A;  4WRI A;  4PHM A;  2QEH A;  2WC8 A;  3SG5 A;  3CS1 A;  1DJI A;  1DQE A;  4MZL A;  3RZS A;  1J7Q A;  1F71 A;  1ZMZ A;  1XA5 A;  2PQL A;  3PM8 A;  1QX5 B;  2L51 A;  4P5O E;  1Q80 A;  1KFU L;  3DF0 B;  5J3X A;  2M7L A;  3AAK A;  1DJH A;  3O78 A;  2LP3 A;  2FJY A;  1F4Q A;  2JT8 A;  5CPV A;  3OGN A;  5FI7 A;  1OOI X;  1W7I B;  3PN7 B;  4HRH A;  1QAS A;  1G33 A;  3BUM B;  2H8V A;  3MSE B;  3BJH A;  2R2I A;  1IG5 A;  1ZOT B;  2MJW B;  1Y1U A;  4OKH A;  1Z2C B;  3I5I B;  3PM2 A;  1CFD A;  2JT0 A;  1FBV A;  4YI8 A;  3UNW A;  3S0F A;  2NXQ A;  2JTT A;  2F33 A;  2KSP A;  2GV5 A;  3BOW B;  5HKZ A;  1PSB A;  3B87 A;  1D1O A;  1DMO A;  1SBJ A;  3I5G B;  5KU1 A;  4UPG A;  2F2P A;  3DVK A;  4PE1 A;  3HX4 A;  3HCM A;  2ZKM X;  2CBL A;  2KDH A;  3DF0 A;  3DVM A;  2WCJ A;  4ZCV A;  4YRU A;  3I5H B;  2JPT A;  1YUU A;  4D1E A;  1FI5 A;  1QVI Y;  4I5N B;  2K7O A;  1CFP A;  4GUK A;  1U5I B;  3OB1 B;  3VRO A;  3CDN A;  4MVF A;  3ZWH A;  3LCP C;  1PVB A;  1JUO A;  1BR1 B;  1EJ3 A;  1OSA A;  1W9Z A;  1A4P A;  1L2O C;  3PJI A;  5I2L A;  2L4H A;  2FCD A;  1XFZ O;  1MXL C;  3DD4 A;  4OZD A;  1KK8 C;  2KAX A;  1UHN A;  3BOW A;  3EK4 A;  2KFH A;  1OQP A;  2O5G A;  2KQY A;  4C0L A;  1DJG A;  1Y6W A;  1S26 D;  2L98 A;  1EG4 A;  1EXR A;  4Q04 A;  4DIR A;  1JWD A;  4MZK A;  1AP4 A;  4DCK A;  1SY9 A;  2BCX A;  4WQ3 A;  3TDZ A;  4A4B A;  5CSN A;  2MA2 A;  3VRN A;  1SL8 A;  3R72 A;  4XJK B;  4N5X A;  3FE9 A;  1F4O A;  1E8A A;  1NUB A;  3WXA A;  3TUY C;  4PHK A;  1ODB A;  1LVC D;  1M63 B;  3VGO A;  1HT9 A;  3PLF B;  1IWQ A;  1N0Y A;  3LK1 A;  3IF7 A;  3EKJ A;  1OMD A;  4DUQ A;  1TUZ A;  1YVH A;  5CSF A;  1C7V A;  2CCM A;  2LP2 A;  3JTD C;  3CWG A;  4AQJ A;  4YGC B;  1JF0 A;  3BFA A;  3EK8 A;  1OOF A;  2EC6 C;  2WCH A;  3SG6 A;  1SR6 C;  1BLQ A;  1J1D A;  2NZ0 A;  1IJ6 A;  3M0W A;  1YX7 A;  3CZT X;  2ZNE A;  3JVT B;  3PSR A;  4XJK A;  2P71 A;  2LVV A;  3DXL A;  3DY9 A;  3PFV A;  4GGF C;  1AK8 A;  2GGZ A;  2PYQ A;  1KWO C;  4ORA B;  3L4A A;  1SYM A;  1XFU O;  2H61 A;  1QS7 A;  1TIZ A;  2BBN A;  2KBM A;  1OE9 B;  1QV1 A;  1QVI Z;  1SCM C;  1MQ1 A;  4OCI A;  2QEV A;  3NSK A;  4MSP A;  4NQG A;  2K7D A;  5I2O A;  3DVE A;  1DVI A;  2JOJ A;  1S5G Y;  5FI2 A;  4OVN F;  4AOM A;  3CYZ A;  3TDI A;  2OS8 C;  3ZNI A;  1IH0 A;  1QTX A;  2M1U A;  3SS3 A;  2COL B;  1KQM B;  1QIV A;  3R1P A;  1SW8 A;  3AKB A;  5JOL A;  4ICB A;  1R6P A;  1WDC B;  2BL0 C;  1MR8 A;  1FI6 A;  1DF0 A;  3S0B A;  2M9G A;  1KFX S;  1LXF C;  2CTN A;  1TWO A;  2PAL A;  1A03 A;  4INX A;  1XYD A;  3R1V A;  4A4C A;  1IGV A;  2B1U A;  4R1E A;  1Z4H A;  2SCP A;  1CDN A;  4QJ5 B;  5GQQ C;  2M49 B;  1QV0 A;  5IBW A;  2HQ8 A;  1QXP A;  1YR5 A;  1F54 A;  3WHU B;  1JBA A;  3DYE A;  1TNP A;  2F2O A;  2K2F A;  1C3Y A;  2ZND A;  4JPZ B;  1FPW A;  3DZT A;  1KFU S;  1AJ4 A;  2MLF C;  4CFR A;  2LC5 A;  1QAT A;  3BQ3 A;  1MF8 B;  2K2A A;  2LHL A;  1OMV A;  1RFJ A;  2OTG B;  3FE6 A;  3Q8I A;  4PAL A;  2KPH A;  2JPO A;  4GGN A;  3FWC A;  5AAN A;  3LK0 A;  1XVJ A;  3O2P A;  1OZO A;  4ETO A;  4MN0 A;  3LL8 B;  4MBE A;  2BE4 A;  1SNL A;  2I18 A;  2KI4 B;  1IQ3 A;  1CFF A;  1S6C A;  1G8I A;  1VRK A;  2JNX A;  4NDD A;  4QJ3 B;  1A29 A;  2WCB A;  4QJ4 B;  2BE6 A;  2KLD A;  2KFG A;  2LM5 A;  3D0Y B;  4YI9 A;  3WNX B;  1LA0 A;  1W7J B;  1P28 A;  1BJF A;  2ISD A;  1TCF A;  2LVK A;  3C1V A;  2NCO A;  1YUT A;  1B8R A;  1TN4 A;  4I5J A;  3B86 A;  3I5F C;  1CLB A;  4N1G A;  3IQO A;  1UHH A;  2H2K A;  5K89 A;  2KGR A;  4GNK B;  1RTP 1;  1S5G Z;  1K9P A;  1Y1A A;  2BKI B;  2LV7 A;  3EVR A;  2M7N A;  3GK4 X;  2KGB C;  4USL A;  1K94 A;  3V2L A;  1CM4 A;  3BUN B;  4M2O A;  1V1G A;  2JQ6 A;  1XK4 C;  4PE0 A;  1SPY A;  3D0Y A;  2KAV A;  3D10 A;  3K21 A;  2QEO A;  4GFT A;  4L9M A;  3UO9 A;  1F55 A;  1CMG A;  1NCZ A;  1DJZ A;  1NX0 A;  1L2O B;  4MLW A;  1GGZ A;  2KOT A;  4ZCU A;  3CAB A;  4HSZ A;  2JUL A;  1JF2 A;  1DTL A;  3OX5 A;  1OOH A;  3BUW B;  4PE7 A;  2KBI A;  2VRG A;  2I7A A;  1KK8 B;  1NX3 A;  3E3R A;  3D74 A;  2WND A;  2HQW A;  3TS5 B;  2TN4 A;  1SRA A;  2BBM A;  5DIC A;  3A8R A;  1J1E A;  2FOT A;  2P6B B;  2QEB A;  2OPO A;  1SMG A;  3BUO B;  1EL4 A;  1SSE B;  1CFC A;  1AJ5 A;  3WHT B;  2LLT A;  2JTZ A;  2L50 A;  2JC2 A;  1KSM A;  1RK9 A;  2JWW A;  3TUY B;  1IKU A;  2KHN A;  3SG2 A;  4F0Z B;  2FJU B;  3BFB A;  3TDU A;  1AUI B;  1CKK A;  3S0G A;  3NSO A;  2GTE A;  3PAT A;  1B8C A;  3JTD B;  5HYD A;  2CXJ A;  4YGA A;  2ZFD A;  5I94 A;  1EG3 A;  1ZFS A;  3L4L A;  1MWN A;  4C0K A;  4KYN A;  1CM1 A;  1SKT A;  2EC6 B;  2L5Y A;  2LAN A;  1SR6 B;  2PAS A;  4JQ0 D;  1S3P A;  5D3O A;  1JFK A;  1H8B A;  1K90 D;  5G08 A;  1NIW A;  3CGA A;  4HRG A;  4CFQ A;  2Y4Q A;  2KNE A;  5D69 A;  1J7R A;  4INW A;  3RM1 A;  1KWO B;  1OW4 A;  2L5X B;  2KAY A;  2LMV A;  1DF0 B;  3D73 A;  1QJT A;  5EL2 A;  1M31 A;  1J55 A;  3NSL A;  2KQ6 A;  1IQ5 A;  1SCM B;  2K0J A;  5KTY A;  1LKJ A;  2JXL A;  1J7O A;  2ERB A;  1ORG A;  1CLM A;  2KLE A;  1XFW O;  2ZRT A;  2BCA A;  4JD9 A;  1OZS A;  1UWO A;  2Y5I A;  2OS8 B;  4PT1 A;  2M29 A;  2WCF A;  2JXC A;  1F70 A;  4ORB B;  5HKY A;  3ICB A;  1GM0 A;  1WRZ A;  1CLL A;  2K60 A;  5AXI A;  2O60 A;  2KFF A;  5HLV A;  1QLS A;  2BL0 B;  1K95 A;  5I8N A;  4GGF A;  1QIW A;  4CID A;  3IQQ A;  4BY4 A;  1ZAC A;  4OV2 A;  1A2X A;  1B7T Y;  1RWY A;  1TNX A;  1PVA A;  1C3Z A;  2NLN A;  1YX8 A;  1L7Z A;  2LMT A;  1FW4 A;  3R1O A;  2LNK A;  1NPQ A;  1XFX O;  3B88 A;  1HQV A;  2JZI A;  3CTN A;  3CZ2 A;  3GOF A;  3GK1 A;  4IL1 A;  2I2R E;  1F8H A;  1A75 B;  1N2D A;  1V1F A;  3DVJ A;  1M39 A;  3OB2 B;  3OHM B;  1JC2 A;  2BKH B;  3D77 A;  1BG1 A;  2GGM A;  2ZN9 A;  2I94 A;  4YBH B;  1TNQ A;  3KO0 A;  2Q91 A;  5DKN A;  1KQV A;  4FQO A;  3KF9 A;  2MHH A;  1Y0V H;  1WDC C;  1K8U A;  4IJ7 A;  4MZJ A;  1BU3 A;  4CLN A;  2QPT A;  1YUR A;  2D8N A;  1R2U A;  2LUX A;  1DJW A;  1M46 A;  5AEQ A;  4DRW A;  2PVB A;  1BT6 A;  1WY9 A;  3NSI A;  2KI6 D;  2LUC A;  3SS5 A;  2EGD A;  1DEL A;  3KHE A;  3KPX A;  1AVS A;  1A75 A;  4PHN A;  3I5F B;  3S0D A;  5B8I B;  2L2C A;  1YVL A;  4MEW A;  1CB1 A;  3S0A A;  5KSZ A;  1LA3 A;  4FTG A;  2NCP A;  3CZ1 A;  1UHJ A;  1SK6 D;  3N7H A;  3BYA A;  1GQM A;  3SG7 A;  1DGU A;  4PHJ A;  3CR2 A;  3SG3 A;  5TNC A;  2Q4U A;  3B6X A;  1YUS A;  4N1F A;  1LS8 A;  1CTR A;  1NYA A;  3OBV A;  2WOR A; 
#chains in the Genus database with same CATH homology
 1DJX A;  2BCB A;  2KI6 C;  2M0R A;  3EK7 A;  5JJG A;  3OP0 A;  1YRU B;  2KI4 C;  1WRL A;  1B9A A;  2HPS A;  2WOS A;  2M1K B;  1ALV A;  1B7T Z;  4MRY A;  1S1E A;  1OMR A;  2K61 A;  1PUL A;  2JT3 A;  2LLS A;  1UUR A;  1SL9 A;  3AAJ A;  1BOC A;  3PN7 C;  2K7B A;  1K96 A;  2LVI A;  4CPV A;  4AQI A;  1N65 A;  4YGE B;  2K8M B;  1CMF A;  1XO5 A;  1XFV O;  2LE9 B;  1M45 A;  2JNF A;  3FS7 A;  3I5I C;  1DJY A;  3RLZ A;  1S6J A;  1NWD A;  3H4S E;  1B1G A;  1XK4 A;  5BPJ A;  1IRJ A;  1WRK A;  2L4I A;  5AER A;  1CDL A;  1TRF A;  3BUX B;  3I5G C;  1EH2 A;  3CLN A;  1S6I A;  2L0P A;  3AKA A;  2L2E A;  1XFY O;  1JFJ A;  1C7W A;  2A4J A;  1MXE A;  1NX2 A;  1WLM A;  1H4B A;  3A4U B;  4YGD B;  1CDP A;  3I5H C;  2F3Y A;  5PAL A;  1K9K A;  1KK7 Y;  2LCP A;  1K9U A;  1PK0 D;  5DKQ A;  2HET A;  2RGI A;  3CR5 X;  4TNC A;  3VRP A;  4PDZ A;  1IJ5 A;  5F6T A;  4GAO A;  1BMO A;  1YTZ C;  5I2Q A;  4M2P A;  3TS5 C;  3NXA A;  4MRX A;  1JSA A;  3FWB A;  2HF5 A;  5HLO A;  4ORC B;  3KEV A;  1TCO B;  1PSR A;  2ZRS A;  4I5L B;  1CDM A;  1NCX A;  2KYC A;  1Y1X A;  2BEC A;  1J7P A;  5FYX A;  1U5I A;  2E6W A;  4PE4 A;  2JRF A;  1RRO A;  4E68 A;  1WLZ A;  1YRT B;  1KCY A;  1UUS A;  4GBA A;  1PAL A;  4DS7 A;  2M8U A;  5CSJ A;  3TZ1 A;  1GJY A;  1C07 A;  2CNP A;  2H61 C;  2M3W A;  3SIA A;  1TOP A;  1GGW A;  3VRR A;  2IS9 A;  2CT9 A;  2M97 A;  1MUX A;  1UP5 A;  1K2H A;  5ER5 A;  5DKR A;  2MLE C;  2G9B A;  1BF5 A;  5HKW A;  4PCW A;  1RJV A;  1MHO A;  1NP8 A;  3PAL A;  2MAZ A;  3O4Y A;  3OX6 A;  2AAO A;  4C0J A;  1SL7 A;  3FIA A;  4OR9 B;  1G4Y R;  1ALW A;  1AHR A;  1ZUZ A;  4U8D A;  2WCE A;  4YGB B;  1SCV A;  1DGV A;  1NSH A;  3JVT C;  3SG4 A;  2E30 A;  5AFP A;  1PRW A;  2V53 A;  1LIN A;  2FCE A;  3LLE A;  1QLK A;  2QAC A;  1S36 A;  3SJS A;  4NDB A;  2LVJ A;  1KK7 Z;  5D7F A;  4WQ2 A;  2Y1M A;  1B47 A;  4I5K A;  2KYF A;  4P2Y B;  2K7C A;  2ZN8 A;  2PRU A;  3O6B A;  2Y1N A;  1TTX A;  1QX2 A;  2AUC A;  2SAS A;  1K93 D;  4GPL B;  1KQM C;  2G2B A;  1X02 A;  3SIB A;  1TNW A;  3GK2 A;  2PSR A;  1CNP A;  2PMY A;  4JWQ A;  2LAP A;  1UHI A;  2F3Z A;  3CR4 X;  1OOJ A;  1B4C A;  1FF1 A;  1BR4 B;  1REC A;  2LHI A;  3EVU A;  2LMU A;  1QX7 A;  5CSI A;  4M2Q A;  1DT7 B;  3F45 A;  1BOD A;  1KSO A;  2F8P A;  5ER4 X;  1KFX L;  2AMI A;  4NDC A;  1B8L A;  1NCY A;  1UHK A;  3QRX A;  4BY5 A;  2MBX A;  1NX1 A;  2LLU A;  4XYN A;  2EHB A;  2DOQ A;  3BXK A;  2MRD A;  3EKH A;  2OTG C;  3EVV A;  3VRQ A;  2JU0 A;  4WRI A;  4PHM A;  2WC8 A;  3SG5 A;  3CS1 A;  1DJI A;  1J7Q A;  4MZL A;  1F71 A;  1ZMZ A;  1XA5 A;  3PM8 A;  1QX5 B;  2L51 A;  4P5O E;  1Q80 A;  1KFU L;  3DF0 B;  5J3X A;  2M7L A;  3AAK A;  1DJH A;  3O78 A;  2LP3 A;  1F4Q A;  2JT8 A;  5CPV A;  3PN7 B;  1W7I B;  4HRH A;  1QAS A;  1G33 A;  3BUM B;  3MSE B;  2R2I A;  1IG5 A;  1ZOT B;  2MJW B;  1Y1U A;  4OKH A;  3I5I B;  1CFD A;  2JT0 A;  1FBV A;  4YI8 A;  2NXQ A;  2JTT A;  2F33 A;  2KSP A;  2GV5 A;  3BOW B;  5HKZ A;  1PSB A;  1D1O A;  1DMO A;  1SBJ A;  3I5G B;  5KU1 A;  4UPG A;  2F2P A;  3DVK A;  4PE1 A;  3HX4 A;  3HCM A;  2ZKM X;  2CBL A;  2KDH A;  3DF0 A;  3DVM A;  4ZCV A;  4YRU A;  3I5H B;  2JPT A;  1YUU A;  4D1E A;  1FI5 A;  1QVI Y;  4I5N B;  2K7O A;  1CFP A;  4GUK A;  1U5I B;  3OB1 B;  3VRO A;  4MVF A;  3ZWH A;  3LCP C;  1PVB A;  1JUO A;  1BR1 B;  1EJ3 A;  1OSA A;  1A4P A;  1L2O C;  5I2L A;  2L4H A;  2FCD A;  1XFZ O;  1MXL C;  3DD4 A;  1KK8 C;  2KAX A;  1UHN A;  3BOW A;  3EK4 A;  2KFH A;  1OQP A;  2O5G A;  2KQY A;  4C0L A;  1DJG A;  1Y6W A;  1S26 D;  2L98 A;  1EG4 A;  1EXR A;  4Q04 A;  4DIR A;  1JWD A;  4MZK A;  1AP4 A;  4DCK A;  1SY9 A;  2BCX A;  4WQ3 A;  3TDZ A;  4A4B A;  5CSN A;  2MA2 A;  3VRN A;  1SL8 A;  4XJK B;  4N5X A;  1F4O A;  1E8A A;  1NUB A;  3WXA A;  3TUY C;  4PHK A;  1ODB A;  1LVC D;  1M63 B;  3VGO A;  1HT9 A;  3PLF B;  1IWQ A;  1N0Y A;  3LK1 A;  3IF7 A;  3EKJ A;  1OMD A;  4DUQ A;  1YVH A;  5CSF A;  1C7V A;  2CCM A;  2LP2 A;  3JTD C;  3CWG A;  4AQJ A;  4YGC B;  1JF0 A;  3EK8 A;  2EC6 C;  3SG6 A;  1SR6 C;  1BLQ A;  1J1D A;  2NZ0 A;  1IJ6 A;  3M0W A;  1YX7 A;  3CZT X;  2ZNE A;  3JVT B;  3PSR A;  4XJK A;  2LVV A;  3PFV A;  4GGF C;  1AK8 A;  2GGZ A;  1KWO C;  4ORA B;  1SYM A;  1XFU O;  2H61 A;  1QS7 A;  1TIZ A;  2BBN A;  2KBM A;  1OE9 B;  1QV1 A;  1QVI Z;  1SCM C;  1MQ1 A;  4OCI A;  3NSK A;  4MSP A;  4NQG A;  2K7D A;  5I2O A;  3DVE A;  1DVI A;  2JOJ A;  1S5G Y;  4AOM A;  4OVN F;  3TDI A;  2OS8 C;  3ZNI A;  1IH0 A;  1QTX A;  2M1U A;  2COL B;  1KQM B;  1QIV A;  1SW8 A;  3AKB A;  5JOL A;  4ICB A;  1R6P A;  1WDC B;  2BL0 C;  1MR8 A;  1FI6 A;  1DF0 A;  2M9G A;  1KFX S;  1LXF C;  2CTN A;  1A03 A;  2PAL A;  1XYD A;  4A4C A;  2B1U A;  1IGV A;  4R1E A;  2SCP A;  1CDN A;  4QJ5 B;  5GQQ C;  2M49 B;  1QV0 A;  5IBW A;  2HQ8 A;  1QXP A;  1YR5 A;  1F54 A;  3WHU B;  1JBA A;  1TNP A;  2F2O A;  2K2F A;  2ZND A;  4JPZ B;  1FPW A;  1KFU S;  1AJ4 A;  2MLF C;  4CFR A;  2LC5 A;  1QAT A;  3BQ3 A;  1MF8 B;  2K2A A;  2LHL A;  1OMV A;  1RFJ A;  2OTG B;  4HRE E;  4PAL A;  4GGN A;  3FWC A;  5AAN A;  3LK0 A;  1XVJ A;  3O2P A;  1OZO A;  4ETO A;  4MN0 A;  3LL8 B;  4MBE A;  2BE4 A;  1SNL A;  2I18 A;  2KI4 B;  1IQ3 A;  1CFF A;  1S6C A;  1G8I A;  1VRK A;  2JNX A;  4NDD A;  4QJ3 B;  1A29 A;  2WCB A;  4QJ4 B;  2BE6 A;  2LM5 A;  2KFG A;  3D0Y B;  4YI9 A;  3WNX B;  1LA0 A;  1W7J B;  1BJF A;  2ISD A;  1TCF A;  2LVK A;  3C1V A;  2NCO A;  1YUT A;  1B8R A;  1TN4 A;  4I5J A;  3I5F C;  1CLB A;  4N1G A;  3IQO A;  1UHH A;  2H2K A;  5K89 A;  2KGR A;  4GNK B;  1RTP 1;  1S5G Z;  1K9P A;  1Y1A A;  2BKI B;  2LV7 A;  3EVR A;  2M7N A;  3GK4 X;  2KGB C;  4USL A;  1K94 A;  1CM4 A;  3BUN B;  4M2O A;  1V1G A;  2JQ6 A;  1XK4 C;  4PE0 A;  1SPY A;  3D0Y A;  2KAV A;  3D10 A;  3K21 A;  4GFT A;  4L9M A;  1F55 A;  1CMG A;  1NCZ A;  1DJZ A;  1NX0 A;  1L2O B;  4MLW A;  1GGZ A;  2KOT A;  4ZCU A;  4HSZ A;  2JUL A;  1JF2 A;  1DTL A;  3OX5 A;  3BUW B;  4PE7 A;  2KBI A;  2VRG A;  2I7A A;  1KK8 B;  1NX3 A;  3E3R A;  2WND A;  2HQW A;  3TS5 B;  2TN4 A;  1SRA A;  2BBM A;  3A8R A;  1J1E A;  2FOT A;  2P6B B;  2OPO A;  1SMG A;  3BUO B;  1EL4 A;  1CFC A;  1AJ5 A;  3WHT B;  2LLT A;  2JTZ A;  2L50 A;  2JC2 A;  1KSM A;  1RK9 A;  2JWW A;  3TUY B;  1IKU A;  2KHN A;  3SG2 A;  4F0Z B;  2FJU B;  3TDU A;  1AUI B;  1CKK A;  3NSO A;  3PAT A;  1B8C A;  3JTD B;  5HYD A;  2CXJ A;  4YGA A;  2ZFD A;  1EG3 A;  1ZFS A;  1MWN A;  4C0K A;  1CM1 A;  1SKT A;  2EC6 B;  2LAN A;  4JQ0 D;  1SR6 B;  2PAS A;  1S3P A;  1JFK A;  1H8B A;  1K90 D;  5G08 A;  1NIW A;  3CGA A;  4HRG A;  4CFQ A;  2Y4Q A;  2KNE A;  5D69 A;  1J7R A;  3RM1 A;  1KWO B;  2L5X B;  2KAY A;  2LMV A;  1DF0 B;  1QJT A;  1M31 A;  1J55 A;  3NSL A;  2KQ6 A;  1IQ5 A;  1SCM B;  2K0J A;  5KTY A;  1LKJ A;  2JXL A;  1J7O A;  2ZRT A;  1CLM A;  1XFW O;  2BCA A;  1OZS A;  1UWO A;  2Y5I A;  2OS8 B;  2M29 A;  2WCF A;  2JXC A;  1F70 A;  4ORB B;  5HKY A;  3ICB A;  1WRZ A;  1CLL A;  5AXI A;  2O60 A;  2KFF A;  5HLV A;  1QLS A;  2BL0 B;  1K95 A;  5I8N A;  4GGF A;  1QIW A;  4CID A;  3IQQ A;  4BY4 A;  1ZAC A;  4OV2 A;  1A2X A;  1B7T Y;  1RWY A;  1TNX A;  1PVA A;  2NLN A;  1YX8 A;  1L7Z A;  2LMT A;  1FW4 A;  2LNK A;  1NPQ A;  1XFX O;  3CTN A;  1HQV A;  2JZI A;  3GOF A;  3GK1 A;  4IL1 A;  2I2R E;  1F8H A;  1A75 B;  1N2D A;  1V1F A;  3DVJ A;  1M39 A;  3OB2 B;  3OHM B;  1JC2 A;  2BKH B;  1BG1 A;  2GGM A;  2ZN9 A;  2I94 A;  4YBH B;  1TNQ A;  3KO0 A;  2Q91 A;  5DKN A;  1KQV A;  4FQO A;  3KF9 A;  2MHH A;  1Y0V H;  1WDC C;  1K8U A;  4MZJ A;  1BU3 A;  4CLN A;  2QPT A;  1YUR A;  2D8N A;  1R2U A;  2LUX A;  1DJW A;  1M46 A;  5AEQ A;  4DRW A;  2PVB A;  1BT6 A;  1WY9 A;  3NSI A;  2KI6 D;  2LUC A;  2EGD A;  3KHE A;  3KPX A;  1AVS A;  1A75 A;  4PHN A;  3I5F B;  5B8I B;  1YVL A;  4MEW A;  1CB1 A;  5KSZ A;  1LA3 A;  4FTG A;  2NCP A;  1UHJ A;  1SK6 D;  3BYA A;  1GQM A;  3SG7 A;  1DGU A;  4PHJ A;  3CR2 A;  3SG3 A;  5TNC A;  2Q4U A;  1YUS A;  4N1F A;  1CTR A;  1NYA A;  2WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...