1G8IA

Crystal structure of human frequenin (neuronal calcium sensor 1)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
182
Chain Sequence
b'SNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Immunocytochemical localization and crystal structure of human frequenin (neuronal calcium sensor 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 69
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA02
3I5FB 1H8BA 3AKBA 3SG5A 1CFPA 1B7TY 1S6CA 2JNXA 2BCAA 1DT7B 3I5IB 4HSZA 4JWQA 1HT9A 1AJ5A 1DVIA 1XYDA 2KSPA 4PE1A 3IQQA 4MVFA 2LP3A 1PVAA 3EK4A 1QXPA 2L4IA 1A03A 1IWQA 3TUYC 3BUOB 1JSAA 2BCXA 1NCYA 4UPGA 4D1EA 2KFFA 1EL4A 4ICBA 3E3RA 4WRIA 1WDCC 1ZACA 2K0JA 1S1EA 2KBMA 1OE9B 1KFUL 5GQQC 2KYCA 5DKRA 3OB2B 1PALA 4OVNF 3K21A 2KI6C 4BY4A 3OHMB 4I5JA 1R6PA 2JRFA 2KI6D 1U5IA 1SW8A 1S5GY 1A29A 1SPYA 2JXLA 2JC2A 1J7RA 3BUMB 1BR1B 2JZIA 1IQ3A 2WORA 1W7IB 3NSOA 1W7JB 4C0LA 1SCVA 1DJZA 1OZSA 5HKWA 4IL1A 1XFWO 2MLFC 4MN0A 1G8IA 3CR5X 1QLKA 4C0KA 2FCDA 3I5FC 4DS7A 1BLQA 1CDPA 2BL0B 2NZ0A 1DJXA 1BOCA 2LVJA 3KF9A 3CR4X 1IRJA 1QVIZ 3I5IC 1XFUO 2EC6B 4DRWA 1WRLA 4ETOA 1PRWA 3ICBA 2FJUB 2KQ6A 1J55A 1LXFC 2A4JA 3BXKA 3DF0B 3PLFB 1PULA 2M7LA 2KNEA 1K95A 1G33A 1M46A 3BUWB 1NCXA 1SKTA 2SASA 1RWYA 2JT3A 1IQ5A 1J7OA 1TRFA 1BG1A 1RROA 3EVRA 2LAPA 3A4UB 3I5GC 1LVCD 1K9KA 2FOTA 4JQ0D 1DF0B 1NP8A 1CFFA 3CS1A 1SNLA 1GQMA 1YR5A 1IKUA 4XJKA 2E6WA 2LLSA 2KFGA 4MRYA 1Y1UA 5JJGA 2M0RA 1JFKA 2LLTA 1KWOB 3CR2A 3QRXA 5F6TA 2ZNDA 5BPJA 3GOFA 1GJYA 3PATA 4DIRA 3WXAA 4Q04A 1IJ5A 4P5OE 1UUSA 1F71A 1JF0A 5K89A 1DMOA 1BJFA 1TCOB 1CDMA 3BOWA 2JU0A 4PCWA 4HRGA 1S3PA 2MRDA 4YGEB 1JWDA 2PSRA 5AANA 1WY9A 4OV2A 1L2OB 1IH0A 1A75B 2V53A 1CFCA 1SCMB 2BL0C 3PSRA 5I2OA 3TUYB 1ZMZA 1BR4B 3EKHA 1JUOA 2AAOA 1IGVA 2EC6C 2HETA 1Y1AA 1NX2A 1QV1A 1AK8A 3FWCA 2K7DA 4C0JA 4DCKA 2E30A 5HYDA 1RJVA 3RM1A 4CLNA 4GBAA 3DVKA 1XK4A 2Y1MA 4MLWA 1A4PA 4GUKA 1DJWA 2BECA 4GGFC 4QJ3B 2LVKA 3ZWHA 2KGBC 2KOTA 5D7FA 1KK8B 1V1FA 4QJ5B 1H4BA 4JPZB 2LC5A 2LV7A 1OZOA 2LMUA 1NX3A 1UHNA 1KWOC 1NX0A 3KPXA 1XFYO 1NUBA 1LA0A 2HQWA 1DTLA 4XYNA 2FCEA 4M2OA 1DGUA 2KHNA 2IS9A 1A2XA 1AHRA 2ZRSA 4FQOA 1CDNA 1E8AA 2LVIA 2F3ZA 3TDUA 1L2OC 5TNCA 5HKYA 1SCMC 2M29A 1YURA 1M63B 2F33A 2LM5A 4BY5A 4I5LB 1DGVA 2LCPA 4PE7A 2I94A 2JQ6A 1B8RA 2K2AA 3WNXB 4CIDA 1QATA 3I5GB 1SR6B 5CSFA 4PDZA 1M45A 1MWNA 2KFHA 4N1GA 2O5GA 3PFVA 1C7WA 2KYFA 5FYXA 1LKJA 2L0PA 2EHBA 2ZN8A 1K93D 3D0YB 1TNXA 1TOPA 4N1FA 5AXIA 1LA3A 2ISDA 4YRUA 1KK8C 2G2BA 1PSBA 2OS8B 1JFJA 1HQVA 1YTZC 1CDLA 2BBMA 2OTGB 3JVTB 5JOLA 1TCFA 2H61A 5G08A 4QJ4B 4MZKA 1F55A 2KAXA 4YGCB 2NCOA 1YX7A 4A4BA 1JF2A 1ZFSA 1YVHA 2ZNEA 3GK4X 3H4SE 1SK6D 1B8LA 1WLMA 2JXCA 1EH2A 2M1KB 5CSNA 4I5KA 1F54A 3CLNA 1TTXA 5HLVA 5CSJA 3DVEA 2F3YA 1XFVO 2M1UA 2KAVA 1QJTA 4GNKB 1UHKA 4E68A 3FIAA 1R2UA 2BE4A 1IG5A 1OSAA 1XO5A 1J7QA 1RTP1 4MZJA 3SG7A 5I2LA 2K7BA 3PN7B 3EVUA 1RFJA 3SG6A 2JNFA 1SR6C 1YX8A 4NDBA 1CFDA 3RLZA 1QX7A 2BKHB 1CLLA 2TN4A 1VRKA 2KI4C 4GGNA 1QLSA 2JT0A 3CGAA 2HPSA 1QIVA 3NSIA 2Q4UA 1BMOA 3EK8A 2ZKMX 4AQJA 3GK2A 2K7CA 1NX1A 2OS8C 2R2IA 2ZRTA 2MBXA 1S6IA 2COLB 3BYAA 2OTGC 3CTNA 3JVTC 3SG4A 5CSIA 1QX5B 1IJ6A 2I2RE 1MF8B 1SBJA 3SJSA 2JWWA 1J1EA 1F8HA 4I5NB 3A8RA 3O78A 1KSMA 1GGZA 2RGIA 2LMVA 1NSHA 1K90D 3D10A 1Y6WA 2LE9B 1QV0A 1J1DA 3SG2A 1L7ZA 1BU3A 3O2PA 3VRQA 1SY9A 5DKNA 3HX4A 2CCMA 2M3WA 1UHIA 2B1UA 1KFXS 1ZOTB 4NQGA 3OP0A 5HLOA 1CMGA 1M31A 1QS7A 1SL9A 1TNWA 1FW4A 4OCIA 1CTRA 4ORCB 3C1VA 3EVVA 2ZFDA 4ZCUA 3BUNB 2I18A 4AQIA 1BT6A 3JTDC 3NSLA 2MA2A 1B8CA 1RK9A 4ZCVA 1MXEA 3PN7C 3GK1A 3F45A 1K2HA 2LHIA 3CZTX 3LK0A 1JC2A 4PHMA 1CB1A 3OX6A 5KSZA 1NPQA 3DF0A 3FWBA 1U5IB 4USLA 5KTYA 2K2FA 2BCBA 1MUXA 2K61A 2BE6A 1KK7Y 1QX2A 2MHHA 2LUXA 2QPTA 2WC8A 4M2PA 4WQ3A 1UWOA 2F8PA 3TS5B 1YRTB 1N65A 1EG4A 4GGFA 1LINA 4PE0A 2G9BA 1B1GA 1FF1A 1DF0A 1XFXO 1OMVA 3DD4A 1KQVA 1NYAA 3BQ3A 1Y1XA 1KFUS 2L51A 2JTTA 1JBAA 2PVBA 2MAZA 1KFXL 5DKQA 1ALWA 4WQ2A 2LMTA 2EGDA 1YVLA 1DJIA 2WCFA 1N0YA 2CNPA 2K7OA 1YUUA 4DUQA 2GV5A 5CPVA 1PSRA 1WLZA 2BBNA 3VROA 1J7PA 1B47A 1DJHA 1OMRA 2NLNA 2PRUA 4GPLB 4U8DA 2KDHA 1PVBA 3CWGA 3LCPC 1AP4A 1FPWA 1TNQA 1A75A 2CT9A 4YI8A 1TN4A 1MHOA 2WOSA 1EJ3A 1F4QA 2LP2A 1B4CA 1AJ4A 2KGRA 2KI4B 4P2YB 3SIBA 1KQMB 2JTZA 2P6BB 3M0WA 1S6JA 3IQOA 4XJKB 3SIAA 1SMGA 2HQ8A 1B9AA 1C07A 1SYMA 1X02A 2LNKA 4CPVA 3IF7A 4MRXA 1G4YR 1Q80A 2WNDA 4MZLA 3SG3A 3BUXB 1D1OA 4MEWA 1NIWA 4YI9A 1CKKA 1C7VA 1FI6A 1QASA 2PALA 3TS5C 1RECA 4HRHA 2D8NA 2PMYA 3BOWB 3NSKA 3WHUB 5AFPA 1UP5A 2H61C 1MQ1A 1GGWA 3WHTB 1AVSA 1EG3A 1ALVA 1YRUB 1BODA 5D69A 1FBVA 2WCBA 2M49B 2LLUA 3LK1A 5IBWA 2K8MB 3EK7A 3KEVA 1KCYA 4YBHB 4PHNA 2JPTA 4FTGA 2I7AA 4MBEA 1DJYA 2KBIA 5ER5A 4OR9B 4AOMA 1CLMA 1V1GA 2HF5A 2OPOA 5B8IB 3VRRA 4A4CA 5AEQA 3I5HC 1YUTA 2CBLA 2O60A 2L4HA 2Q91A 1UURA 1TIZA 4YGDB 1AUIB 2SCPA 1PK0D 3HCMA 3JTDB 4L9MA 4NDCA 5HKZA 4R1EA 1OQPA 2L5XB 3PALA 3ZNIA 2DOQA 2VRGA 2BKIB 2CXJA 3KHEA 1FI5A 3VRPA 2NCPA 4OKHA 1F4OA 4MSPA 2AUCA 4YGBB 2F2OA 2Y5IA 1XFZO 1TNPA 1KQMC 2Y4QA 1CM4A 4PE4A 1CM1A 4M2QA 1KK7Z 4TNCA 3NXAA 1DJGA 3TDZA 1UHJA 4CFRA 2GGZA 3EKJA 3LLEA 1WRKA 2PASA 1KSOA 1K94A 2H2KA 1EXRA 1SL7A 4HREE 4F0ZB 4CFQA 2JT8A 1F70A 1Y0VH 3D0YA 1SRAA 1K8UA 3TDIA 1SL8A 5ER4X 2LVVA 2LANA 1ODBA 2JOJA 1N2DA 2CTNA 5I2QA 1K96A 2ZN9A 3AKAA 3OX5A 2MLEC 1S36A 2WCEA 3VGOA 2KQYA 4PHKA 1XVJA 1B7TZ 2L2EA 3KO0A 3O4YA 4PALA 3OB1B 1CMFA 3DVJA 4NDDA 2M9GA 1QVIY 2Y1NA 4ORBB 1QIWA 1XK4C 3DVMA 2F2PA 3LL8B 4GAOA 5J3XA 1K9UA 1WDCB 2LUCA 2M7NA 2JULA 1MXLC 1ZUZA 1OMDA 1S26D 3AAKA 4N5XA 1MR8A 5KU1A 1WRZA 2NXQA 3AAJA 2AMIA 1UHHA 1YUSA 4PHJA 2QACA 1M39A 2L98A 2L50A 2M97A 5AERA 3PM8A 4ORAB 1S5GZ 1CLBA 1BF5A 1QTXA 1OOJA 2MJWB 4GFTA 1XA5A 2GGMA 5I8NA 3VRNA 3I5HB 1K9PA 3MSEB 5PALA 2M8UA 1CNPA 1NCZA 2LHLA 3O6BA 1NWDA 3TZ1A 3FS7A 4YGAA 2KAYA
chains in the Genus database with same CATH superfamily
3I5FB 3S0EA 1H8BA 3AKBA 3SG5A 1CFPA 1B7TY 1S6CA 2JNXA 2BCAA 1DT7B 3I5IB 4HSZA 4JWQA 3R1OA 1HT9A 1AJ5A 1DVIA 3S0FA 1XYDA 2KSPA 2WC5A 3IQQA 4MVFA 2LP3A 4PE1A 1PVAA 3EK4A 1QXPA 2L4IA 3O4XA 1A03A 1IWQA 3TUYC 3BUOB 1JSAA 2BCXA 1NCYA 4UPGA 4D1EA 1TUZA 1EL4A 2KFFA 3BFBA 4ICBA 3E3RA 4WRIA 1WDCC 1ZACA 2K0JA 1S1EA 2KBMA 1OE9B 1KFUL 5GQQC 2KYCA 1OOGA 5DKRA 1DELA 3OB2B 4JD9A 1PALA 4OVNF 3K21A 2KI6C 4BY4A 3OHMB 4I5JA 4INWA 2YGUA 1GM0A 1R6PA 2JRFA 2KI6D 1U5IA 1SW8A 4FQTA 1S5GY 1A29A 1SPYA 5FI2A 2JXLA 2QEOA 2JC2A 3NGVA 1J7RA 3BUMB 1BR1B 2JZIA 1IQ3A 3NHIA 2WORA 1W7IB 3NSOA 1W7JB 4C0LA 1SCVA 1DJZA 1OZSA 1LS8A 5HKWA 4IL1A 1XFWO 2MLFC 4MN0A 1G8IA 3PJIA 3CR5X 1QLKA 4C0KA 2FCDA 3I5FC 1W9ZA 4DS7A 1BLQA 1CDPA 3DY9A 4IJ7A 2BL0B 2FJYA 2NZ0A 1DJXA 1BOCA 1Z4HA 2LVJA 3KF9A 1QWVA 3CR4X 1IRJA 1QVIZ 3I5IC 1XFUO 2EC6B 4DRWA 1WRLA 4ETOA 1PRWA 3ICBA 2FJUB 2KQ6A 3CDNA 3R1VA 1J55A 1LXFC 1ORGA 2A4JA 3BXKA 3DF0B 1PULA 3PLFB 2M7LA 2KNEA 1K95A 1G33A 1IIOA 1M46A 3BUWB 1NCXA 1SKTA 2SASA 1RWYA 2JT3A 1IQ5A 1J7OA 1SSEB 1TRFA 1BG1A 1RROA 3EVRA 2LAPA 3A4UB 3I5GC 1LVCD 1K9KA 2FOTA 4JQ0D 1DF0B 1NP8A 1CFFA 3CS1A 1SNLA 1GQMA 1YR5A 1IKUA 4XJKA 1C3ZA 2E6WA 2KFGA 2LLSA 1Y1UA 4MRYA 5JJGA 2P70A 2M0RA 1JFKA 2LLTA 1KWOB 3CR2A 3QRXA 5F6TA 2ZNDA 5BPJA 3GOFA 1GJYA 3PATA 4DIRA 3R1PA 3WXAA 4Q04A 1IJ5A 4P5OE 1UUSA 1F71A 1JF0A 5K89A 1DMOA 1BJFA 1TCOB 1CDMA 3B6XA 3BOWA 2JU0A 4PCWA 4HRGA 1S3PA 2MRDA 4YGEB 1JWDA 2PSRA 5AANA 2KLDA 3CABA 5I94A 2QEHA 1WY9A 2PYQA 1L2OB 4OV2A 1XFRA 3S0BA 3V2LA 1IH0A 1A75B 2V53A 1CFCA 1SCMB 2BL0C 3PSRA 5I2OA 3TUYB 1ZMZA 1BR4B 3EKHA 3FE8A 1JUOA 2AAOA 1IGVA 2EC6C 2HETA 1Y1AA 1NX2A 1QV1A 1AK8A 3FWCA 2K60A 2K7DA 4C0JA 4DCKA 2E30A 5HYDA 1RJVA 3RM1A 4CLNA 4GBAA 3DVKA 3NHTA 1XK4A 2Y1MA 4MLWA 1A4PA 4GUKA 1DJWA 2BECA 4GGFC 4QJ3B 2LVKA 3ZWHA 2KGBC 2KOTA 5D7FA 1KK8B 1V1FA 3SS5A 4QJ5B 4JPZB 3K1EA 2LC5A 2LV7A 1OZOA 2LMUA 1NX3A 1UHNA 1KWOC 1NX0A 2L5YA 3KPXA 3CZ2A 3UO9A 1XFYO 1NUBA 1LA0A 2HQWA 1DTLA 4KYNA 4XYNA 2FCEA 4M2OA 1Z2CB 1DGUA 2KHNA 2IS9A 1A2XA 1AHRA 2WCJA 2ZRSA 1OOIX 1E8AA 4FQOA 1CDNA 2LVIA 2F3ZA 3TDUA 1L2OC 5TNCA 5HKYA 1SCMC 4OZDA 2M29A 1YURA 1M63B 2F33A 2LM5A 3CZ1A 3IVTA 4I5LB 4BY5A 3TZ1A 1DGVA 2LCPA 4PE7A 2I94A 2JQ6A 1B8RA 2K2AA 3DXLA 3WNXB 4CIDA 1QATA 3I5GB 1SR6B 5CSFA 4PDZA 1M45A 1MWNA 2KFHA 4N1GA 2O5GA 3PFVA 1C7WA 2KYFA 5FYXA 1LKJA 3D75A 2L0PA 2EHBA 2ZN8A 1K93D 3D0YB 3N7HA 1TNXA 1TOPA 4N1FA 5AXIA 1LA3A 2ISDA 4YRUA 1KK8C 2G2BA 1PSBA 2OS8B 1JFJA 1HQVA 1YTZC 1CDLA 2BBMA 2OTGB 3SS3A 3JVTB 5JOLA 1TCFA 2H61A 5G08A 4QJ4B 4MZKA 1F55A 2KAXA 4YGCB 2NCOA 1YX7A 4A4BA 3B7AA 1JF2A 1ZFSA 2WCLA 1YVHA 2ZNEA 3GK4X 3H4SE 1SK6D 1B8LA 1OOHA 1WLMA 2JXCA 1EH2A 2M1KB 5CSNA 4I5KA 1F54A 3CLNA 1TTXA 5HLVA 5CSJA 3DVEA 2F3YA 1XFVO 2M1UA 2KAVA 3BJHA 1QJTA 4GNKB 3L47A 1UHKA 4E68A 3FIAA 1R2UA 2BE4A 1XO5A 1IG5A 1OSAA 2JPOA 1J7QA 1RTP1 4MZJA 3SG7A 5I2LA 2H8VA 2K7BA 3PN7B 3EVUA 1RFJA 3SG6A 2JNFA 1SR6C 1YX8A 4NDBA 1CFDA 3RLZA 1QX7A 2BKHB 3DYEA 1CLLA 3S0AA 2TN4A 1VRKA 2KI4C 4GGNA 1QLSA 2QDIA 2JT0A 3CGAA 2HPSA 1QIVA 3NSIA 2Q4UA 1BMOA 3EK8A 2ZKMX 4AQJA 3GK2A 2K7CA 1NX1A 2OS8C 2R2IA 2ZRTA 2MBXA 1S6IA 2COLB 3BYAA 2OTGC 3CTNA 3JVTC 3SG4A 5CSIA 1QX5B 1IJ6A 2I2RE 1DEKA 1MF8B 1SBJA 1TUJA 3B88A 3SJSA 2JWWA 1J1EA 1F8HA 4I5NB 3A8RA 3O78A 1KSMA 1GGZA 2RGIA 3UNWA 2LMVA 2ERBA 1NSHA 1K90D 3D10A 1Y6WA 2LE9B 3S0GA 1QV0A 1J1DA 3SG2A 1L7ZA 1BU3A 3O2PA 3VRQA 1SY9A 5DKNA 3HX4A 2CCMA 2M3WA 1UHIA 2B1UA 1KFXS 1H4BA 3BFAA 1ZOTB 4NQGA 3OP0A 5HLOA 1CMGA 1M31A 1QS7A 1SL9A 1TNWA 5DICA 4INXA 1FW4A 4OCIA 1CTRA 4ORCB 3C1VA 3D77A 3EVVA 2ZFDA 4ZCUA 3BUNB 2I18A 4AQIA 1BT6A 3JTDC 3NSLA 2MA2A 1B8CA 1RK9A 4ZCVA 1MXEA 3PN7C 3GK1A 3F45A 1K2HA 2LHIA 3CZTX 3LK0A 1JC2A 4PHMA 1CB1A 3OX6A 5KSZA 1NPQA 3DF0A 3FWBA 1U5IB 3D76A 4USLA 5KTYA 2K2FA 2BCBA 1MUXA 2K61A 2BE6A 1KK7Y 1QX2A 2MHHA 2LUXA 2QPTA 2WC8A 4M2PA 4WQ3A 1UWOA 2F8PA 3TS5B 5HL1A 1YRTB 1N65A 1EG4A 4GGFA 1LINA 4PE0A 2G9BA 1B1GA 1FF1A 1DF0A 1XFXO 1T14A 1OMVA 3DD4A 1KQVA 1NYAA 3BQ3A 1Y1XA 1KFUS 2L51A 2JTTA 1JBAA 2PVBA 2MAZA 1KFXL 5DKQA 1ALWA 1P28A 4WQ2A 2LMTA 3SS4A 2EGDA 1YVLA 1DJIA 2KLEA 1N0YA 2WCFA 2CNPA 2K7OA 1YUUA 4DUQA 2GV5A 5CPVA 1PSRA 1WLZA 2BBNA 3VROA 1J7PA 1B47A 1DJHA 1OMRA 2NLNA 2PRUA 4GPLB 4U8DA 2KDHA 1PVBA 3CWGA 3LCPC 1AP4A 1FPWA 1TNQA 1A75A 2CT9A 5FI7A 4YI8A 3D78A 1TN4A 1MHOA 2WOSA 1EJ3A 1F4QA 2LP2A 1B4CA 1OW4A 1AJ4A 2KGRA 2KI4B 4P2YB 3BFHA 1KQMB 2JTZA 2P6BB 3SIBA 3M0WA 1S6JA 3IQOA 4XJKB 3SIAA 1SMGA 2PQLA 2HQ8A 1B9AA 1C07A 1SYMA 1X02A 2LNKA 4CPVA 3IF7A 4MRXA 1G4YR 1Q80A 2WNDA 4MZLA 3SG3A 3BUXB 1D1OA 4MEWA 1NIWA 4YI9A 3RZSA 1CKKA 1C7VA 1FI6A 1QASA 2PALA 1C3YA 3TS5C 1RECA 4HRHA 2D8NA 2PMYA 3BOWB 3NSKA 3Q8IA 3WHUB 5AFPA 1UP5A 2H61C 1MQ1A 1GGWA 3WHTB 1AVSA 1EG3A 1ALVA 2QEBA 1YRUB 2BAPA 2WC6A 5D69A 1BODA 3DZTA 1FBVA 2P71A 2M49B 2LLUA 2WCBA 3LK1A 5IBWA 2K8MB 3EK7A 3KEVA 1KCYA 4YBHB 4PHNA 2JPTA 4FTGA 2I7AA 4MBEA 1DJYA 2KBIA 2BNXA 3D73A 4OR9B 5ER5A 4AOMA 1CLMA 1V1GA 2HF5A 2OPOA 5B8IB 3VRRA 4A4CA 5AEQA 3I5HC 1YUTA 2CBLA 2O60A 2L4HA 2Q91A 1UURA 1TIZA 4JKTA 4YGDB 1AUIB 2SCPA 1PK0D 3HCMA 3JTDB 3L4LA 4L9MA 3CYZA 4NDCA 5HKZA 4R1EA 1OQPA 2L5XB 3PALA 3ZNIA 2KPHA 2DOQA 2VRGA 2BKIB 2CXJA 3KHEA 1FI5A 3VRPA 2NCPA 4OKHA 1F4OA 4MSPA 3VB1A 2AUCA 3R72A 2F2OA 2Y5IA 1XFZO 1TNPA 1KQMC 3D74A 4YGBB 5FI6A 2Y4QA 3PM2A 1CM4A 4PE4A 1CM1A 3EG5B 4M2QA 1KK7Z 4TNCA 3NXAA 1DJGA 3TDZA 1UHJA 4CFRA 2GGZA 3EKJA 3LLEA 1WRKA 2PASA 1KSOA 1K94A 2H2KA 4F7FA 2L2CA 1EXRA 1SL7A 4HREE 4F0ZB 4CFQA 2JT8A 1F70A 1Y0VH 3D0YA 3FE6A 1SRAA 1K8UA 3S0DA 3TDIA 1SL8A 2WCKA 5ER4X 2LVVA 3OBVA 2LANA 1ODBA 2GTEA 2JOJA 1N2DA 2WCMA 3OGNA 2CTNA 5I2QA 1K96A 2ZN9A 3AKAA 3CZ0A 3OX5A 3QMEA 2MLEC 1S36A 2WCEA 3VGOA 2KQYA 4PHKA 1XVJA 1B7TZ 1OOFA 2L2EA 3KO0A 3O4YA 4PALA 3OB1B 1CMFA 3DVJA 4NDDA 2M9GA 1QVIY 2Y1NA 4ORBB 1QIWA 1XK4C 3DVMA 2F2PA 3LL8B 4GAOA 5J3XA 1K9UA 1WDCB 2LUCA 2M7NA 2JULA 1MXLC 1ZUZA 1OMDA 1S26D 3AAKA 4N5XA 1MR8A 5KU1A 1WRZA 2NXQA 2QEVA 3AAJA 2AMIA 3L4AA 1UHHA 1YUSA 2WCHA 4PHJA 3B86A 2QACA 4PT1A 1M39A 5D3OA 2L98A 2L50A 2M97A 5AERA 1DQEA 3PM8A 4ORAB 1S5GZ 1DC1A 1CLBA 1BF5A 1QTXA 1OOJA 1TWOA 2MJWB 3FE9A 4GFTA 1XA5A 2GGMA 5I8NA 3VRNA 3I5HB 1K9PA 3MSEB 5PALA 2M8UA 1CNPA 1NCZA 2LHLA 3O6BA 1NWDA 5EL2A 3B87A 3FS7A 4YGAA 2KAYA
chains in the Genus database with same CATH topology
3I5FB 1H8BA 3AKBA 3SG5A 1CFPA 1B7TY 1S6CA 2JNXA 2BCAA 1DT7B 3I5IB 4HSZA 4JWQA 1HT9A 1AJ5A 1DVIA 1XYDA 2KSPA 4PE1A 3IQQA 4MVFA 2LP3A 1PVAA 3EK4A 1QXPA 2L4IA 1A03A 1IWQA 3TUYC 3BUOB 1JSAA 2BCXA 1NCYA 4UPGA 4D1EA 2KFFA 1EL4A 4ICBA 3E3RA 4WRIA 1WDCC 1ZACA 2K0JA 1S1EA 2KBMA 1OE9B 1KFUL 5GQQC 2KYCA 5DKRA 3OB2B 1PALA 4OVNF 3K21A 2KI6C 4BY4A 3OHMB 4I5JA 1R6PA 2JRFA 2KI6D 1U5IA 1SW8A 1S5GY 1A29A 1SPYA 2JXLA 2JC2A 1J7RA 3BUMB 1BR1B 2JZIA 1IQ3A 2WORA 1W7IB 3NSOA 1W7JB 4C0LA 1SCVA 1DJZA 1OZSA 5HKWA 4IL1A 1XFWO 2MLFC 4MN0A 1G8IA 3CR5X 1QLKA 4C0KA 2FCDA 3I5FC 4DS7A 1BLQA 1CDPA 2BL0B 2NZ0A 1DJXA 1BOCA 2LVJA 3KF9A 3CR4X 1IRJA 1QVIZ 3I5IC 1XFUO 2EC6B 4DRWA 1WRLA 4ETOA 1PRWA 3ICBA 2FJUB 2KQ6A 1J55A 1LXFC 2A4JA 3BXKA 3DF0B 3PLFB 1PULA 2M7LA 2KNEA 1K95A 1G33A 1M46A 3BUWB 1NCXA 1SKTA 2SASA 1RWYA 2JT3A 1IQ5A 1J7OA 1TRFA 1BG1A 1RROA 3EVRA 2LAPA 3A4UB 3I5GC 1LVCD 1K9KA 2FOTA 4JQ0D 1DF0B 1NP8A 1CFFA 3CS1A 1SNLA 1GQMA 1YR5A 1IKUA 4XJKA 2E6WA 2LLSA 2KFGA 4MRYA 1Y1UA 5JJGA 2M0RA 1JFKA 2LLTA 1KWOB 3CR2A 3QRXA 5F6TA 2ZNDA 5BPJA 3GOFA 1GJYA 3PATA 4DIRA 3WXAA 4Q04A 1IJ5A 4P5OE 1UUSA 1F71A 1JF0A 5K89A 1DMOA 1BJFA 1TCOB 1CDMA 3BOWA 2JU0A 4PCWA 4HRGA 1S3PA 2MRDA 4YGEB 1JWDA 2PSRA 5AANA 1WY9A 4OV2A 1L2OB 1IH0A 1A75B 2V53A 1CFCA 1SCMB 2BL0C 3PSRA 5I2OA 3TUYB 1ZMZA 1BR4B 3EKHA 1JUOA 2AAOA 1IGVA 2EC6C 2HETA 1Y1AA 1NX2A 1QV1A 1AK8A 3FWCA 2K7DA 4C0JA 4DCKA 2E30A 5HYDA 1RJVA 3RM1A 4CLNA 4GBAA 3DVKA 1XK4A 2Y1MA 4MLWA 1A4PA 4GUKA 1DJWA 2BECA 4GGFC 4QJ3B 2LVKA 3ZWHA 2KGBC 2KOTA 5D7FA 1KK8B 1V1FA 4QJ5B 1H4BA 4JPZB 2LC5A 2LV7A 1OZOA 2LMUA 1NX3A 1UHNA 1KWOC 1NX0A 3KPXA 1XFYO 1NUBA 1LA0A 2HQWA 1DTLA 4XYNA 2FCEA 4M2OA 1DGUA 2KHNA 2IS9A 1A2XA 1AHRA 2ZRSA 4FQOA 1CDNA 1E8AA 2LVIA 2F3ZA 3TDUA 1L2OC 5TNCA 5HKYA 1SCMC 2M29A 1YURA 1M63B 2F33A 2LM5A 4BY5A 4I5LB 1DGVA 2LCPA 4PE7A 2I94A 2JQ6A 1B8RA 2K2AA 3WNXB 4CIDA 1QATA 3I5GB 1SR6B 5CSFA 4PDZA 1M45A 1MWNA 2KFHA 4N1GA 2O5GA 3PFVA 1C7WA 2KYFA 5FYXA 1LKJA 2L0PA 2EHBA 2ZN8A 1K93D 3D0YB 1TNXA 1TOPA 4N1FA 5AXIA 1LA3A 2ISDA 4YRUA 1KK8C 2G2BA 1PSBA 2OS8B 1JFJA 1HQVA 1YTZC 1CDLA 2BBMA 2OTGB 3JVTB 5JOLA 1TCFA 2H61A 5G08A 4QJ4B 4MZKA 1F55A 2KAXA 4YGCB 2NCOA 1YX7A 4A4BA 1JF2A 1ZFSA 1YVHA 2ZNEA 3GK4X 3H4SE 1SK6D 1B8LA 1WLMA 2JXCA 1EH2A 2M1KB 5CSNA 4I5KA 1F54A 3CLNA 1TTXA 5HLVA 5CSJA 3DVEA 2F3YA 1XFVO 2M1UA 2KAVA 1QJTA 4GNKB 1UHKA 4E68A 3FIAA 1R2UA 2BE4A 1IG5A 1OSAA 1XO5A 1J7QA 1RTP1 4MZJA 3SG7A 5I2LA 2K7BA 3PN7B 3EVUA 1RFJA 3SG6A 2JNFA 1SR6C 1YX8A 4NDBA 1CFDA 3RLZA 1QX7A 2BKHB 1CLLA 2TN4A 1VRKA 2KI4C 4GGNA 1QLSA 2JT0A 3CGAA 2HPSA 1QIVA 3NSIA 2Q4UA 1BMOA 3EK8A 2ZKMX 4AQJA 3GK2A 2K7CA 1NX1A 2OS8C 2R2IA 2ZRTA 2MBXA 1S6IA 2COLB 3BYAA 2OTGC 3CTNA 3JVTC 3SG4A 5CSIA 1QX5B 1IJ6A 2I2RE 1MF8B 1SBJA 3SJSA 2JWWA 1J1EA 1F8HA 4I5NB 3A8RA 3O78A 1KSMA 1GGZA 2RGIA 2LMVA 1NSHA 1K90D 3D10A 1Y6WA 2LE9B 1QV0A 1J1DA 3SG2A 1L7ZA 1BU3A 3O2PA 3VRQA 1SY9A 5DKNA 3HX4A 2CCMA 2M3WA 1UHIA 2B1UA 1KFXS 1ZOTB 4NQGA 3OP0A 5HLOA 1CMGA 1M31A 1QS7A 1SL9A 1TNWA 1FW4A 4OCIA 1CTRA 4ORCB 3C1VA 3EVVA 2ZFDA 4ZCUA 3BUNB 2I18A 4AQIA 1BT6A 3JTDC 3NSLA 2MA2A 1B8CA 1RK9A 4ZCVA 1MXEA 3PN7C 3GK1A 3F45A 1K2HA 2LHIA 3CZTX 3LK0A 1JC2A 4PHMA 1CB1A 3OX6A 5KSZA 1NPQA 3DF0A 3FWBA 1U5IB 4USLA 5KTYA 2K2FA 2BCBA 1MUXA 2K61A 2BE6A 1KK7Y 1QX2A 2MHHA 2LUXA 2QPTA 2WC8A 4M2PA 4WQ3A 1UWOA 2F8PA 3TS5B 1YRTB 1N65A 1EG4A 4GGFA 1LINA 4PE0A 2G9BA 1B1GA 1FF1A 1DF0A 1XFXO 1OMVA 3DD4A 1KQVA 1NYAA 3BQ3A 1Y1XA 1KFUS 2L51A 2JTTA 1JBAA 2PVBA 2MAZA 1KFXL 5DKQA 1ALWA 4WQ2A 2LMTA 2EGDA 1YVLA 1DJIA 2WCFA 1N0YA 2CNPA 2K7OA 1YUUA 4DUQA 2GV5A 5CPVA 1PSRA 1WLZA 2BBNA 3VROA 1J7PA 1B47A 1DJHA 1OMRA 2NLNA 2PRUA 4GPLB 4U8DA 2KDHA 1PVBA 3CWGA 3LCPC 1AP4A 1FPWA 1TNQA 1A75A 2CT9A 4YI8A 1TN4A 1MHOA 2WOSA 1EJ3A 1F4QA 2LP2A 1B4CA 1AJ4A 2KGRA 2KI4B 4P2YB 3SIBA 1KQMB 2JTZA 2P6BB 3M0WA 1S6JA 3IQOA 4XJKB 3SIAA 1SMGA 2HQ8A 1B9AA 1C07A 1SYMA 1X02A 2LNKA 4CPVA 3IF7A 4MRXA 1G4YR 1Q80A 2WNDA 4MZLA 3SG3A 3BUXB 1D1OA 4MEWA 1NIWA 4YI9A 1CKKA 1C7VA 1FI6A 1QASA 2PALA 3TS5C 1RECA 4HRHA 2D8NA 2PMYA 3BOWB 3NSKA 3WHUB 5AFPA 1UP5A 2H61C 1MQ1A 1GGWA 3WHTB 1AVSA 1EG3A 1ALVA 1YRUB 1BODA 5D69A 1FBVA 2WCBA 2M49B 2LLUA 3LK1A 5IBWA 2K8MB 3EK7A 3KEVA 1KCYA 4YBHB 4PHNA 2JPTA 4FTGA 2I7AA 4MBEA 1DJYA 2KBIA 5ER5A 4OR9B 4AOMA 1CLMA 1V1GA 2HF5A 2OPOA 5B8IB 3VRRA 4A4CA 5AEQA 3I5HC 1YUTA 2CBLA 2O60A 2L4HA 2Q91A 1UURA 1TIZA 4YGDB 1AUIB 2SCPA 1PK0D 3HCMA 3JTDB 4L9MA 4NDCA 5HKZA 4R1EA 1OQPA 2L5XB 3PALA 3ZNIA 2DOQA 2VRGA 2BKIB 2CXJA 3KHEA 1FI5A 3VRPA 2NCPA 4OKHA 1F4OA 4MSPA 2AUCA 4YGBB 2F2OA 2Y5IA 1XFZO 1TNPA 1KQMC 2Y4QA 1CM4A 4PE4A 1CM1A 4M2QA 1KK7Z 4TNCA 3NXAA 1DJGA 3TDZA 1UHJA 4CFRA 2GGZA 3EKJA 3LLEA 1WRKA 2PASA 1KSOA 1K94A 2H2KA 1EXRA 1SL7A 4HREE 4F0ZB 4CFQA 2JT8A 1F70A 1Y0VH 3D0YA 1SRAA 1K8UA 3TDIA 1SL8A 5ER4X 2LVVA 2LANA 1ODBA 2JOJA 1N2DA 2CTNA 5I2QA 1K96A 2ZN9A 3AKAA 3OX5A 2MLEC 1S36A 2WCEA 3VGOA 2KQYA 4PHKA 1XVJA 1B7TZ 2L2EA 3KO0A 3O4YA 4PALA 3OB1B 1CMFA 3DVJA 4NDDA 2M9GA 1QVIY 2Y1NA 4ORBB 1QIWA 1XK4C 3DVMA 2F2PA 3LL8B 4GAOA 5J3XA 1K9UA 1WDCB 2LUCA 2M7NA 2JULA 1MXLC 1ZUZA 1OMDA 1S26D 3AAKA 4N5XA 1MR8A 5KU1A 1WRZA 2NXQA 3AAJA 2AMIA 1UHHA 1YUSA 4PHJA 2QACA 1M39A 2L98A 2L50A 2M97A 5AERA 3PM8A 4ORAB 1S5GZ 1CLBA 1BF5A 1QTXA 1OOJA 2MJWB 4GFTA 1XA5A 2GGMA 5I8NA 3VRNA 3I5HB 1K9PA 3MSEB 5PALA 2M8UA 1CNPA 1NCZA 2LHLA 3O6BA 1NWDA 3TZ1A 3FS7A 4YGAA 2KAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5F B;  1H8B A;  3AKB A;  3SG5 A;  1CFP A;  1B7T Y;  1S6C A;  2JNX A;  2BCA A;  1DT7 B;  3I5I B;  4HSZ A;  4JWQ A;  1HT9 A;  1AJ5 A;  1DVI A;  1XYD A;  2KSP A;  4PE1 A;  3IQQ A;  4MVF A;  2LP3 A;  1PVA A;  3EK4 A;  1QXP A;  2L4I A;  1A03 A;  1IWQ A;  3TUY C;  3BUO B;  1JSA A;  2BCX A;  1NCY A;  4UPG A;  4D1E A;  2KFF A;  1EL4 A;  4ICB A;  3E3R A;  4WRI A;  1WDC C;  1ZAC A;  2K0J A;  1S1E A;  2KBM A;  1OE9 B;  1KFU L;  5GQQ C;  2KYC A;  5DKR A;  3OB2 B;  1PAL A;  4OVN F;  3K21 A;  2KI6 C;  4BY4 A;  3OHM B;  4I5J A;  1R6P A;  2JRF A;  2KI6 D;  1U5I A;  1SW8 A;  1S5G Y;  1A29 A;  1SPY A;  2JXL A;  2JC2 A;  1J7R A;  3BUM B;  1BR1 B;  2JZI A;  1IQ3 A;  2WOR A;  1W7I B;  3NSO A;  1W7J B;  4C0L A;  1SCV A;  1DJZ A;  1OZS A;  5HKW A;  4IL1 A;  1XFW O;  2MLF C;  4MN0 A;  1G8I A;  3CR5 X;  1QLK A;  4C0K A;  2FCD A;  3I5F C;  4DS7 A;  1BLQ A;  1CDP A;  2BL0 B;  2NZ0 A;  1DJX A;  1BOC A;  2LVJ A;  3KF9 A;  3CR4 X;  1IRJ A;  1QVI Z;  3I5I C;  1XFU O;  2EC6 B;  4DRW A;  1WRL A;  4ETO A;  1PRW A;  3ICB A;  2FJU B;  2KQ6 A;  1J55 A;  1LXF C;  2A4J A;  3BXK A;  3DF0 B;  3PLF B;  1PUL A;  2M7L A;  2KNE A;  1K95 A;  1G33 A;  1M46 A;  3BUW B;  1NCX A;  1SKT A;  2SAS A;  1RWY A;  2JT3 A;  1IQ5 A;  1J7O A;  1TRF A;  1BG1 A;  1RRO A;  3EVR A;  2LAP A;  3A4U B;  3I5G C;  1LVC D;  1K9K A;  2FOT A;  4JQ0 D;  1DF0 B;  1NP8 A;  1CFF A;  3CS1 A;  1SNL A;  1GQM A;  1YR5 A;  1IKU A;  4XJK A;  2E6W A;  2LLS A;  2KFG A;  4MRY A;  1Y1U A;  5JJG A;  2M0R A;  1JFK A;  2LLT A;  1KWO B;  3CR2 A;  3QRX A;  5F6T A;  2ZND A;  5BPJ A;  3GOF A;  1GJY A;  3PAT A;  4DIR A;  3WXA A;  4Q04 A;  1IJ5 A;  4P5O E;  1UUS A;  1F71 A;  1JF0 A;  5K89 A;  1DMO A;  1BJF A;  1TCO B;  1CDM A;  3BOW A;  2JU0 A;  4PCW A;  4HRG A;  1S3P A;  2MRD A;  4YGE B;  1JWD A;  2PSR A;  5AAN A;  1WY9 A;  4OV2 A;  1L2O B;  1IH0 A;  1A75 B;  2V53 A;  1CFC A;  1SCM B;  2BL0 C;  3PSR A;  5I2O A;  3TUY B;  1ZMZ A;  1BR4 B;  3EKH A;  1JUO A;  2AAO A;  1IGV A;  2EC6 C;  2HET A;  1Y1A A;  1NX2 A;  1QV1 A;  1AK8 A;  3FWC A;  2K7D A;  4C0J A;  4DCK A;  2E30 A;  5HYD A;  1RJV A;  3RM1 A;  4CLN A;  4GBA A;  3DVK A;  1XK4 A;  2Y1M A;  4MLW A;  1A4P A;  4GUK A;  1DJW A;  2BEC A;  4GGF C;  4QJ3 B;  2LVK A;  3ZWH A;  2KGB C;  2KOT A;  5D7F A;  1KK8 B;  1V1F A;  4QJ5 B;  1H4B A;  4JPZ B;  2LC5 A;  2LV7 A;  1OZO A;  2LMU A;  1NX3 A;  1UHN A;  1KWO C;  1NX0 A;  3KPX A;  1XFY O;  1NUB A;  1LA0 A;  2HQW A;  1DTL A;  4XYN A;  2FCE A;  4M2O A;  1DGU A;  2KHN A;  2IS9 A;  1A2X A;  1AHR A;  2ZRS A;  4FQO A;  1CDN A;  1E8A A;  2LVI A;  2F3Z A;  3TDU A;  1L2O C;  5TNC A;  5HKY A;  1SCM C;  2M29 A;  1YUR A;  1M63 B;  2F33 A;  2LM5 A;  4BY5 A;  4I5L B;  1DGV A;  2LCP A;  4PE7 A;  2I94 A;  2JQ6 A;  1B8R A;  2K2A A;  3WNX B;  4CID A;  1QAT A;  3I5G B;  1SR6 B;  5CSF A;  4PDZ A;  1M45 A;  1MWN A;  2KFH A;  4N1G A;  2O5G A;  3PFV A;  1C7W A;  2KYF A;  5FYX A;  1LKJ A;  2L0P A;  2EHB A;  2ZN8 A;  1K93 D;  3D0Y B;  1TNX A;  1TOP A;  4N1F A;  5AXI A;  1LA3 A;  2ISD A;  4YRU A;  1KK8 C;  2G2B A;  1PSB A;  2OS8 B;  1JFJ A;  1HQV A;  1YTZ C;  1CDL A;  2BBM A;  2OTG B;  3JVT B;  5JOL A;  1TCF A;  2H61 A;  5G08 A;  4QJ4 B;  4MZK A;  1F55 A;  2KAX A;  4YGC B;  2NCO A;  1YX7 A;  4A4B A;  1JF2 A;  1ZFS A;  1YVH A;  2ZNE A;  3GK4 X;  3H4S E;  1SK6 D;  1B8L A;  1WLM A;  2JXC A;  1EH2 A;  2M1K B;  5CSN A;  4I5K A;  1F54 A;  3CLN A;  1TTX A;  5HLV A;  5CSJ A;  3DVE A;  2F3Y A;  1XFV O;  2M1U A;  2KAV A;  1QJT A;  4GNK B;  1UHK A;  4E68 A;  3FIA A;  1R2U A;  2BE4 A;  1IG5 A;  1OSA A;  1XO5 A;  1J7Q A;  1RTP 1;  4MZJ A;  3SG7 A;  5I2L A;  2K7B A;  3PN7 B;  3EVU A;  1RFJ A;  3SG6 A;  2JNF A;  1SR6 C;  1YX8 A;  4NDB A;  1CFD A;  3RLZ A;  1QX7 A;  2BKH B;  1CLL A;  2TN4 A;  1VRK A;  2KI4 C;  4GGN A;  1QLS A;  2JT0 A;  3CGA A;  2HPS A;  1QIV A;  3NSI A;  2Q4U A;  1BMO A;  3EK8 A;  2ZKM X;  4AQJ A;  3GK2 A;  2K7C A;  1NX1 A;  2OS8 C;  2R2I A;  2ZRT A;  2MBX A;  1S6I A;  2COL B;  3BYA A;  2OTG C;  3CTN A;  3JVT C;  3SG4 A;  5CSI A;  1QX5 B;  1IJ6 A;  2I2R E;  1MF8 B;  1SBJ A;  3SJS A;  2JWW A;  1J1E A;  1F8H A;  4I5N B;  3A8R A;  3O78 A;  1KSM A;  1GGZ A;  2RGI A;  2LMV A;  1NSH A;  1K90 D;  3D10 A;  1Y6W A;  2LE9 B;  1QV0 A;  1J1D A;  3SG2 A;  1L7Z A;  1BU3 A;  3O2P A;  3VRQ A;  1SY9 A;  5DKN A;  3HX4 A;  2CCM A;  2M3W A;  1UHI A;  2B1U A;  1KFX S;  1ZOT B;  4NQG A;  3OP0 A;  5HLO A;  1CMG A;  1M31 A;  1QS7 A;  1SL9 A;  1TNW A;  1FW4 A;  4OCI A;  1CTR A;  4ORC B;  3C1V A;  3EVV A;  2ZFD A;  4ZCU A;  3BUN B;  2I18 A;  4AQI A;  1BT6 A;  3JTD C;  3NSL A;  2MA2 A;  1B8C A;  1RK9 A;  4ZCV A;  1MXE A;  3PN7 C;  3GK1 A;  3F45 A;  1K2H A;  2LHI A;  3CZT X;  3LK0 A;  1JC2 A;  4PHM A;  1CB1 A;  3OX6 A;  5KSZ A;  1NPQ A;  3DF0 A;  3FWB A;  1U5I B;  4USL A;  5KTY A;  2K2F A;  2BCB A;  1MUX A;  2K61 A;  2BE6 A;  1KK7 Y;  1QX2 A;  2MHH A;  2LUX A;  2QPT A;  2WC8 A;  4M2P A;  4WQ3 A;  1UWO A;  2F8P A;  3TS5 B;  1YRT B;  1N65 A;  1EG4 A;  4GGF A;  1LIN A;  4PE0 A;  2G9B A;  1B1G A;  1FF1 A;  1DF0 A;  1XFX O;  1OMV A;  3DD4 A;  1KQV A;  1NYA A;  3BQ3 A;  1Y1X A;  1KFU S;  2L51 A;  2JTT A;  1JBA A;  2PVB A;  2MAZ A;  1KFX L;  5DKQ A;  1ALW A;  4WQ2 A;  2LMT A;  2EGD A;  1YVL A;  1DJI A;  2WCF A;  1N0Y A;  2CNP A;  2K7O A;  1YUU A;  4DUQ A;  2GV5 A;  5CPV A;  1PSR A;  1WLZ A;  2BBN A;  3VRO A;  1J7P A;  1B47 A;  1DJH A;  1OMR A;  2NLN A;  2PRU A;  4GPL B;  4U8D A;  2KDH A;  1PVB A;  3CWG A;  3LCP C;  1AP4 A;  1FPW A;  1TNQ A;  1A75 A;  2CT9 A;  4YI8 A;  1TN4 A;  1MHO A;  2WOS A;  1EJ3 A;  1F4Q A;  2LP2 A;  1B4C A;  1AJ4 A;  2KGR A;  2KI4 B;  4P2Y B;  3SIB A;  1KQM B;  2JTZ A;  2P6B B;  3M0W A;  1S6J A;  3IQO A;  4XJK B;  3SIA A;  1SMG A;  2HQ8 A;  1B9A A;  1C07 A;  1SYM A;  1X02 A;  2LNK A;  4CPV A;  3IF7 A;  4MRX A;  1G4Y R;  1Q80 A;  2WND A;  4MZL A;  3SG3 A;  3BUX B;  1D1O A;  4MEW A;  1NIW A;  4YI9 A;  1CKK A;  1C7V A;  1FI6 A;  1QAS A;  2PAL A;  3TS5 C;  1REC A;  4HRH A;  2D8N A;  2PMY A;  3BOW B;  3NSK A;  3WHU B;  5AFP A;  1UP5 A;  2H61 C;  1MQ1 A;  1GGW A;  3WHT B;  1AVS A;  1EG3 A;  1ALV A;  1YRU B;  1BOD A;  5D69 A;  1FBV A;  2WCB A;  2M49 B;  2LLU A;  3LK1 A;  5IBW A;  2K8M B;  3EK7 A;  3KEV A;  1KCY A;  4YBH B;  4PHN A;  2JPT A;  4FTG A;  2I7A A;  4MBE A;  1DJY A;  2KBI A;  5ER5 A;  4OR9 B;  4AOM A;  1CLM A;  1V1G A;  2HF5 A;  2OPO A;  5B8I B;  3VRR A;  4A4C A;  5AEQ A;  3I5H C;  1YUT A;  2CBL A;  2O60 A;  2L4H A;  2Q91 A;  1UUR A;  1TIZ A;  4YGD B;  1AUI B;  2SCP A;  1PK0 D;  3HCM A;  3JTD B;  4L9M A;  4NDC A;  5HKZ A;  4R1E A;  1OQP A;  2L5X B;  3PAL A;  3ZNI A;  2DOQ A;  2VRG A;  2BKI B;  2CXJ A;  3KHE A;  1FI5 A;  3VRP A;  2NCP A;  4OKH A;  1F4O A;  4MSP A;  2AUC A;  4YGB B;  2F2O A;  2Y5I A;  1XFZ O;  1TNP A;  1KQM C;  2Y4Q A;  1CM4 A;  4PE4 A;  1CM1 A;  4M2Q A;  1KK7 Z;  4TNC A;  3NXA A;  1DJG A;  3TDZ A;  1UHJ A;  4CFR A;  2GGZ A;  3EKJ A;  3LLE A;  1WRK A;  2PAS A;  1KSO A;  1K94 A;  2H2K A;  1EXR A;  1SL7 A;  4HRE E;  4F0Z B;  4CFQ A;  2JT8 A;  1F70 A;  1Y0V H;  3D0Y A;  1SRA A;  1K8U A;  3TDI A;  1SL8 A;  5ER4 X;  2LVV A;  2LAN A;  1ODB A;  2JOJ A;  1N2D A;  2CTN A;  5I2Q A;  1K96 A;  2ZN9 A;  3AKA A;  3OX5 A;  2MLE C;  1S36 A;  2WCE A;  3VGO A;  2KQY A;  4PHK A;  1XVJ A;  1B7T Z;  2L2E A;  3KO0 A;  3O4Y A;  4PAL A;  3OB1 B;  1CMF A;  3DVJ A;  4NDD A;  2M9G A;  1QVI Y;  2Y1N A;  4ORB B;  1QIW A;  1XK4 C;  3DVM A;  2F2P A;  3LL8 B;  4GAO A;  5J3X A;  1K9U A;  1WDC B;  2LUC A;  2M7N A;  2JUL A;  1MXL C;  1ZUZ A;  1OMD A;  1S26 D;  3AAK A;  4N5X A;  1MR8 A;  5KU1 A;  1WRZ A;  2NXQ A;  3AAJ A;  2AMI A;  1UHH A;  1YUS A;  4PHJ A;  2QAC A;  1M39 A;  2L98 A;  2L50 A;  2M97 A;  5AER A;  3PM8 A;  4ORA B;  1S5G Z;  1CLB A;  1BF5 A;  1QTX A;  1OOJ A;  2MJW B;  4GFT A;  1XA5 A;  2GGM A;  5I8N A;  3VRN A;  3I5H B;  1K9P A;  3MSE B;  5PAL A;  2M8U A;  1CNP A;  1NCZ A;  2LHL A;  3O6B A;  1NWD A;  3TZ1 A;  3FS7 A;  4YGA A;  2KAY A; 
#chains in the Genus database with same CATH topology
 3I5F B;  3S0E A;  1H8B A;  3AKB A;  3SG5 A;  1CFP A;  1B7T Y;  1S6C A;  2JNX A;  2BCA A;  1DT7 B;  3I5I B;  4HSZ A;  4JWQ A;  3R1O A;  1HT9 A;  1AJ5 A;  1DVI A;  3S0F A;  1XYD A;  2KSP A;  2WC5 A;  3IQQ A;  4MVF A;  2LP3 A;  4PE1 A;  1PVA A;  3EK4 A;  1QXP A;  2L4I A;  3O4X A;  1A03 A;  1IWQ A;  3TUY C;  3BUO B;  1JSA A;  2BCX A;  1NCY A;  4UPG A;  4D1E A;  1TUZ A;  1EL4 A;  2KFF A;  3BFB A;  4ICB A;  3E3R A;  4WRI A;  1WDC C;  1ZAC A;  2K0J A;  1S1E A;  2KBM A;  1OE9 B;  1KFU L;  5GQQ C;  2KYC A;  1OOG A;  5DKR A;  1DEL A;  3OB2 B;  4JD9 A;  1PAL A;  4OVN F;  3K21 A;  2KI6 C;  4BY4 A;  3OHM B;  4I5J A;  4INW A;  2YGU A;  1GM0 A;  1R6P A;  2JRF A;  2KI6 D;  1U5I A;  1SW8 A;  4FQT A;  1S5G Y;  1A29 A;  1SPY A;  5FI2 A;  2JXL A;  2QEO A;  2JC2 A;  3NGV A;  1J7R A;  3BUM B;  1BR1 B;  2JZI A;  1IQ3 A;  3NHI A;  2WOR A;  1W7I B;  3NSO A;  1W7J B;  4C0L A;  1SCV A;  1DJZ A;  1OZS A;  1LS8 A;  5HKW A;  4IL1 A;  1XFW O;  2MLF C;  4MN0 A;  1G8I A;  3PJI A;  3CR5 X;  1QLK A;  4C0K A;  2FCD A;  3I5F C;  1W9Z A;  4DS7 A;  1BLQ A;  1CDP A;  3DY9 A;  4IJ7 A;  2BL0 B;  2FJY A;  2NZ0 A;  1DJX A;  1BOC A;  1Z4H A;  2LVJ A;  3KF9 A;  1QWV A;  3CR4 X;  1IRJ A;  1QVI Z;  3I5I C;  1XFU O;  2EC6 B;  4DRW A;  1WRL A;  4ETO A;  1PRW A;  3ICB A;  2FJU B;  2KQ6 A;  3CDN A;  3R1V A;  1J55 A;  1LXF C;  1ORG A;  2A4J A;  3BXK A;  3DF0 B;  1PUL A;  3PLF B;  2M7L A;  2KNE A;  1K95 A;  1G33 A;  1IIO A;  1M46 A;  3BUW B;  1NCX A;  1SKT A;  2SAS A;  1RWY A;  2JT3 A;  1IQ5 A;  1J7O A;  1SSE B;  1TRF A;  1BG1 A;  1RRO A;  3EVR A;  2LAP A;  3A4U B;  3I5G C;  1LVC D;  1K9K A;  2FOT A;  4JQ0 D;  1DF0 B;  1NP8 A;  1CFF A;  3CS1 A;  1SNL A;  1GQM A;  1YR5 A;  1IKU A;  4XJK A;  1C3Z A;  2E6W A;  2KFG A;  2LLS A;  1Y1U A;  4MRY A;  5JJG A;  2P70 A;  2M0R A;  1JFK A;  2LLT A;  1KWO B;  3CR2 A;  3QRX A;  5F6T A;  2ZND A;  5BPJ A;  3GOF A;  1GJY A;  3PAT A;  4DIR A;  3R1P A;  3WXA A;  4Q04 A;  1IJ5 A;  4P5O E;  1UUS A;  1F71 A;  1JF0 A;  5K89 A;  1DMO A;  1BJF A;  1TCO B;  1CDM A;  3B6X A;  3BOW A;  2JU0 A;  4PCW A;  4HRG A;  1S3P A;  2MRD A;  4YGE B;  1JWD A;  2PSR A;  5AAN A;  2KLD A;  3CAB A;  5I94 A;  2QEH A;  1WY9 A;  2PYQ A;  1L2O B;  4OV2 A;  1XFR A;  3S0B A;  3V2L A;  1IH0 A;  1A75 B;  2V53 A;  1CFC A;  1SCM B;  2BL0 C;  3PSR A;  5I2O A;  3TUY B;  1ZMZ A;  1BR4 B;  3EKH A;  3FE8 A;  1JUO A;  2AAO A;  1IGV A;  2EC6 C;  2HET A;  1Y1A A;  1NX2 A;  1QV1 A;  1AK8 A;  3FWC A;  2K60 A;  2K7D A;  4C0J A;  4DCK A;  2E30 A;  5HYD A;  1RJV A;  3RM1 A;  4CLN A;  4GBA A;  3DVK A;  3NHT A;  1XK4 A;  2Y1M A;  4MLW A;  1A4P A;  4GUK A;  1DJW A;  2BEC A;  4GGF C;  4QJ3 B;  2LVK A;  3ZWH A;  2KGB C;  2KOT A;  5D7F A;  1KK8 B;  1V1F A;  3SS5 A;  4QJ5 B;  4JPZ B;  3K1E A;  2LC5 A;  2LV7 A;  1OZO A;  2LMU A;  1NX3 A;  1UHN A;  1KWO C;  1NX0 A;  2L5Y A;  3KPX A;  3CZ2 A;  3UO9 A;  1XFY O;  1NUB A;  1LA0 A;  2HQW A;  1DTL A;  4KYN A;  4XYN A;  2FCE A;  4M2O A;  1Z2C B;  1DGU A;  2KHN A;  2IS9 A;  1A2X A;  1AHR A;  2WCJ A;  2ZRS A;  1OOI X;  1E8A A;  4FQO A;  1CDN A;  2LVI A;  2F3Z A;  3TDU A;  1L2O C;  5TNC A;  5HKY A;  1SCM C;  4OZD A;  2M29 A;  1YUR A;  1M63 B;  2F33 A;  2LM5 A;  3CZ1 A;  3IVT A;  4I5L B;  4BY5 A;  3TZ1 A;  1DGV A;  2LCP A;  4PE7 A;  2I94 A;  2JQ6 A;  1B8R A;  2K2A A;  3DXL A;  3WNX B;  4CID A;  1QAT A;  3I5G B;  1SR6 B;  5CSF A;  4PDZ A;  1M45 A;  1MWN A;  2KFH A;  4N1G A;  2O5G A;  3PFV A;  1C7W A;  2KYF A;  5FYX A;  1LKJ A;  3D75 A;  2L0P A;  2EHB A;  2ZN8 A;  1K93 D;  3D0Y B;  3N7H A;  1TNX A;  1TOP A;  4N1F A;  5AXI A;  1LA3 A;  2ISD A;  4YRU A;  1KK8 C;  2G2B A;  1PSB A;  2OS8 B;  1JFJ A;  1HQV A;  1YTZ C;  1CDL A;  2BBM A;  2OTG B;  3SS3 A;  3JVT B;  5JOL A;  1TCF A;  2H61 A;  5G08 A;  4QJ4 B;  4MZK A;  1F55 A;  2KAX A;  4YGC B;  2NCO A;  1YX7 A;  4A4B A;  3B7A A;  1JF2 A;  1ZFS A;  2WCL A;  1YVH A;  2ZNE A;  3GK4 X;  3H4S E;  1SK6 D;  1B8L A;  1OOH A;  1WLM A;  2JXC A;  1EH2 A;  2M1K B;  5CSN A;  4I5K A;  1F54 A;  3CLN A;  1TTX A;  5HLV A;  5CSJ A;  3DVE A;  2F3Y A;  1XFV O;  2M1U A;  2KAV A;  3BJH A;  1QJT A;  4GNK B;  3L47 A;  1UHK A;  4E68 A;  3FIA A;  1R2U A;  2BE4 A;  1XO5 A;  1IG5 A;  1OSA A;  2JPO A;  1J7Q A;  1RTP 1;  4MZJ A;  3SG7 A;  5I2L A;  2H8V A;  2K7B A;  3PN7 B;  3EVU A;  1RFJ A;  3SG6 A;  2JNF A;  1SR6 C;  1YX8 A;  4NDB A;  1CFD A;  3RLZ A;  1QX7 A;  2BKH B;  3DYE A;  1CLL A;  3S0A A;  2TN4 A;  1VRK A;  2KI4 C;  4GGN A;  1QLS A;  2QDI A;  2JT0 A;  3CGA A;  2HPS A;  1QIV A;  3NSI A;  2Q4U A;  1BMO A;  3EK8 A;  2ZKM X;  4AQJ A;  3GK2 A;  2K7C A;  1NX1 A;  2OS8 C;  2R2I A;  2ZRT A;  2MBX A;  1S6I A;  2COL B;  3BYA A;  2OTG C;  3CTN A;  3JVT C;  3SG4 A;  5CSI A;  1QX5 B;  1IJ6 A;  2I2R E;  1DEK A;  1MF8 B;  1SBJ A;  1TUJ A;  3B88 A;  3SJS A;  2JWW A;  1J1E A;  1F8H A;  4I5N B;  3A8R A;  3O78 A;  1KSM A;  1GGZ A;  2RGI A;  3UNW A;  2LMV A;  2ERB A;  1NSH A;  1K90 D;  3D10 A;  1Y6W A;  2LE9 B;  3S0G A;  1QV0 A;  1J1D A;  3SG2 A;  1L7Z A;  1BU3 A;  3O2P A;  3VRQ A;  1SY9 A;  5DKN A;  3HX4 A;  2CCM A;  2M3W A;  1UHI A;  2B1U A;  1KFX S;  1H4B A;  3BFA A;  1ZOT B;  4NQG A;  3OP0 A;  5HLO A;  1CMG A;  1M31 A;  1QS7 A;  1SL9 A;  1TNW A;  5DIC A;  4INX A;  1FW4 A;  4OCI A;  1CTR A;  4ORC B;  3C1V A;  3D77 A;  3EVV A;  2ZFD A;  4ZCU A;  3BUN B;  2I18 A;  4AQI A;  1BT6 A;  3JTD C;  3NSL A;  2MA2 A;  1B8C A;  1RK9 A;  4ZCV A;  1MXE A;  3PN7 C;  3GK1 A;  3F45 A;  1K2H A;  2LHI A;  3CZT X;  3LK0 A;  1JC2 A;  4PHM A;  1CB1 A;  3OX6 A;  5KSZ A;  1NPQ A;  3DF0 A;  3FWB A;  1U5I B;  3D76 A;  4USL A;  5KTY A;  2K2F A;  2BCB A;  1MUX A;  2K61 A;  2BE6 A;  1KK7 Y;  1QX2 A;  2MHH A;  2LUX A;  2QPT A;  2WC8 A;  4M2P A;  4WQ3 A;  1UWO A;  2F8P A;  3TS5 B;  5HL1 A;  1YRT B;  1N65 A;  1EG4 A;  4GGF A;  1LIN A;  4PE0 A;  2G9B A;  1B1G A;  1FF1 A;  1DF0 A;  1XFX O;  1T14 A;  1OMV A;  3DD4 A;  1KQV A;  1NYA A;  3BQ3 A;  1Y1X A;  1KFU S;  2L51 A;  2JTT A;  1JBA A;  2PVB A;  2MAZ A;  1KFX L;  5DKQ A;  1ALW A;  1P28 A;  4WQ2 A;  2LMT A;  3SS4 A;  2EGD A;  1YVL A;  1DJI A;  2KLE A;  1N0Y A;  2WCF A;  2CNP A;  2K7O A;  1YUU A;  4DUQ A;  2GV5 A;  5CPV A;  1PSR A;  1WLZ A;  2BBN A;  3VRO A;  1J7P A;  1B47 A;  1DJH A;  1OMR A;  2NLN A;  2PRU A;  4GPL B;  4U8D A;  2KDH A;  1PVB A;  3CWG A;  3LCP C;  1AP4 A;  1FPW A;  1TNQ A;  1A75 A;  2CT9 A;  5FI7 A;  4YI8 A;  3D78 A;  1TN4 A;  1MHO A;  2WOS A;  1EJ3 A;  1F4Q A;  2LP2 A;  1B4C A;  1OW4 A;  1AJ4 A;  2KGR A;  2KI4 B;  4P2Y B;  3BFH A;  1KQM B;  2JTZ A;  2P6B B;  3SIB A;  3M0W A;  1S6J A;  3IQO A;  4XJK B;  3SIA A;  1SMG A;  2PQL A;  2HQ8 A;  1B9A A;  1C07 A;  1SYM A;  1X02 A;  2LNK A;  4CPV A;  3IF7 A;  4MRX A;  1G4Y R;  1Q80 A;  2WND A;  4MZL A;  3SG3 A;  3BUX B;  1D1O A;  4MEW A;  1NIW A;  4YI9 A;  3RZS A;  1CKK A;  1C7V A;  1FI6 A;  1QAS A;  2PAL A;  1C3Y A;  3TS5 C;  1REC A;  4HRH A;  2D8N A;  2PMY A;  3BOW B;  3NSK A;  3Q8I A;  3WHU B;  5AFP A;  1UP5 A;  2H61 C;  1MQ1 A;  1GGW A;  3WHT B;  1AVS A;  1EG3 A;  1ALV A;  2QEB A;  1YRU B;  2BAP A;  2WC6 A;  5D69 A;  1BOD A;  3DZT A;  1FBV A;  2P71 A;  2M49 B;  2LLU A;  2WCB A;  3LK1 A;  5IBW A;  2K8M B;  3EK7 A;  3KEV A;  1KCY A;  4YBH B;  4PHN A;  2JPT A;  4FTG A;  2I7A A;  4MBE A;  1DJY A;  2KBI A;  2BNX A;  3D73 A;  4OR9 B;  5ER5 A;  4AOM A;  1CLM A;  1V1G A;  2HF5 A;  2OPO A;  5B8I B;  3VRR A;  4A4C A;  5AEQ A;  3I5H C;  1YUT A;  2CBL A;  2O60 A;  2L4H A;  2Q91 A;  1UUR A;  1TIZ A;  4JKT A;  4YGD B;  1AUI B;  2SCP A;  1PK0 D;  3HCM A;  3JTD B;  3L4L A;  4L9M A;  3CYZ A;  4NDC A;  5HKZ A;  4R1E A;  1OQP A;  2L5X B;  3PAL A;  3ZNI A;  2KPH A;  2DOQ A;  2VRG A;  2BKI B;  2CXJ A;  3KHE A;  1FI5 A;  3VRP A;  2NCP A;  4OKH A;  1F4O A;  4MSP A;  3VB1 A;  2AUC A;  3R72 A;  2F2O A;  2Y5I A;  1XFZ O;  1TNP A;  1KQM C;  3D74 A;  4YGB B;  5FI6 A;  2Y4Q A;  3PM2 A;  1CM4 A;  4PE4 A;  1CM1 A;  3EG5 B;  4M2Q A;  1KK7 Z;  4TNC A;  3NXA A;  1DJG A;  3TDZ A;  1UHJ A;  4CFR A;  2GGZ A;  3EKJ A;  3LLE A;  1WRK A;  2PAS A;  1KSO A;  1K94 A;  2H2K A;  4F7F A;  2L2C A;  1EXR A;  1SL7 A;  4HRE E;  4F0Z B;  4CFQ A;  2JT8 A;  1F70 A;  1Y0V H;  3D0Y A;  3FE6 A;  1SRA A;  1K8U A;  3S0D A;  3TDI A;  1SL8 A;  2WCK A;  5ER4 X;  2LVV A;  3OBV A;  2LAN A;  1ODB A;  2GTE A;  2JOJ A;  1N2D A;  2WCM A;  3OGN A;  2CTN A;  5I2Q A;  1K96 A;  2ZN9 A;  3AKA A;  3CZ0 A;  3OX5 A;  3QME A;  2MLE C;  1S36 A;  2WCE A;  3VGO A;  2KQY A;  4PHK A;  1XVJ A;  1B7T Z;  1OOF A;  2L2E A;  3KO0 A;  3O4Y A;  4PAL A;  3OB1 B;  1CMF A;  3DVJ A;  4NDD A;  2M9G A;  1QVI Y;  2Y1N A;  4ORB B;  1QIW A;  1XK4 C;  3DVM A;  2F2P A;  3LL8 B;  4GAO A;  5J3X A;  1K9U A;  1WDC B;  2LUC A;  2M7N A;  2JUL A;  1MXL C;  1ZUZ A;  1OMD A;  1S26 D;  3AAK A;  4N5X A;  1MR8 A;  5KU1 A;  1WRZ A;  2NXQ A;  2QEV A;  3AAJ A;  2AMI A;  3L4A A;  1UHH A;  1YUS A;  2WCH A;  4PHJ A;  3B86 A;  2QAC A;  4PT1 A;  1M39 A;  5D3O A;  2L98 A;  2L50 A;  2M97 A;  5AER A;  1DQE A;  3PM8 A;  4ORA B;  1S5G Z;  1DC1 A;  1CLB A;  1BF5 A;  1QTX A;  1OOJ A;  1TWO A;  2MJW B;  3FE9 A;  4GFT A;  1XA5 A;  2GGM A;  5I8N A;  3VRN A;  3I5H B;  1K9P A;  3MSE B;  5PAL A;  2M8U A;  1CNP A;  1NCZ A;  2LHL A;  3O6B A;  1NWD A;  5EL2 A;  3B87 A;  3FS7 A;  4YGA A;  2KAY A; 
#chains in the Genus database with same CATH homology
 3I5F B;  1H8B A;  3AKB A;  3SG5 A;  1CFP A;  1B7T Y;  1S6C A;  2JNX A;  2BCA A;  1DT7 B;  3I5I B;  4HSZ A;  4JWQ A;  1HT9 A;  1AJ5 A;  1DVI A;  1XYD A;  2KSP A;  4PE1 A;  3IQQ A;  4MVF A;  2LP3 A;  1PVA A;  3EK4 A;  1QXP A;  2L4I A;  1A03 A;  1IWQ A;  3TUY C;  3BUO B;  1JSA A;  2BCX A;  1NCY A;  4UPG A;  4D1E A;  2KFF A;  1EL4 A;  4ICB A;  3E3R A;  4WRI A;  1WDC C;  1ZAC A;  2K0J A;  1S1E A;  2KBM A;  1OE9 B;  1KFU L;  5GQQ C;  2KYC A;  5DKR A;  3OB2 B;  1PAL A;  4OVN F;  3K21 A;  2KI6 C;  4BY4 A;  3OHM B;  4I5J A;  1R6P A;  2JRF A;  2KI6 D;  1U5I A;  1SW8 A;  1S5G Y;  1A29 A;  1SPY A;  2JXL A;  2JC2 A;  1J7R A;  3BUM B;  1BR1 B;  2JZI A;  1IQ3 A;  2WOR A;  1W7I B;  3NSO A;  1W7J B;  4C0L A;  1SCV A;  1DJZ A;  1OZS A;  5HKW A;  4IL1 A;  1XFW O;  2MLF C;  4MN0 A;  1G8I A;  3CR5 X;  1QLK A;  4C0K A;  2FCD A;  3I5F C;  4DS7 A;  1BLQ A;  1CDP A;  2BL0 B;  2NZ0 A;  1DJX A;  1BOC A;  2LVJ A;  3KF9 A;  3CR4 X;  1IRJ A;  1QVI Z;  3I5I C;  1XFU O;  2EC6 B;  4DRW A;  1WRL A;  4ETO A;  1PRW A;  3ICB A;  2FJU B;  2KQ6 A;  1J55 A;  1LXF C;  2A4J A;  3BXK A;  3DF0 B;  3PLF B;  1PUL A;  2M7L A;  2KNE A;  1K95 A;  1G33 A;  1M46 A;  3BUW B;  1NCX A;  1SKT A;  2SAS A;  1RWY A;  2JT3 A;  1IQ5 A;  1J7O A;  1TRF A;  1BG1 A;  1RRO A;  3EVR A;  2LAP A;  3A4U B;  3I5G C;  1LVC D;  1K9K A;  2FOT A;  4JQ0 D;  1DF0 B;  1NP8 A;  1CFF A;  3CS1 A;  1SNL A;  1GQM A;  1YR5 A;  1IKU A;  4XJK A;  2E6W A;  2LLS A;  2KFG A;  4MRY A;  1Y1U A;  5JJG A;  2M0R A;  1JFK A;  2LLT A;  1KWO B;  3CR2 A;  3QRX A;  5F6T A;  2ZND A;  5BPJ A;  3GOF A;  1GJY A;  3PAT A;  4DIR A;  3WXA A;  4Q04 A;  1IJ5 A;  4P5O E;  1UUS A;  1F71 A;  1JF0 A;  5K89 A;  1DMO A;  1BJF A;  1TCO B;  1CDM A;  3BOW A;  2JU0 A;  4PCW A;  4HRG A;  1S3P A;  2MRD A;  4YGE B;  1JWD A;  2PSR A;  5AAN A;  1WY9 A;  4OV2 A;  1L2O B;  1IH0 A;  1A75 B;  2V53 A;  1CFC A;  1SCM B;  2BL0 C;  3PSR A;  5I2O A;  3TUY B;  1ZMZ A;  1BR4 B;  3EKH A;  1JUO A;  2AAO A;  1IGV A;  2EC6 C;  2HET A;  1Y1A A;  1NX2 A;  1QV1 A;  1AK8 A;  3FWC A;  2K7D A;  4C0J A;  4DCK A;  2E30 A;  5HYD A;  1RJV A;  3RM1 A;  4CLN A;  4GBA A;  3DVK A;  1XK4 A;  2Y1M A;  4MLW A;  1A4P A;  4GUK A;  1DJW A;  2BEC A;  4GGF C;  4QJ3 B;  2LVK A;  3ZWH A;  2KGB C;  2KOT A;  5D7F A;  1KK8 B;  1V1F A;  4QJ5 B;  1H4B A;  4JPZ B;  2LC5 A;  2LV7 A;  1OZO A;  2LMU A;  1NX3 A;  1UHN A;  1KWO C;  1NX0 A;  3KPX A;  1XFY O;  1NUB A;  1LA0 A;  2HQW A;  1DTL A;  4XYN A;  2FCE A;  4M2O A;  1DGU A;  2KHN A;  2IS9 A;  1A2X A;  1AHR A;  2ZRS A;  4FQO A;  1CDN A;  1E8A A;  2LVI A;  2F3Z A;  3TDU A;  1L2O C;  5TNC A;  5HKY A;  1SCM C;  2M29 A;  1YUR A;  1M63 B;  2F33 A;  2LM5 A;  4BY5 A;  4I5L B;  1DGV A;  2LCP A;  4PE7 A;  2I94 A;  2JQ6 A;  1B8R A;  2K2A A;  3WNX B;  4CID A;  1QAT A;  3I5G B;  1SR6 B;  5CSF A;  4PDZ A;  1M45 A;  1MWN A;  2KFH A;  4N1G A;  2O5G A;  3PFV A;  1C7W A;  2KYF A;  5FYX A;  1LKJ A;  2L0P A;  2EHB A;  2ZN8 A;  1K93 D;  3D0Y B;  1TNX A;  1TOP A;  4N1F A;  5AXI A;  1LA3 A;  2ISD A;  4YRU A;  1KK8 C;  2G2B A;  1PSB A;  2OS8 B;  1JFJ A;  1HQV A;  1YTZ C;  1CDL A;  2BBM A;  2OTG B;  3JVT B;  5JOL A;  1TCF A;  2H61 A;  5G08 A;  4QJ4 B;  4MZK A;  1F55 A;  2KAX A;  4YGC B;  2NCO A;  1YX7 A;  4A4B A;  1JF2 A;  1ZFS A;  1YVH A;  2ZNE A;  3GK4 X;  3H4S E;  1SK6 D;  1B8L A;  1WLM A;  2JXC A;  1EH2 A;  2M1K B;  5CSN A;  4I5K A;  1F54 A;  3CLN A;  1TTX A;  5HLV A;  5CSJ A;  3DVE A;  2F3Y A;  1XFV O;  2M1U A;  2KAV A;  1QJT A;  4GNK B;  1UHK A;  4E68 A;  3FIA A;  1R2U A;  2BE4 A;  1IG5 A;  1OSA A;  1XO5 A;  1J7Q A;  1RTP 1;  4MZJ A;  3SG7 A;  5I2L A;  2K7B A;  3PN7 B;  3EVU A;  1RFJ A;  3SG6 A;  2JNF A;  1SR6 C;  1YX8 A;  4NDB A;  1CFD A;  3RLZ A;  1QX7 A;  2BKH B;  1CLL A;  2TN4 A;  1VRK A;  2KI4 C;  4GGN A;  1QLS A;  2JT0 A;  3CGA A;  2HPS A;  1QIV A;  3NSI A;  2Q4U A;  1BMO A;  3EK8 A;  2ZKM X;  4AQJ A;  3GK2 A;  2K7C A;  1NX1 A;  2OS8 C;  2R2I A;  2ZRT A;  2MBX A;  1S6I A;  2COL B;  3BYA A;  2OTG C;  3CTN A;  3JVT C;  3SG4 A;  5CSI A;  1QX5 B;  1IJ6 A;  2I2R E;  1MF8 B;  1SBJ A;  3SJS A;  2JWW A;  1J1E A;  1F8H A;  4I5N B;  3A8R A;  3O78 A;  1KSM A;  1GGZ A;  2RGI A;  2LMV A;  1NSH A;  1K90 D;  3D10 A;  1Y6W A;  2LE9 B;  1QV0 A;  1J1D A;  3SG2 A;  1L7Z A;  1BU3 A;  3O2P A;  3VRQ A;  1SY9 A;  5DKN A;  3HX4 A;  2CCM A;  2M3W A;  1UHI A;  2B1U A;  1KFX S;  1ZOT B;  4NQG A;  3OP0 A;  5HLO A;  1CMG A;  1M31 A;  1QS7 A;  1SL9 A;  1TNW A;  1FW4 A;  4OCI A;  1CTR A;  4ORC B;  3C1V A;  3EVV A;  2ZFD A;  4ZCU A;  3BUN B;  2I18 A;  4AQI A;  1BT6 A;  3JTD C;  3NSL A;  2MA2 A;  1B8C A;  1RK9 A;  4ZCV A;  1MXE A;  3PN7 C;  3GK1 A;  3F45 A;  1K2H A;  2LHI A;  3CZT X;  3LK0 A;  1JC2 A;  4PHM A;  1CB1 A;  3OX6 A;  5KSZ A;  1NPQ A;  3DF0 A;  3FWB A;  1U5I B;  4USL A;  5KTY A;  2K2F A;  2BCB A;  1MUX A;  2K61 A;  2BE6 A;  1KK7 Y;  1QX2 A;  2MHH A;  2LUX A;  2QPT A;  2WC8 A;  4M2P A;  4WQ3 A;  1UWO A;  2F8P A;  3TS5 B;  1YRT B;  1N65 A;  1EG4 A;  4GGF A;  1LIN A;  4PE0 A;  2G9B A;  1B1G A;  1FF1 A;  1DF0 A;  1XFX O;  1OMV A;  3DD4 A;  1KQV A;  1NYA A;  3BQ3 A;  1Y1X A;  1KFU S;  2L51 A;  2JTT A;  1JBA A;  2PVB A;  2MAZ A;  1KFX L;  5DKQ A;  1ALW A;  4WQ2 A;  2LMT A;  2EGD A;  1YVL A;  1DJI A;  2WCF A;  1N0Y A;  2CNP A;  2K7O A;  1YUU A;  4DUQ A;  2GV5 A;  5CPV A;  1PSR A;  1WLZ A;  2BBN A;  3VRO A;  1J7P A;  1B47 A;  1DJH A;  1OMR A;  2NLN A;  2PRU A;  4GPL B;  4U8D A;  2KDH A;  1PVB A;  3CWG A;  3LCP C;  1AP4 A;  1FPW A;  1TNQ A;  1A75 A;  2CT9 A;  4YI8 A;  1TN4 A;  1MHO A;  2WOS A;  1EJ3 A;  1F4Q A;  2LP2 A;  1B4C A;  1AJ4 A;  2KGR A;  2KI4 B;  4P2Y B;  3SIB A;  1KQM B;  2JTZ A;  2P6B B;  3M0W A;  1S6J A;  3IQO A;  4XJK B;  3SIA A;  1SMG A;  2HQ8 A;  1B9A A;  1C07 A;  1SYM A;  1X02 A;  2LNK A;  4CPV A;  3IF7 A;  4MRX A;  1G4Y R;  1Q80 A;  2WND A;  4MZL A;  3SG3 A;  3BUX B;  1D1O A;  4MEW A;  1NIW A;  4YI9 A;  1CKK A;  1C7V A;  1FI6 A;  1QAS A;  2PAL A;  3TS5 C;  1REC A;  4HRH A;  2D8N A;  2PMY A;  3BOW B;  3NSK A;  3WHU B;  5AFP A;  1UP5 A;  2H61 C;  1MQ1 A;  1GGW A;  3WHT B;  1AVS A;  1EG3 A;  1ALV A;  1YRU B;  1BOD A;  5D69 A;  1FBV A;  2WCB A;  2M49 B;  2LLU A;  3LK1 A;  5IBW A;  2K8M B;  3EK7 A;  3KEV A;  1KCY A;  4YBH B;  4PHN A;  2JPT A;  4FTG A;  2I7A A;  4MBE A;  1DJY A;  2KBI A;  5ER5 A;  4OR9 B;  4AOM A;  1CLM A;  1V1G A;  2HF5 A;  2OPO A;  5B8I B;  3VRR A;  4A4C A;  5AEQ A;  3I5H C;  1YUT A;  2CBL A;  2O60 A;  2L4H A;  2Q91 A;  1UUR A;  1TIZ A;  4YGD B;  1AUI B;  2SCP A;  1PK0 D;  3HCM A;  3JTD B;  4L9M A;  4NDC A;  5HKZ A;  4R1E A;  1OQP A;  2L5X B;  3PAL A;  3ZNI A;  2DOQ A;  2VRG A;  2BKI B;  2CXJ A;  3KHE A;  1FI5 A;  3VRP A;  2NCP A;  4OKH A;  1F4O A;  4MSP A;  2AUC A;  4YGB B;  2F2O A;  2Y5I A;  1XFZ O;  1TNP A;  1KQM C;  2Y4Q A;  1CM4 A;  4PE4 A;  1CM1 A;  4M2Q A;  1KK7 Z;  4TNC A;  3NXA A;  1DJG A;  3TDZ A;  1UHJ A;  4CFR A;  2GGZ A;  3EKJ A;  3LLE A;  1WRK A;  2PAS A;  1KSO A;  1K94 A;  2H2K A;  1EXR A;  1SL7 A;  4HRE E;  4F0Z B;  4CFQ A;  2JT8 A;  1F70 A;  1Y0V H;  3D0Y A;  1SRA A;  1K8U A;  3TDI A;  1SL8 A;  5ER4 X;  2LVV A;  2LAN A;  1ODB A;  2JOJ A;  1N2D A;  2CTN A;  5I2Q A;  1K96 A;  2ZN9 A;  3AKA A;  3OX5 A;  2MLE C;  1S36 A;  2WCE A;  3VGO A;  2KQY A;  4PHK A;  1XVJ A;  1B7T Z;  2L2E A;  3KO0 A;  3O4Y A;  4PAL A;  3OB1 B;  1CMF A;  3DVJ A;  4NDD A;  2M9G A;  1QVI Y;  2Y1N A;  4ORB B;  1QIW A;  1XK4 C;  3DVM A;  2F2P A;  3LL8 B;  4GAO A;  5J3X A;  1K9U A;  1WDC B;  2LUC A;  2M7N A;  2JUL A;  1MXL C;  1ZUZ A;  1OMD A;  1S26 D;  3AAK A;  4N5X A;  1MR8 A;  5KU1 A;  1WRZ A;  2NXQ A;  3AAJ A;  2AMI A;  1UHH A;  1YUS A;  4PHJ A;  2QAC A;  1M39 A;  2L98 A;  2L50 A;  2M97 A;  5AER A;  3PM8 A;  4ORA B;  1S5G Z;  1CLB A;  1BF5 A;  1QTX A;  1OOJ A;  2MJW B;  4GFT A;  1XA5 A;  2GGM A;  5I8N A;  3VRN A;  3I5H B;  1K9P A;  3MSE B;  5PAL A;  2M8U A;  1CNP A;  1NCZ A;  2LHL A;  3O6B A;  1NWD A;  3TZ1 A;  3FS7 A;  4YGA A;  2KAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...