1G8IA

Crystal structure of human frequenin (neuronal calcium sensor 1)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
182
Chain Sequence
SNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Immunocytochemical localization and crystal structure of human frequenin (neuronal calcium sensor 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 69
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA02
2JC2A 2KQYA 4A4CA 1XFYO 1FPWA 2F2OA 4M2OA 1X02A 1SCMB 3I5HB 1UUSA 2KDHA 4ZCVA 1M39A 1AK8A 1J7OA 2WOSA 2JT0A 2V53A 3H4SE 1YX8A 2BBNA 3JTDB 1K93D 4QJ3B 4NDDA 4MZJA 4MVFA 1SCVA 1J7RA 1WDCB 2WCFA 3DD4A 2CXJA 1HQVA 2PALA 3BOWA 4I5JA 2K0JA 1NCYA 3TDIA 2OPOA 5HKZA 1EXRA 3PN7C 2JT3A 4XJKA 2KYCA 2K7CA 2Y1NA 1UHHA 1B47A 1QASA 1NIWA 3WNXB 1WRZA 4BY5A 1B8RA 2A4JA 1SBJA 4DUQA 1DJGA 2L0PA 1KCYA 4YGEB 3D0YA 1JBAA 3O2PA 1CMGA 1FI6A 3KEVA 4OCIA 2Y5IA 1QJTA 2JTTA 4OV2A 4NDBA 1A2XA 1C7VA 1BODA 1UHNA 4M2QA 1G4YR 2L5XB 1SL9A 3PATA 2ZFDA 2OS8C 1B1GA 2LHLA 1BOCA 1KFUL 1YURA 3SJSA 1J7PA 3DVJA 3CS1A 4MEWA 5K89A 4WQ2A 1DJYA 2H61C 2PVBA 1K8UA 2Q4UA 3VROA 4UPGA 4DRWA 4U8DA 2RGIA 5GQQC 1TNPA 2LHIA 1JF0A 5ER5A 1MWNA 1CLBA 4WRIA 2ZN8A 1DMOA 1XFVO 3JVTC 3SG7A 5DKRA 2LMTA 3O6BA 1KWOB 2KNEA 1QLSA 2AUCA 1SR6C 1TRFA 2KOTA 2MLFC 1F55A 2LP2A 2JXCA 4E68A 1EH2A 1JWDA 2KI4C 3PN7B 1CTRA 1W7JB 2G2BA 3EKJA 1ALWA 1QTXA 1BMOA 3BYAA 1NWDA 2KI6D 1GGWA 4AOMA 1CNPA 3LK0A 3GK2A 1KSOA 2LV7A 2ZN9A 3I5HC 5HKWA 3KO0A 1DGUA 1NPQA 1SKTA 5AXIA 3NSOA 3TDZA 4PE7A 4GGFC 5KU1A 1TIZA 4DS7A 1JFJA 3DVMA 1SRAA 2KQ6A 3O4YA 1DVIA 1K94A 1WDCC 4PHMA 3CGAA 1QIWA 3AAJA 1TTXA 1B8LA 1K90D 1CLMA 3NSKA 4QJ5B 2QACA 2COLB 2LP3A 1YUSA 1WLMA 5CSJA 1F70A 1JFKA 2BECA 3EVUA 4YBHB 2I94A 3RM1A 4R1EA 4DCKA 3ZWHA 5DKNA 1MXEA 2ZRSA 4ICBA 4AQIA 5HKYA 5JOLA 2O5GA 5CSNA 5CPVA 4N1FA 2MRDA 2BE4A 1BJFA 1H8BA 1IRJA 1XVJA 1V1GA 2BBMA 1JF2A 4HSZA 1IJ5A 2K8MB 4MLWA 3VRNA 1A03A 1FW4A 2JWWA 3OB1B 2Q91A 2JT8A 1XA5A 2KI4B 2O60A 3WHTB 2L4IA 2BKHB 1L2OB 2BKIB 3AKBA 2LE9B 4F0ZB 1CFDA 4HRGA 4NDCA 1NCZA 1SK6D 1DJXA 2Y4QA 4M2PA 1LKJA 4JQ0D 3BUXB 2LLSA 2NZ0A 4ETOA 4PHJA 5IBWA 3BUMB 2BL0B 4P5OE 1XK4C 1FI5A 1RTP1 1XYDA 3CR4X 1YVLA 1MHOA 1QATA 3ZNIA 1KWOC 3IQOA 1KK7Z 4JPZB 1EL4A 3ICBA 2NLNA 1PVAA 1B8CA 1SYMA 1YRUB 3LL8B 5FYXA 2KYFA 1TOPA 1TCOB 1QIVA 2PMYA 1ODBA 1CFFA 2F8PA 1UHIA 1SL8A 1MR8A 3NSLA 2BCXA 2JRFA 2L51A 5I2OA 1EG3A 5AFPA 2M9GA 1Y1AA 2CT9A 2LLUA 3NSIA 1NSHA 1DF0B 1S6CA 2KGBC 3SG6A 3TUYB 1Y1UA 3KF9A 5HLOA 5CSFA 2I7AA 2FCDA 2MLEC 1CMFA 3DF0A 3EK4A 1F8HA 1ZFSA 2WNDA 4ORBB 3AKAA 4PALA 3GOFA 2HQWA 1DJZA 3AAKA 4GPLB 4PDZA 3OX5A 1UHJA 5BPJA 2LVVA 4WQ3A 1M46A 2LCPA 3SIAA 2FCEA 2WC8A 1B7TZ 3K21A 1ALVA 1A75B 1IG5A 1PSBA 1SMGA 1KK8B 2GV5A 1NX0A 2LNKA 5D69A 2LAPA 3VGOA 1CDPA 2PASA 4YRUA 2ZNDA 2CCMA 4OKHA 1MUXA 2H61A 4A4BA 2M8UA 1V1FA 4P2YB 1QVIZ 1L7ZA 5PALA 2F3ZA 2M1KB 1KK7Y 1K95A 2G9BA 1AHRA 1PALA 1LA0A 2WORA 4GAOA 1L2OC 4D1EA 2KFFA 5KTYA 1SW8A 1F71A 5AEQA 3BOWB 1PRWA 1EJ3A 3CWGA 2BCAA 1XFXO 1KQMB 1TNXA 4XJKB 1A29A 2JPTA 1YTZC 2HF5A 1BU3A 5TNCA 1HT9A 1YUUA 2BL0C 3PALA 5ER4X 2VRGA 3A4UB 1LXFC 1SL7A 2LUCA 1U5IA 1UHKA 3SG4A 3WXAA 1Y1XA 4XYNA 2LVKA 3D0YB 1K96A 5I2QA 1FF1A 3KHEA 2F3YA 1NCXA 2ZNEA 4GGFA 4MZKA 5I2LA 1C7WA 2JTZA 3KPXA 1S5GZ 2P6BB 1QV0A 2JU0A 1IQ3A 1QX7A 2FJUB 1R6PA 3OP0A 3FIAA 2L98A 1TN4A 1Y6WA 2H2KA 1MQ1A 5D7FA 2SCPA 1IKUA 2M3WA 1IJ6A 2OTGC 1WLZA 1ZUZA 3GK1A 2JXLA 1B7TY 1S6JA 4TNCA 3QRXA 1S36A 2LC5A 1IH0A 1QS7A 4NQGA 3TUYC 3TS5B 1IQ5A 1MXLC 1J55A 1DJWA 4FTGA 4MSPA 3BUNB 4YGDB 1J1EA 1SPYA 2MJWB 3C1VA 4C0LA 1R2UA 1TNWA 1JUOA 1S3PA 2L2EA 5DKQA 3I5IC 1DT7B 1UP5A 2M7LA 2M29A 1F4QA 1QVIY 3PM8A 2AAOA 3BUOB 4C0KA 1FBVA 1BT6A 3VRRA 4GGNA 2CBLA 1YR5A 1S1EA 2HPSA 4ZCUA 1CDNA 1OOJA 2ISDA 2M49B 4CIDA 3IQQA 5F6TA 2CTNA 3LCPC 2LVJA 1KFUS 2NXQA 1AUIB 2K7DA 5JJGA 1RK9A 5B8IB 1DGVA 1KK8C 4YI9A 2K7BA 2DOQA 4IL1A 1RWYA 1B4CA 1J7QA 3CR2A 4YGCB 2MAZA 1OZOA 4MBEA 2IS9A 2BCBA 4QJ4B 1AJ4A 3IF7A 1CLLA 1XK4A 4DIRA 2NCOA 2M97A 3SG3A 3FS7A 1A4PA 1PK0D 1RFJA 2KBMA 3LK1A 5I8NA 1WY9A 2EHBA 5G08A 1XFUO 4JWQA 1S5GY 1TCFA 1GQMA 2LUXA 2KAYA 4GBAA 2OTGB 1PVBA 1KQMC 2M0RA 1NP8A 4PHKA 4HREE 1CDMA 2EC6C 2QPTA 1Y0VH 3EK8A 5J3XA 4PE4A 4PCWA 2JNXA 1KFXS 2L50A 1RECA 1YVHA 1B9AA 4YI8A 1CM1A 1OMVA 1QX2A 1YX7A 2NCPA 3I5IB 4CPVA 2L4HA 2KSPA 1NX2A 1XFZO 1CFCA 3RLZA 2JULA 1JC2A 1S6IA 3BXKA 1BR1B 1AVSA 2ZRTA 3PFVA 3I5GB 1QLKA 1RJVA 4OVNF 2FOTA 4PHNA 1PULA 1BLQA 1UWOA 1H4BA 1YUTA 1OSAA 2EGDA 1KSMA 2HQ8A 2LANA 1YRTB 3TZ1A 2F2PA 1IGVA 4OR9B 1G33A 2WCBA 3I5FB 4YGAA 2KAVA 4L9MA 3TS5C 3OB2B 3SG2A 2MA2A 1XFWO 3CZTX 2KHNA 3VRPA 1NUBA 3DVEA 2LMVA 4I5KA 5HYDA 2SASA 4PE1A 1K9PA 1GGZA 5CSIA 3LLEA 2LVIA 3EVVA 1F4OA 4ORCB 4AQJA 2KBIA 1DTLA 1OZSA 3HX4A 3WHUB 3E3RA 4USLA 1OMDA 1AP4A 1K2HA 1CB1A 1N2DA 1WRLA 1NX1A 2PSRA 4N5XA 1S26D 1OE9B 3OX6A 4FQOA 2K2FA 2EC6B 1DJHA 2F33A 1DJIA 4I5NB 1N65A 3EK7A 1CDLA 1QX5B 2I18A 2PRUA 2LM5A 2KFGA 3EVRA 3A8RA 1AJ5A 3PLFB 2B1UA 2Y1MA 4BY4A 2TN4A 3D10A 3O78A 1WRKA 2JNFA 3SG5A 1G8IA 2HETA 1LA3A 3CR5X 4CFQA 1LINA 2E6WA 1CM4A 1E8AA 3MSEB 3NXAA 3F45A 2KFHA 2GGMA 1XO5A 2LMUA 3CTNA 4MRXA 1BG1A 1F54A 3PSRA 1NX3A 4MRYA 3DF0B 2GGZA 3GK4X 5AANA 5KSZA 1GJYA 1KFXL 2LLTA 1SCMC 1LVCD 1M31A 3TDUA 4GFTA 3EKHA 4C0JA 1SY9A 1K9UA 1SNLA 2K61A 2MHHA 1N0YA 3CLNA 4GUKA 4GNKB 5HLVA 1OQPA 1MF8B 3JTDC 3OHMB 1PSRA 2KAXA 1VRKA 2E30A 1C07A 4YGBB 3BUWB 4PE0A 2MBXA 2OS8B 2WCEA 3SIBA 3VRQA 1UURA 3M0WA 1QV1A 3BQ3A 4Q04A 2JZIA 1RROA 2KI6C 2ZKMX 3FWBA 1DF0A 4CFRA 1W7IB 4HRHA 3FWCA 2CNPA 1M45A 2JOJA 1IWQA 2AMIA 3I5GC 4N1GA 2M1UA 1TNQA 2JQ6A 4ORAB 1KQVA 1JSAA 1EG4A 3JVTB 4MN0A 2KGRA 1D1OA 1CFPA 1BF5A 3DVKA 1BR4B 1NYAA 5AERA 1QXPA 1SR6B 2R2IA 1M63B 4MZLA 3I5FC 1J1DA 2BE6A 4I5LB 2I2RE 3HCMA 1Q80A 1K9KA 2M7NA 1ZOTB 1ZMZA 2K2AA 2K7OA 4CLNA 1ZACA 1OMRA 1A75A 1CKKA 1U5IB 2D8NA
chains in the Genus database with same CATH superfamily
2JC2A 2KQYA 4A4CA 1XFYO 1FPWA 2F2OA 3CZ2A 4M2OA 2K60A 1X02A 1SCMB 1SSEB 1TUZA 1UUSA 3I5HB 1DELA 2KDHA 3R1OA 3CZ0A 4ZCVA 1M39A 1AK8A 1J7OA 2WOSA 2JT0A 2V53A 3H4SE 1YX8A 2BBNA 3JTDB 1K93D 4QJ3B 4NDDA 4MZJA 4MVFA 3CYZA 2BAPA 1SCVA 3OBVA 4JKTA 1J7RA 1WDCB 2QEOA 2WCFA 3DD4A 2CXJA 1HQVA 2PALA 3BOWA 4I5JA 2JPOA 2K0JA 1NCYA 3B7AA 3TDIA 2OPOA 5HKZA 1EXRA 3PN7C 2JT3A 4XJKA 2KYCA 2K7CA 2Y1NA 1UHHA 1B47A 1QASA 1NIWA 3WNXB 1WRZA 4BY5A 1B8RA 2A4JA 2P70A 1SBJA 4DUQA 4PT1A 1DJGA 3D75A 3IVTA 2L0PA 1KCYA 4YGEB 3D0YA 1JBAA 3O2PA 1CMGA 1FI6A 3KEVA 4OCIA 2Y5IA 1QJTA 2JTTA 4OV2A 3VB1A 4NDBA 1A2XA 1C7VA 1BODA 1UHNA 3Q8IA 5DICA 4M2QA 1G4YR 2L5XB 1SL9A 3PATA 2ZFDA 3PJIA 4F7FA 3CABA 2OS8C 1B1GA 3SS3A 2LHLA 1BOCA 1KFUL 1YURA 3SJSA 1J7PA 3DVJA 3CS1A 4MEWA 5K89A 4WQ2A 1DJYA 2H61C 2PVBA 3SS5A 1K8UA 2Q4UA 3VROA 4UPGA 4DRWA 4U8DA 2RGIA 5GQQC 1TNPA 2LHIA 1JF0A 5ER5A 1MWNA 1CLBA 4WRIA 2ZN8A 1DMOA 1XFVO 3JVTC 3SG7A 5DKRA 2LMTA 3O6BA 1KWOB 2KNEA 1QLSA 2AUCA 1SR6C 1TRFA 2KOTA 2MLFC 1IIOA 2WC6A 1F55A 2LP2A 2JXCA 4E68A 1EH2A 1JWDA 2KI4C 2WCJA 3PN7B 1CTRA 1W7JB 1OOGA 2G2BA 1XFRA 3EKJA 1ALWA 1QTXA 1BMOA 3BYAA 1NWDA 2KI6D 1GGWA 4AOMA 1CNPA 3LK0A 3GK2A 3B88A 1KSOA 2LV7A 2ZN9A 3I5HC 5HKWA 3KO0A 4INXA 1DGUA 1NPQA 1SKTA 3NHTA 3NSOA 5AXIA 2WCHA 3S0EA 4PE7A 3TDZA 4GGFC 5KU1A 1TIZA 4DS7A 1JFJA 1OOIX 3DVMA 1SRAA 2KQ6A 3DYEA 3O4YA 1DVIA 1K94A 5EL2A 1WDCC 4PHMA 3CGAA 3V2LA 1QWVA 1Z4HA 1QIWA 3AAJA 1TTXA 1B8LA 1K90D 1CLMA 3NSKA 4QJ5B 2QACA 2COLB 2LP3A 1YUSA 1WLMA 5CSJA 1F70A 1JFKA 1OW4A 3FE6A 2BECA 3EVUA 4YBHB 2I94A 3RM1A 4R1EA 4DCKA 3B87A 3ZWHA 5DKNA 1MXEA 2QDIA 2ZRSA 4ICBA 4INWA 4AQIA 5HKYA 5JOLA 2WCLA 5D3OA 2O5GA 5CSNA 3R72A 5CPVA 4N1FA 2MRDA 2BE4A 1BJFA 1H8BA 1IRJA 1XVJA 3NGVA 3D74A 1V1GA 2BBMA 1JF2A 4HSZA 1IJ5A 2K8MB 2WC5A 4MLWA 3VRNA 1FW4A 1A03A 2JWWA 3OB1B 2Q91A 2JT8A 1XA5A 2KI4B 2O60A 3WHTB 2L4IA 2BKHB 1L2OB 2BKIB 5FI6A 3AKBA 3QMEA 5FI2A 3L4AA 2LE9B 2BNXA 4F0ZB 1CFDA 4HRGA 3DXLA 1NCZA 1SK6D 4NDCA 1DJXA 2Y4QA 2KLEA 4M2PA 1LKJA 3D73A 4JQ0D 3BUXB 3S0DA 2LLSA 2NZ0A 4ETOA 4PHJA 5IBWA 3BUMB 2BL0B 4P5OE 1XK4C 1FI5A 1RTP1 2PQLA 1XYDA 3CR4X 1GM0A 1YVLA 1MHOA 1QATA 3ZNIA 3BJHA 4IJ7A 3EG5B 1KWOC 3R1PA 3IQOA 1KK7Z 4JPZB 1EL4A 3ICBA 4OZDA 1C3ZA 1C3YA 1OOHA 2NLNA 1PVAA 1B8CA 1SYMA 1YRUB 2YGUA 3LL8B 5FYXA 2KYFA 1TOPA 1TCOB 1QIVA 2PMYA 1ODBA 1CFFA 3R1VA 3D77A 2F8PA 1UHIA 3CDNA 1SL8A 1MR8A 3NSLA 2BCXA 2JRFA 2L51A 3S0FA 5I2OA 1EG3A 5AFPA 2M9GA 1Y1AA 2CT9A 2LLUA 3NSIA 1NSHA 1DF0B 1S6CA 2KGBC 3SG6A 3TUYB 1Y1UA 3KF9A 5HLOA 5CSFA 2I7AA 2FCDA 2MLEC 1CMFA 3DF0A 3EK4A 1F8HA 3N7HA 1ZFSA 2WNDA 4ORBB 3O4XA 3AKAA 4PALA 3GOFA 2HQWA 2PYQA 1DJZA 3AAKA 4GPLB 4PDZA 1LS8A 3OX5A 1UHJA 5BPJA 3BFBA 2LVVA 4WQ3A 1M46A 2LCPA 3SIAA 2FCEA 2WC8A 1B7TZ 2L2CA 3K21A 3K1EA 1ALVA 1A75B 1TUJA 1IG5A 1PSBA 1SMGA 1KK8B 2GV5A 1NX0A 2LNKA 5D69A 2LAPA 3VGOA 1CDPA 2PASA 4YRUA 2ZNDA 2CCMA 2WCKA 3B6XA 4OKHA 1MUXA 2H61A 2L5YA 4A4BA 2M8UA 1V1FA 4P2YB 1QVIZ 1L7ZA 5PALA 2F3ZA 1DC1A 2M1KB 1KK7Y 1K95A 2G9BA 1AHRA 1PALA 1LA0A 2WORA 4GAOA 1L2OC 4D1EA 2KFFA 5KTYA 1SW8A 1F71A 2KLDA 5AEQA 3BOWB 1PRWA 1EJ3A 3CWGA 2BCAA 1XFXO 1KQMB 1TNXA 4XJKB 1A29A 2JPTA 1YTZC 2HF5A 1BU3A 5TNCA 1HT9A 1YUUA 2BL0C 3PALA 5ER4X 2VRGA 3A4UB 1LXFC 1SL7A 2LUCA 1U5IA 5FI7A 1UHKA 4BY4A 3SG4A 3WXAA 1Y1XA 3CZ1A 4XYNA 2LVKA 3D0YB 1K96A 5I2QA 1FF1A 2P71A 2QEBA 3KHEA 2F3YA 1NCXA 2ZNEA 4GGFA 4MZKA 5I2LA 1C7WA 2JTZA 3KPXA 1S5GZ 3NHIA 2P6BB 1QV0A 2JU0A 1IQ3A 1QX7A 2FJUB 1R6PA 3OP0A 3FIAA 3UO9A 2L98A 1TN4A 1Y6WA 2H2KA 1MQ1A 5D7FA 2SCPA 1IKUA 2M3WA 1IJ6A 2OTGC 1WLZA 1ZUZA 3BFHA 3GK1A 2JXLA 1B7TY 1S6JA 4TNCA 3QRXA 1S36A 2LC5A 1IH0A 1QS7A 4NQGA 3TUYC 3TS5B 1IQ5A 1MXLC 1P28A 1J55A 1DJWA 4FTGA 4MSPA 3BUNB 2ERBA 1J1EA 1SPYA 2MJWB 4YGDB 3C1VA 4C0LA 1DQEA 1R2UA 1TNWA 1JUOA 1S3PA 2L2EA 5DKQA 3I5IC 1DT7B 1UP5A 2M7LA 2M29A 1F4QA 1QVIY 3PM8A 2AAOA 3BUOB 4C0KA 1FBVA 1BT6A 3VRRA 4GGNA 2CBLA 1YR5A 1S1EA 2HPSA 4ZCUA 1CDNA 1OOJA 2ISDA 1W9ZA 2M49B 4CIDA 3IQQA 5F6TA 3S0GA 2CTNA 3LCPC 2LVJA 1OOFA 1KFUS 2QEVA 2GTEA 2NXQA 1AUIB 2K7DA 5JJGA 1RK9A 5B8IB 1DGVA 1KK8C 4YI9A 2K7BA 2DOQA 4IL1A 1RWYA 1B4CA 1J7QA 3CR2A 4YGCB 2MAZA 1OZOA 4MBEA 2IS9A 2BCBA 4QJ4B 1AJ4A 3IF7A 1CLLA 1XK4A 4DIRA 2NCOA 2M97A 3SG3A 5I94A 3L4LA 3FS7A 1A4PA 1PK0D 1RFJA 2KBMA 3LK1A 5I8NA 1WY9A 2EHBA 5G08A 1XFUO 4JWQA 2KPHA 1S5GY 1TCFA 1GQMA 2LUXA 2KAYA 4GBAA 2OTGB 1PVBA 1KQMC 2M0RA 1NP8A 1TWOA 4PHKA 1DEKA 4HREE 1CDMA 2EC6C 2QPTA 1Y0VH 3EK8A 5J3XA 4PE4A 4PCWA 2JNXA 1KFXS 2L50A 1RECA 1YVHA 1B9AA 4YI8A 1CM1A 1OMVA 1QX2A 1YX7A 2NCPA 3I5IB 4CPVA 2L4HA 2KSPA 1NX2A 3UNWA 1XFZO 1CFCA 3RLZA 2JULA 1JC2A 1S6IA 3BXKA 1BR1B 1AVSA 2ZRTA 3PFVA 3S0AA 3I5GB 1QLKA 1RJVA 4JD9A 4OVNF 2FOTA 4PHNA 1PULA 1BLQA 1UWOA 1H4BA 1YUTA 1OSAA 2EGDA 1KSMA 2HQ8A 2LANA 1YRTB 3TZ1A 2F2PA 1IGVA 4OR9B 2QEHA 1G33A 2WCBA 3I5FB 4YGAA 2KAVA 4L9MA 3TS5C 3D76A 3OB2B 3SG2A 2MA2A 1XFWO 3CZTX 2KHNA 3VRPA 1NUBA 3DVEA 2LMVA 4I5KA 5HYDA 2SASA 4PE1A 1K9PA 1GGZA 5CSIA 3LLEA 2LVIA 3EVVA 1F4OA 4ORCB 4AQJA 2KBIA 1DTLA 1OZSA 3HX4A 3S0BA 3WHUB 3E3RA 4USLA 1OMDA 1AP4A 1K2HA 1CB1A 1N2DA 1WRLA 1NX1A 2PSRA 4N5XA 1S26D 1OE9B 2H8VA 3OX6A 4FQOA 5HL1A 2K2FA 3B86A 2EC6B 1DJHA 2F33A 1DJIA 4I5NB 1N65A 3EK7A 1CDLA 1QX5B 2I18A 2PRUA 2LM5A 2KFGA 3EVRA 3A8RA 1AJ5A 3PLFB 2B1UA 2Y1MA 3FE9A 2TN4A 3D10A 3O78A 1WRKA 2JNFA 3D78A 3SG5A 1G8IA 2HETA 1LA3A 3CR5X 4CFQA 1LINA 2E6WA 1CM4A 1E8AA 3MSEB 3NXAA 1Z2CB 2KFHA 2GGMA 3F45A 1XO5A 2LMUA 3CTNA 3PM2A 4MRXA 1BG1A 3PSRA 1NX3A 4MRYA 1F54A 3DF0B 2GGZA 3GK4X 5AANA 5KSZA 1GJYA 1KFXL 2LLTA 1SCMC 1LVCD 1M31A 3TDUA 4GFTA 3EKHA 4C0JA 1SY9A 1K9UA 1SNLA 2K61A 2MHHA 1N0YA 3CLNA 4GUKA 4GNKB 5HLVA 1OQPA 1MF8B 3BFAA 3L47A 3JTDC 3OHMB 2WCMA 1PSRA 2KAXA 2FJYA 1VRKA 2E30A 1ORGA 3DZTA 1C07A 4YGBB 3BUWB 4PE0A 2MBXA 2OS8B 2WCEA 3SIBA 3VRQA 1UURA 4FQTA 3M0WA 4KYNA 1QV1A 3BQ3A 3FE8A 2JZIA 4Q04A 1RROA 2KI6C 2ZKMX 3FWBA 1DF0A 4CFRA 1W7IB 4HRHA 3FWCA 3OGNA 2CNPA 1M45A 2JOJA 3DY9A 1IWQA 2AMIA 3I5GC 4N1GA 2M1UA 1TNQA 2JQ6A 4ORAB 1KQVA 1JSAA 1EG4A 3JVTB 4MN0A 2KGRA 1D1OA 3SS4A 1CFPA 1BF5A 3RZSA 1T14A 3DVKA 1BR4B 1NYAA 5AERA 1QXPA 1SR6B 2R2IA 1M63B 4MZLA 3I5FC 1J1DA 2BE6A 4I5LB 2I2RE 3HCMA 1Q80A 1K9KA 2M7NA 1ZOTB 1ZMZA 2K2AA 2K7OA 4CLNA 1ZACA 1OMRA 1A75A 1CKKA 1U5IB 2D8NA
chains in the Genus database with same CATH topology
2JC2A 2KQYA 4A4CA 1XFYO 1FPWA 2F2OA 4M2OA 1X02A 1SCMB 3I5HB 1UUSA 2KDHA 4ZCVA 1M39A 1AK8A 1J7OA 2WOSA 2JT0A 2V53A 3H4SE 1YX8A 2BBNA 3JTDB 1K93D 4QJ3B 4NDDA 4MZJA 4MVFA 1SCVA 1J7RA 1WDCB 2WCFA 3DD4A 2CXJA 1HQVA 2PALA 3BOWA 4I5JA 2K0JA 1NCYA 3TDIA 2OPOA 5HKZA 1EXRA 3PN7C 2JT3A 4XJKA 2KYCA 2K7CA 2Y1NA 1UHHA 1B47A 1QASA 1NIWA 3WNXB 1WRZA 4BY5A 1B8RA 2A4JA 1SBJA 4DUQA 1DJGA 2L0PA 1KCYA 4YGEB 3D0YA 1JBAA 3O2PA 1CMGA 1FI6A 3KEVA 4OCIA 2Y5IA 1QJTA 2JTTA 4OV2A 4NDBA 1A2XA 1C7VA 1BODA 1UHNA 4M2QA 1G4YR 2L5XB 1SL9A 3PATA 2ZFDA 2OS8C 1B1GA 2LHLA 1BOCA 1KFUL 1YURA 3SJSA 1J7PA 3DVJA 3CS1A 4MEWA 5K89A 4WQ2A 1DJYA 2H61C 2PVBA 1K8UA 2Q4UA 3VROA 4UPGA 4DRWA 4U8DA 2RGIA 5GQQC 1TNPA 2LHIA 1JF0A 5ER5A 1MWNA 1CLBA 4WRIA 2ZN8A 1DMOA 1XFVO 3JVTC 3SG7A 5DKRA 2LMTA 3O6BA 1KWOB 2KNEA 1QLSA 2AUCA 1SR6C 1TRFA 2KOTA 2MLFC 1F55A 2LP2A 2JXCA 4E68A 1EH2A 1JWDA 2KI4C 3PN7B 1CTRA 1W7JB 2G2BA 3EKJA 1ALWA 1QTXA 1BMOA 3BYAA 1NWDA 2KI6D 1GGWA 4AOMA 1CNPA 3LK0A 3GK2A 1KSOA 2LV7A 2ZN9A 3I5HC 5HKWA 3KO0A 1DGUA 1NPQA 1SKTA 5AXIA 3NSOA 3TDZA 4PE7A 4GGFC 5KU1A 1TIZA 4DS7A 1JFJA 3DVMA 1SRAA 2KQ6A 3O4YA 1DVIA 1K94A 1WDCC 4PHMA 3CGAA 1QIWA 3AAJA 1TTXA 1B8LA 1K90D 1CLMA 3NSKA 4QJ5B 2QACA 2COLB 2LP3A 1YUSA 1WLMA 5CSJA 1F70A 1JFKA 2BECA 3EVUA 4YBHB 2I94A 3RM1A 4R1EA 4DCKA 3ZWHA 5DKNA 1MXEA 2ZRSA 4ICBA 4AQIA 5HKYA 5JOLA 2O5GA 5CSNA 5CPVA 4N1FA 2MRDA 2BE4A 1BJFA 1H8BA 1IRJA 1XVJA 1V1GA 2BBMA 1JF2A 4HSZA 1IJ5A 2K8MB 4MLWA 3VRNA 1A03A 1FW4A 2JWWA 3OB1B 2Q91A 2JT8A 1XA5A 2KI4B 2O60A 3WHTB 2L4IA 2BKHB 1L2OB 2BKIB 3AKBA 2LE9B 4F0ZB 1CFDA 4HRGA 4NDCA 1NCZA 1SK6D 1DJXA 2Y4QA 4M2PA 1LKJA 4JQ0D 3BUXB 2LLSA 2NZ0A 4ETOA 4PHJA 5IBWA 3BUMB 2BL0B 4P5OE 1XK4C 1FI5A 1RTP1 1XYDA 3CR4X 1YVLA 1MHOA 1QATA 3ZNIA 1KWOC 3IQOA 1KK7Z 4JPZB 1EL4A 3ICBA 2NLNA 1PVAA 1B8CA 1SYMA 1YRUB 3LL8B 5FYXA 2KYFA 1TOPA 1TCOB 1QIVA 2PMYA 1ODBA 1CFFA 2F8PA 1UHIA 1SL8A 1MR8A 3NSLA 2BCXA 2JRFA 2L51A 5I2OA 1EG3A 5AFPA 2M9GA 1Y1AA 2CT9A 2LLUA 3NSIA 1NSHA 1DF0B 1S6CA 2KGBC 3SG6A 3TUYB 1Y1UA 3KF9A 5HLOA 5CSFA 2I7AA 2FCDA 2MLEC 1CMFA 3DF0A 3EK4A 1F8HA 1ZFSA 2WNDA 4ORBB 3AKAA 4PALA 3GOFA 2HQWA 1DJZA 3AAKA 4GPLB 4PDZA 3OX5A 1UHJA 5BPJA 2LVVA 4WQ3A 1M46A 2LCPA 3SIAA 2FCEA 2WC8A 1B7TZ 3K21A 1ALVA 1A75B 1IG5A 1PSBA 1SMGA 1KK8B 2GV5A 1NX0A 2LNKA 5D69A 2LAPA 3VGOA 1CDPA 2PASA 4YRUA 2ZNDA 2CCMA 4OKHA 1MUXA 2H61A 4A4BA 2M8UA 1V1FA 4P2YB 1QVIZ 1L7ZA 5PALA 2F3ZA 2M1KB 1KK7Y 1K95A 2G9BA 1AHRA 1PALA 1LA0A 2WORA 4GAOA 1L2OC 4D1EA 2KFFA 5KTYA 1SW8A 1F71A 5AEQA 3BOWB 1PRWA 1EJ3A 3CWGA 2BCAA 1XFXO 1KQMB 1TNXA 4XJKB 1A29A 2JPTA 1YTZC 2HF5A 1BU3A 5TNCA 1HT9A 1YUUA 2BL0C 3PALA 5ER4X 2VRGA 3A4UB 1LXFC 1SL7A 2LUCA 1U5IA 1UHKA 3SG4A 3WXAA 1Y1XA 4XYNA 2LVKA 3D0YB 1K96A 5I2QA 1FF1A 3KHEA 2F3YA 1NCXA 2ZNEA 4GGFA 4MZKA 5I2LA 1C7WA 2JTZA 3KPXA 1S5GZ 2P6BB 1QV0A 2JU0A 1IQ3A 1QX7A 2FJUB 1R6PA 3OP0A 3FIAA 2L98A 1TN4A 1Y6WA 2H2KA 1MQ1A 5D7FA 2SCPA 1IKUA 2M3WA 1IJ6A 2OTGC 1WLZA 1ZUZA 3GK1A 2JXLA 1B7TY 1S6JA 4TNCA 3QRXA 1S36A 2LC5A 1IH0A 1QS7A 4NQGA 3TUYC 3TS5B 1IQ5A 1MXLC 1J55A 1DJWA 4FTGA 4MSPA 3BUNB 4YGDB 1J1EA 1SPYA 2MJWB 3C1VA 4C0LA 1R2UA 1TNWA 1JUOA 1S3PA 2L2EA 5DKQA 3I5IC 1DT7B 1UP5A 2M7LA 2M29A 1F4QA 1QVIY 3PM8A 2AAOA 3BUOB 4C0KA 1FBVA 1BT6A 3VRRA 4GGNA 2CBLA 1YR5A 1S1EA 2HPSA 4ZCUA 1CDNA 1OOJA 2ISDA 2M49B 4CIDA 3IQQA 5F6TA 2CTNA 3LCPC 2LVJA 1KFUS 2NXQA 1AUIB 2K7DA 5JJGA 1RK9A 5B8IB 1DGVA 1KK8C 4YI9A 2K7BA 2DOQA 4IL1A 1RWYA 1B4CA 1J7QA 3CR2A 4YGCB 2MAZA 1OZOA 4MBEA 2IS9A 2BCBA 4QJ4B 1AJ4A 3IF7A 1CLLA 1XK4A 4DIRA 2NCOA 2M97A 3SG3A 3FS7A 1A4PA 1PK0D 1RFJA 2KBMA 3LK1A 5I8NA 1WY9A 2EHBA 5G08A 1XFUO 4JWQA 1S5GY 1TCFA 1GQMA 2LUXA 2KAYA 4GBAA 2OTGB 1PVBA 1KQMC 2M0RA 1NP8A 4PHKA 4HREE 1CDMA 2EC6C 2QPTA 1Y0VH 3EK8A 5J3XA 4PE4A 4PCWA 2JNXA 1KFXS 2L50A 1RECA 1YVHA 1B9AA 4YI8A 1CM1A 1OMVA 1QX2A 1YX7A 2NCPA 3I5IB 4CPVA 2L4HA 2KSPA 1NX2A 1XFZO 1CFCA 3RLZA 2JULA 1JC2A 1S6IA 3BXKA 1BR1B 1AVSA 2ZRTA 3PFVA 3I5GB 1QLKA 1RJVA 4OVNF 2FOTA 4PHNA 1PULA 1BLQA 1UWOA 1H4BA 1YUTA 1OSAA 2EGDA 1KSMA 2HQ8A 2LANA 1YRTB 3TZ1A 2F2PA 1IGVA 4OR9B 1G33A 2WCBA 3I5FB 4YGAA 2KAVA 4L9MA 3TS5C 3OB2B 3SG2A 2MA2A 1XFWO 3CZTX 2KHNA 3VRPA 1NUBA 3DVEA 2LMVA 4I5KA 5HYDA 2SASA 4PE1A 1K9PA 1GGZA 5CSIA 3LLEA 2LVIA 3EVVA 1F4OA 4ORCB 4AQJA 2KBIA 1DTLA 1OZSA 3HX4A 3WHUB 3E3RA 4USLA 1OMDA 1AP4A 1K2HA 1CB1A 1N2DA 1WRLA 1NX1A 2PSRA 4N5XA 1S26D 1OE9B 3OX6A 4FQOA 2K2FA 2EC6B 1DJHA 2F33A 1DJIA 4I5NB 1N65A 3EK7A 1CDLA 1QX5B 2I18A 2PRUA 2LM5A 2KFGA 3EVRA 3A8RA 1AJ5A 3PLFB 2B1UA 2Y1MA 4BY4A 2TN4A 3D10A 3O78A 1WRKA 2JNFA 3SG5A 1G8IA 2HETA 1LA3A 3CR5X 4CFQA 1LINA 2E6WA 1CM4A 1E8AA 3MSEB 3NXAA 3F45A 2KFHA 2GGMA 1XO5A 2LMUA 3CTNA 4MRXA 1BG1A 1F54A 3PSRA 1NX3A 4MRYA 3DF0B 2GGZA 3GK4X 5AANA 5KSZA 1GJYA 1KFXL 2LLTA 1SCMC 1LVCD 1M31A 3TDUA 4GFTA 3EKHA 4C0JA 1SY9A 1K9UA 1SNLA 2K61A 2MHHA 1N0YA 3CLNA 4GUKA 4GNKB 5HLVA 1OQPA 1MF8B 3JTDC 3OHMB 1PSRA 2KAXA 1VRKA 2E30A 1C07A 4YGBB 3BUWB 4PE0A 2MBXA 2OS8B 2WCEA 3SIBA 3VRQA 1UURA 3M0WA 1QV1A 3BQ3A 4Q04A 2JZIA 1RROA 2KI6C 2ZKMX 3FWBA 1DF0A 4CFRA 1W7IB 4HRHA 3FWCA 2CNPA 1M45A 2JOJA 1IWQA 2AMIA 3I5GC 4N1GA 2M1UA 1TNQA 2JQ6A 4ORAB 1KQVA 1JSAA 1EG4A 3JVTB 4MN0A 2KGRA 1D1OA 1CFPA 1BF5A 3DVKA 1BR4B 1NYAA 5AERA 1QXPA 1SR6B 2R2IA 1M63B 4MZLA 3I5FC 1J1DA 2BE6A 4I5LB 2I2RE 3HCMA 1Q80A 1K9KA 2M7NA 1ZOTB 1ZMZA 2K2AA 2K7OA 4CLNA 1ZACA 1OMRA 1A75A 1CKKA 1U5IB 2D8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC2 A;  2KQY A;  4A4C A;  1XFY O;  1FPW A;  2F2O A;  4M2O A;  1X02 A;  1SCM B;  3I5H B;  1UUS A;  2KDH A;  4ZCV A;  1M39 A;  1AK8 A;  1J7O A;  2WOS A;  2JT0 A;  2V53 A;  3H4S E;  1YX8 A;  2BBN A;  3JTD B;  1K93 D;  4QJ3 B;  4NDD A;  4MZJ A;  4MVF A;  1SCV A;  1J7R A;  1WDC B;  2WCF A;  3DD4 A;  2CXJ A;  1HQV A;  2PAL A;  3BOW A;  4I5J A;  2K0J A;  1NCY A;  3TDI A;  2OPO A;  5HKZ A;  1EXR A;  3PN7 C;  2JT3 A;  4XJK A;  2KYC A;  2K7C A;  2Y1N A;  1UHH A;  1B47 A;  1QAS A;  1NIW A;  3WNX B;  1WRZ A;  4BY5 A;  1B8R A;  2A4J A;  1SBJ A;  4DUQ A;  1DJG A;  2L0P A;  1KCY A;  4YGE B;  3D0Y A;  1JBA A;  3O2P A;  1CMG A;  1FI6 A;  3KEV A;  4OCI A;  2Y5I A;  1QJT A;  2JTT A;  4OV2 A;  4NDB A;  1A2X A;  1C7V A;  1BOD A;  1UHN A;  4M2Q A;  1G4Y R;  2L5X B;  1SL9 A;  3PAT A;  2ZFD A;  2OS8 C;  1B1G A;  2LHL A;  1BOC A;  1KFU L;  1YUR A;  3SJS A;  1J7P A;  3DVJ A;  3CS1 A;  4MEW A;  5K89 A;  4WQ2 A;  1DJY A;  2H61 C;  2PVB A;  1K8U A;  2Q4U A;  3VRO A;  4UPG A;  4DRW A;  4U8D A;  2RGI A;  5GQQ C;  1TNP A;  2LHI A;  1JF0 A;  5ER5 A;  1MWN A;  1CLB A;  4WRI A;  2ZN8 A;  1DMO A;  1XFV O;  3JVT C;  3SG7 A;  5DKR A;  2LMT A;  3O6B A;  1KWO B;  2KNE A;  1QLS A;  2AUC A;  1SR6 C;  1TRF A;  2KOT A;  2MLF C;  1F55 A;  2LP2 A;  2JXC A;  4E68 A;  1EH2 A;  1JWD A;  2KI4 C;  3PN7 B;  1CTR A;  1W7J B;  2G2B A;  3EKJ A;  1ALW A;  1QTX A;  1BMO A;  3BYA A;  1NWD A;  2KI6 D;  1GGW A;  4AOM A;  1CNP A;  3LK0 A;  3GK2 A;  1KSO A;  2LV7 A;  2ZN9 A;  3I5H C;  5HKW A;  3KO0 A;  1DGU A;  1NPQ A;  1SKT A;  5AXI A;  3NSO A;  3TDZ A;  4PE7 A;  4GGF C;  5KU1 A;  1TIZ A;  4DS7 A;  1JFJ A;  3DVM A;  1SRA A;  2KQ6 A;  3O4Y A;  1DVI A;  1K94 A;  1WDC C;  4PHM A;  3CGA A;  1QIW A;  3AAJ A;  1TTX A;  1B8L A;  1K90 D;  1CLM A;  3NSK A;  4QJ5 B;  2QAC A;  2COL B;  2LP3 A;  1YUS A;  1WLM A;  5CSJ A;  1F70 A;  1JFK A;  2BEC A;  3EVU A;  4YBH B;  2I94 A;  3RM1 A;  4R1E A;  4DCK A;  3ZWH A;  5DKN A;  1MXE A;  2ZRS A;  4ICB A;  4AQI A;  5HKY A;  5JOL A;  2O5G A;  5CSN A;  5CPV A;  4N1F A;  2MRD A;  2BE4 A;  1BJF A;  1H8B A;  1IRJ A;  1XVJ A;  1V1G A;  2BBM A;  1JF2 A;  4HSZ A;  1IJ5 A;  2K8M B;  4MLW A;  3VRN A;  1A03 A;  1FW4 A;  2JWW A;  3OB1 B;  2Q91 A;  2JT8 A;  1XA5 A;  2KI4 B;  2O60 A;  3WHT B;  2L4I A;  2BKH B;  1L2O B;  2BKI B;  3AKB A;  2LE9 B;  4F0Z B;  1CFD A;  4HRG A;  4NDC A;  1NCZ A;  1SK6 D;  1DJX A;  2Y4Q A;  4M2P A;  1LKJ A;  4JQ0 D;  3BUX B;  2LLS A;  2NZ0 A;  4ETO A;  4PHJ A;  5IBW A;  3BUM B;  2BL0 B;  4P5O E;  1XK4 C;  1FI5 A;  1RTP 1;  1XYD A;  3CR4 X;  1YVL A;  1MHO A;  1QAT A;  3ZNI A;  1KWO C;  3IQO A;  1KK7 Z;  4JPZ B;  1EL4 A;  3ICB A;  2NLN A;  1PVA A;  1B8C A;  1SYM A;  1YRU B;  3LL8 B;  5FYX A;  2KYF A;  1TOP A;  1TCO B;  1QIV A;  2PMY A;  1ODB A;  1CFF A;  2F8P A;  1UHI A;  1SL8 A;  1MR8 A;  3NSL A;  2BCX A;  2JRF A;  2L51 A;  5I2O A;  1EG3 A;  5AFP A;  2M9G A;  1Y1A A;  2CT9 A;  2LLU A;  3NSI A;  1NSH A;  1DF0 B;  1S6C A;  2KGB C;  3SG6 A;  3TUY B;  1Y1U A;  3KF9 A;  5HLO A;  5CSF A;  2I7A A;  2FCD A;  2MLE C;  1CMF A;  3DF0 A;  3EK4 A;  1F8H A;  1ZFS A;  2WND A;  4ORB B;  3AKA A;  4PAL A;  3GOF A;  2HQW A;  1DJZ A;  3AAK A;  4GPL B;  4PDZ A;  3OX5 A;  1UHJ A;  5BPJ A;  2LVV A;  4WQ3 A;  1M46 A;  2LCP A;  3SIA A;  2FCE A;  2WC8 A;  1B7T Z;  3K21 A;  1ALV A;  1A75 B;  1IG5 A;  1PSB A;  1SMG A;  1KK8 B;  2GV5 A;  1NX0 A;  2LNK A;  5D69 A;  2LAP A;  3VGO A;  1CDP A;  2PAS A;  4YRU A;  2ZND A;  2CCM A;  4OKH A;  1MUX A;  2H61 A;  4A4B A;  2M8U A;  1V1F A;  4P2Y B;  1QVI Z;  1L7Z A;  5PAL A;  2F3Z A;  2M1K B;  1KK7 Y;  1K95 A;  2G9B A;  1AHR A;  1PAL A;  1LA0 A;  2WOR A;  4GAO A;  1L2O C;  4D1E A;  2KFF A;  5KTY A;  1SW8 A;  1F71 A;  5AEQ A;  3BOW B;  1PRW A;  1EJ3 A;  3CWG A;  2BCA A;  1XFX O;  1KQM B;  1TNX A;  4XJK B;  1A29 A;  2JPT A;  1YTZ C;  2HF5 A;  1BU3 A;  5TNC A;  1HT9 A;  1YUU A;  2BL0 C;  3PAL A;  5ER4 X;  2VRG A;  3A4U B;  1LXF C;  1SL7 A;  2LUC A;  1U5I A;  1UHK A;  3SG4 A;  3WXA A;  1Y1X A;  4XYN A;  2LVK A;  3D0Y B;  1K96 A;  5I2Q A;  1FF1 A;  3KHE A;  2F3Y A;  1NCX A;  2ZNE A;  4GGF A;  4MZK A;  5I2L A;  1C7W A;  2JTZ A;  3KPX A;  1S5G Z;  2P6B B;  1QV0 A;  2JU0 A;  1IQ3 A;  1QX7 A;  2FJU B;  1R6P A;  3OP0 A;  3FIA A;  2L98 A;  1TN4 A;  1Y6W A;  2H2K A;  1MQ1 A;  5D7F A;  2SCP A;  1IKU A;  2M3W A;  1IJ6 A;  2OTG C;  1WLZ A;  1ZUZ A;  3GK1 A;  2JXL A;  1B7T Y;  1S6J A;  4TNC A;  3QRX A;  1S36 A;  2LC5 A;  1IH0 A;  1QS7 A;  4NQG A;  3TUY C;  3TS5 B;  1IQ5 A;  1MXL C;  1J55 A;  1DJW A;  4FTG A;  4MSP A;  3BUN B;  4YGD B;  1J1E A;  1SPY A;  2MJW B;  3C1V A;  4C0L A;  1R2U A;  1TNW A;  1JUO A;  1S3P A;  2L2E A;  5DKQ A;  3I5I C;  1DT7 B;  1UP5 A;  2M7L A;  2M29 A;  1F4Q A;  1QVI Y;  3PM8 A;  2AAO A;  3BUO B;  4C0K A;  1FBV A;  1BT6 A;  3VRR A;  4GGN A;  2CBL A;  1YR5 A;  1S1E A;  2HPS A;  4ZCU A;  1CDN A;  1OOJ A;  2ISD A;  2M49 B;  4CID A;  3IQQ A;  5F6T A;  2CTN A;  3LCP C;  2LVJ A;  1KFU S;  2NXQ A;  1AUI B;  2K7D A;  5JJG A;  1RK9 A;  5B8I B;  1DGV A;  1KK8 C;  4YI9 A;  2K7B A;  2DOQ A;  4IL1 A;  1RWY A;  1B4C A;  1J7Q A;  3CR2 A;  4YGC B;  2MAZ A;  1OZO A;  4MBE A;  2IS9 A;  2BCB A;  4QJ4 B;  1AJ4 A;  3IF7 A;  1CLL A;  1XK4 A;  4DIR A;  2NCO A;  2M97 A;  3SG3 A;  3FS7 A;  1A4P A;  1PK0 D;  1RFJ A;  2KBM A;  3LK1 A;  5I8N A;  1WY9 A;  2EHB A;  5G08 A;  1XFU O;  4JWQ A;  1S5G Y;  1TCF A;  1GQM A;  2LUX A;  2KAY A;  4GBA A;  2OTG B;  1PVB A;  1KQM C;  2M0R A;  1NP8 A;  4PHK A;  4HRE E;  1CDM A;  2EC6 C;  2QPT A;  1Y0V H;  3EK8 A;  5J3X A;  4PE4 A;  4PCW A;  2JNX A;  1KFX S;  2L50 A;  1REC A;  1YVH A;  1B9A A;  4YI8 A;  1CM1 A;  1OMV A;  1QX2 A;  1YX7 A;  2NCP A;  3I5I B;  4CPV A;  2L4H A;  2KSP A;  1NX2 A;  1XFZ O;  1CFC A;  3RLZ A;  2JUL A;  1JC2 A;  1S6I A;  3BXK A;  1BR1 B;  1AVS A;  2ZRT A;  3PFV A;  3I5G B;  1QLK A;  1RJV A;  4OVN F;  2FOT A;  4PHN A;  1PUL A;  1BLQ A;  1UWO A;  1H4B A;  1YUT A;  1OSA A;  2EGD A;  1KSM A;  2HQ8 A;  2LAN A;  1YRT B;  3TZ1 A;  2F2P A;  1IGV A;  4OR9 B;  1G33 A;  2WCB A;  3I5F B;  4YGA A;  2KAV A;  4L9M A;  3TS5 C;  3OB2 B;  3SG2 A;  2MA2 A;  1XFW O;  3CZT X;  2KHN A;  3VRP A;  1NUB A;  3DVE A;  2LMV A;  4I5K A;  5HYD A;  2SAS A;  4PE1 A;  1K9P A;  1GGZ A;  5CSI A;  3LLE A;  2LVI A;  3EVV A;  1F4O A;  4ORC B;  4AQJ A;  2KBI A;  1DTL A;  1OZS A;  3HX4 A;  3WHU B;  3E3R A;  4USL A;  1OMD A;  1AP4 A;  1K2H A;  1CB1 A;  1N2D A;  1WRL A;  1NX1 A;  2PSR A;  4N5X A;  1S26 D;  1OE9 B;  3OX6 A;  4FQO A;  2K2F A;  2EC6 B;  1DJH A;  2F33 A;  1DJI A;  4I5N B;  1N65 A;  3EK7 A;  1CDL A;  1QX5 B;  2I18 A;  2PRU A;  2LM5 A;  2KFG A;  3EVR A;  3A8R A;  1AJ5 A;  3PLF B;  2B1U A;  2Y1M A;  4BY4 A;  2TN4 A;  3D10 A;  3O78 A;  1WRK A;  2JNF A;  3SG5 A;  1G8I A;  2HET A;  1LA3 A;  3CR5 X;  4CFQ A;  1LIN A;  2E6W A;  1CM4 A;  1E8A A;  3MSE B;  3NXA A;  3F45 A;  2KFH A;  2GGM A;  1XO5 A;  2LMU A;  3CTN A;  4MRX A;  1BG1 A;  1F54 A;  3PSR A;  1NX3 A;  4MRY A;  3DF0 B;  2GGZ A;  3GK4 X;  5AAN A;  5KSZ A;  1GJY A;  1KFX L;  2LLT A;  1SCM C;  1LVC D;  1M31 A;  3TDU A;  4GFT A;  3EKH A;  4C0J A;  1SY9 A;  1K9U A;  1SNL A;  2K61 A;  2MHH A;  1N0Y A;  3CLN A;  4GUK A;  4GNK B;  5HLV A;  1OQP A;  1MF8 B;  3JTD C;  3OHM B;  1PSR A;  2KAX A;  1VRK A;  2E30 A;  1C07 A;  4YGB B;  3BUW B;  4PE0 A;  2MBX A;  2OS8 B;  2WCE A;  3SIB A;  3VRQ A;  1UUR A;  3M0W A;  1QV1 A;  3BQ3 A;  4Q04 A;  2JZI A;  1RRO A;  2KI6 C;  2ZKM X;  3FWB A;  1DF0 A;  4CFR A;  1W7I B;  4HRH A;  3FWC A;  2CNP A;  1M45 A;  2JOJ A;  1IWQ A;  2AMI A;  3I5G C;  4N1G A;  2M1U A;  1TNQ A;  2JQ6 A;  4ORA B;  1KQV A;  1JSA A;  1EG4 A;  3JVT B;  4MN0 A;  2KGR A;  1D1O A;  1CFP A;  1BF5 A;  3DVK A;  1BR4 B;  1NYA A;  5AER A;  1QXP A;  1SR6 B;  2R2I A;  1M63 B;  4MZL A;  3I5F C;  1J1D A;  2BE6 A;  4I5L B;  2I2R E;  3HCM A;  1Q80 A;  1K9K A;  2M7N A;  1ZOT B;  1ZMZ A;  2K2A A;  2K7O A;  4CLN A;  1ZAC A;  1OMR A;  1A75 A;  1CKK A;  1U5I B;  2D8N A; 
#chains in the Genus database with same CATH topology
 2JC2 A;  2KQY A;  4A4C A;  1XFY O;  1FPW A;  2F2O A;  3CZ2 A;  4M2O A;  2K60 A;  1X02 A;  1SCM B;  1SSE B;  1TUZ A;  1UUS A;  3I5H B;  1DEL A;  2KDH A;  3R1O A;  3CZ0 A;  4ZCV A;  1M39 A;  1AK8 A;  1J7O A;  2WOS A;  2JT0 A;  2V53 A;  3H4S E;  1YX8 A;  2BBN A;  3JTD B;  1K93 D;  4QJ3 B;  4NDD A;  4MZJ A;  4MVF A;  3CYZ A;  2BAP A;  1SCV A;  3OBV A;  4JKT A;  1J7R A;  1WDC B;  2QEO A;  2WCF A;  3DD4 A;  2CXJ A;  1HQV A;  2PAL A;  3BOW A;  4I5J A;  2JPO A;  2K0J A;  1NCY A;  3B7A A;  3TDI A;  2OPO A;  5HKZ A;  1EXR A;  3PN7 C;  2JT3 A;  4XJK A;  2KYC A;  2K7C A;  2Y1N A;  1UHH A;  1B47 A;  1QAS A;  1NIW A;  3WNX B;  1WRZ A;  4BY5 A;  1B8R A;  2A4J A;  2P70 A;  1SBJ A;  4DUQ A;  4PT1 A;  1DJG A;  3D75 A;  3IVT A;  2L0P A;  1KCY A;  4YGE B;  3D0Y A;  1JBA A;  3O2P A;  1CMG A;  1FI6 A;  3KEV A;  4OCI A;  2Y5I A;  1QJT A;  2JTT A;  4OV2 A;  3VB1 A;  4NDB A;  1A2X A;  1C7V A;  1BOD A;  1UHN A;  3Q8I A;  5DIC A;  4M2Q A;  1G4Y R;  2L5X B;  1SL9 A;  3PAT A;  2ZFD A;  3PJI A;  4F7F A;  3CAB A;  2OS8 C;  1B1G A;  3SS3 A;  2LHL A;  1BOC A;  1KFU L;  1YUR A;  3SJS A;  1J7P A;  3DVJ A;  3CS1 A;  4MEW A;  5K89 A;  4WQ2 A;  1DJY A;  2H61 C;  2PVB A;  3SS5 A;  1K8U A;  2Q4U A;  3VRO A;  4UPG A;  4DRW A;  4U8D A;  2RGI A;  5GQQ C;  1TNP A;  2LHI A;  1JF0 A;  5ER5 A;  1MWN A;  1CLB A;  4WRI A;  2ZN8 A;  1DMO A;  1XFV O;  3JVT C;  3SG7 A;  5DKR A;  2LMT A;  3O6B A;  1KWO B;  2KNE A;  1QLS A;  2AUC A;  1SR6 C;  1TRF A;  2KOT A;  2MLF C;  1IIO A;  2WC6 A;  1F55 A;  2LP2 A;  2JXC A;  4E68 A;  1EH2 A;  1JWD A;  2KI4 C;  2WCJ A;  3PN7 B;  1CTR A;  1W7J B;  1OOG A;  2G2B A;  1XFR A;  3EKJ A;  1ALW A;  1QTX A;  1BMO A;  3BYA A;  1NWD A;  2KI6 D;  1GGW A;  4AOM A;  1CNP A;  3LK0 A;  3GK2 A;  3B88 A;  1KSO A;  2LV7 A;  2ZN9 A;  3I5H C;  5HKW A;  3KO0 A;  4INX A;  1DGU A;  1NPQ A;  1SKT A;  3NHT A;  3NSO A;  5AXI A;  2WCH A;  3S0E A;  4PE7 A;  3TDZ A;  4GGF C;  5KU1 A;  1TIZ A;  4DS7 A;  1JFJ A;  1OOI X;  3DVM A;  1SRA A;  2KQ6 A;  3DYE A;  3O4Y A;  1DVI A;  1K94 A;  5EL2 A;  1WDC C;  4PHM A;  3CGA A;  3V2L A;  1QWV A;  1Z4H A;  1QIW A;  3AAJ A;  1TTX A;  1B8L A;  1K90 D;  1CLM A;  3NSK A;  4QJ5 B;  2QAC A;  2COL B;  2LP3 A;  1YUS A;  1WLM A;  5CSJ A;  1F70 A;  1JFK A;  1OW4 A;  3FE6 A;  2BEC A;  3EVU A;  4YBH B;  2I94 A;  3RM1 A;  4R1E A;  4DCK A;  3B87 A;  3ZWH A;  5DKN A;  1MXE A;  2QDI A;  2ZRS A;  4ICB A;  4INW A;  4AQI A;  5HKY A;  5JOL A;  2WCL A;  5D3O A;  2O5G A;  5CSN A;  3R72 A;  5CPV A;  4N1F A;  2MRD A;  2BE4 A;  1BJF A;  1H8B A;  1IRJ A;  1XVJ A;  3NGV A;  3D74 A;  1V1G A;  2BBM A;  1JF2 A;  4HSZ A;  1IJ5 A;  2K8M B;  2WC5 A;  4MLW A;  3VRN A;  1FW4 A;  1A03 A;  2JWW A;  3OB1 B;  2Q91 A;  2JT8 A;  1XA5 A;  2KI4 B;  2O60 A;  3WHT B;  2L4I A;  2BKH B;  1L2O B;  2BKI B;  5FI6 A;  3AKB A;  3QME A;  5FI2 A;  3L4A A;  2LE9 B;  2BNX A;  4F0Z B;  1CFD A;  4HRG A;  3DXL A;  1NCZ A;  1SK6 D;  4NDC A;  1DJX A;  2Y4Q A;  2KLE A;  4M2P A;  1LKJ A;  3D73 A;  4JQ0 D;  3BUX B;  3S0D A;  2LLS A;  2NZ0 A;  4ETO A;  4PHJ A;  5IBW A;  3BUM B;  2BL0 B;  4P5O E;  1XK4 C;  1FI5 A;  1RTP 1;  2PQL A;  1XYD A;  3CR4 X;  1GM0 A;  1YVL A;  1MHO A;  1QAT A;  3ZNI A;  3BJH A;  4IJ7 A;  3EG5 B;  1KWO C;  3R1P A;  3IQO A;  1KK7 Z;  4JPZ B;  1EL4 A;  3ICB A;  4OZD A;  1C3Z A;  1C3Y A;  1OOH A;  2NLN A;  1PVA A;  1B8C A;  1SYM A;  1YRU B;  2YGU A;  3LL8 B;  5FYX A;  2KYF A;  1TOP A;  1TCO B;  1QIV A;  2PMY A;  1ODB A;  1CFF A;  3R1V A;  3D77 A;  2F8P A;  1UHI A;  3CDN A;  1SL8 A;  1MR8 A;  3NSL A;  2BCX A;  2JRF A;  2L51 A;  3S0F A;  5I2O A;  1EG3 A;  5AFP A;  2M9G A;  1Y1A A;  2CT9 A;  2LLU A;  3NSI A;  1NSH A;  1DF0 B;  1S6C A;  2KGB C;  3SG6 A;  3TUY B;  1Y1U A;  3KF9 A;  5HLO A;  5CSF A;  2I7A A;  2FCD A;  2MLE C;  1CMF A;  3DF0 A;  3EK4 A;  1F8H A;  3N7H A;  1ZFS A;  2WND A;  4ORB B;  3O4X A;  3AKA A;  4PAL A;  3GOF A;  2HQW A;  2PYQ A;  1DJZ A;  3AAK A;  4GPL B;  4PDZ A;  1LS8 A;  3OX5 A;  1UHJ A;  5BPJ A;  3BFB A;  2LVV A;  4WQ3 A;  1M46 A;  2LCP A;  3SIA A;  2FCE A;  2WC8 A;  1B7T Z;  2L2C A;  3K21 A;  3K1E A;  1ALV A;  1A75 B;  1TUJ A;  1IG5 A;  1PSB A;  1SMG A;  1KK8 B;  2GV5 A;  1NX0 A;  2LNK A;  5D69 A;  2LAP A;  3VGO A;  1CDP A;  2PAS A;  4YRU A;  2ZND A;  2CCM A;  2WCK A;  3B6X A;  4OKH A;  1MUX A;  2H61 A;  2L5Y A;  4A4B A;  2M8U A;  1V1F A;  4P2Y B;  1QVI Z;  1L7Z A;  5PAL A;  2F3Z A;  1DC1 A;  2M1K B;  1KK7 Y;  1K95 A;  2G9B A;  1AHR A;  1PAL A;  1LA0 A;  2WOR A;  4GAO A;  1L2O C;  4D1E A;  2KFF A;  5KTY A;  1SW8 A;  1F71 A;  2KLD A;  5AEQ A;  3BOW B;  1PRW A;  1EJ3 A;  3CWG A;  2BCA A;  1XFX O;  1KQM B;  1TNX A;  4XJK B;  1A29 A;  2JPT A;  1YTZ C;  2HF5 A;  1BU3 A;  5TNC A;  1HT9 A;  1YUU A;  2BL0 C;  3PAL A;  5ER4 X;  2VRG A;  3A4U B;  1LXF C;  1SL7 A;  2LUC A;  1U5I A;  5FI7 A;  1UHK A;  4BY4 A;  3SG4 A;  3WXA A;  1Y1X A;  3CZ1 A;  4XYN A;  2LVK A;  3D0Y B;  1K96 A;  5I2Q A;  1FF1 A;  2P71 A;  2QEB A;  3KHE A;  2F3Y A;  1NCX A;  2ZNE A;  4GGF A;  4MZK A;  5I2L A;  1C7W A;  2JTZ A;  3KPX A;  1S5G Z;  3NHI A;  2P6B B;  1QV0 A;  2JU0 A;  1IQ3 A;  1QX7 A;  2FJU B;  1R6P A;  3OP0 A;  3FIA A;  3UO9 A;  2L98 A;  1TN4 A;  1Y6W A;  2H2K A;  1MQ1 A;  5D7F A;  2SCP A;  1IKU A;  2M3W A;  1IJ6 A;  2OTG C;  1WLZ A;  1ZUZ A;  3BFH A;  3GK1 A;  2JXL A;  1B7T Y;  1S6J A;  4TNC A;  3QRX A;  1S36 A;  2LC5 A;  1IH0 A;  1QS7 A;  4NQG A;  3TUY C;  3TS5 B;  1IQ5 A;  1MXL C;  1P28 A;  1J55 A;  1DJW A;  4FTG A;  4MSP A;  3BUN B;  2ERB A;  1J1E A;  1SPY A;  2MJW B;  4YGD B;  3C1V A;  4C0L A;  1DQE A;  1R2U A;  1TNW A;  1JUO A;  1S3P A;  2L2E A;  5DKQ A;  3I5I C;  1DT7 B;  1UP5 A;  2M7L A;  2M29 A;  1F4Q A;  1QVI Y;  3PM8 A;  2AAO A;  3BUO B;  4C0K A;  1FBV A;  1BT6 A;  3VRR A;  4GGN A;  2CBL A;  1YR5 A;  1S1E A;  2HPS A;  4ZCU A;  1CDN A;  1OOJ A;  2ISD A;  1W9Z A;  2M49 B;  4CID A;  3IQQ A;  5F6T A;  3S0G A;  2CTN A;  3LCP C;  2LVJ A;  1OOF A;  1KFU S;  2QEV A;  2GTE A;  2NXQ A;  1AUI B;  2K7D A;  5JJG A;  1RK9 A;  5B8I B;  1DGV A;  1KK8 C;  4YI9 A;  2K7B A;  2DOQ A;  4IL1 A;  1RWY A;  1B4C A;  1J7Q A;  3CR2 A;  4YGC B;  2MAZ A;  1OZO A;  4MBE A;  2IS9 A;  2BCB A;  4QJ4 B;  1AJ4 A;  3IF7 A;  1CLL A;  1XK4 A;  4DIR A;  2NCO A;  2M97 A;  3SG3 A;  5I94 A;  3L4L A;  3FS7 A;  1A4P A;  1PK0 D;  1RFJ A;  2KBM A;  3LK1 A;  5I8N A;  1WY9 A;  2EHB A;  5G08 A;  1XFU O;  4JWQ A;  2KPH A;  1S5G Y;  1TCF A;  1GQM A;  2LUX A;  2KAY A;  4GBA A;  2OTG B;  1PVB A;  1KQM C;  2M0R A;  1NP8 A;  1TWO A;  4PHK A;  1DEK A;  4HRE E;  1CDM A;  2EC6 C;  2QPT A;  1Y0V H;  3EK8 A;  5J3X A;  4PE4 A;  4PCW A;  2JNX A;  1KFX S;  2L50 A;  1REC A;  1YVH A;  1B9A A;  4YI8 A;  1CM1 A;  1OMV A;  1QX2 A;  1YX7 A;  2NCP A;  3I5I B;  4CPV A;  2L4H A;  2KSP A;  1NX2 A;  3UNW A;  1XFZ O;  1CFC A;  3RLZ A;  2JUL A;  1JC2 A;  1S6I A;  3BXK A;  1BR1 B;  1AVS A;  2ZRT A;  3PFV A;  3S0A A;  3I5G B;  1QLK A;  1RJV A;  4JD9 A;  4OVN F;  2FOT A;  4PHN A;  1PUL A;  1BLQ A;  1UWO A;  1H4B A;  1YUT A;  1OSA A;  2EGD A;  1KSM A;  2HQ8 A;  2LAN A;  1YRT B;  3TZ1 A;  2F2P A;  1IGV A;  4OR9 B;  2QEH A;  1G33 A;  2WCB A;  3I5F B;  4YGA A;  2KAV A;  4L9M A;  3TS5 C;  3D76 A;  3OB2 B;  3SG2 A;  2MA2 A;  1XFW O;  3CZT X;  2KHN A;  3VRP A;  1NUB A;  3DVE A;  2LMV A;  4I5K A;  5HYD A;  2SAS A;  4PE1 A;  1K9P A;  1GGZ A;  5CSI A;  3LLE A;  2LVI A;  3EVV A;  1F4O A;  4ORC B;  4AQJ A;  2KBI A;  1DTL A;  1OZS A;  3HX4 A;  3S0B A;  3WHU B;  3E3R A;  4USL A;  1OMD A;  1AP4 A;  1K2H A;  1CB1 A;  1N2D A;  1WRL A;  1NX1 A;  2PSR A;  4N5X A;  1S26 D;  1OE9 B;  2H8V A;  3OX6 A;  4FQO A;  5HL1 A;  2K2F A;  3B86 A;  2EC6 B;  1DJH A;  2F33 A;  1DJI A;  4I5N B;  1N65 A;  3EK7 A;  1CDL A;  1QX5 B;  2I18 A;  2PRU A;  2LM5 A;  2KFG A;  3EVR A;  3A8R A;  1AJ5 A;  3PLF B;  2B1U A;  2Y1M A;  3FE9 A;  2TN4 A;  3D10 A;  3O78 A;  1WRK A;  2JNF A;  3D78 A;  3SG5 A;  1G8I A;  2HET A;  1LA3 A;  3CR5 X;  4CFQ A;  1LIN A;  2E6W A;  1CM4 A;  1E8A A;  3MSE B;  3NXA A;  1Z2C B;  2KFH A;  2GGM A;  3F45 A;  1XO5 A;  2LMU A;  3CTN A;  3PM2 A;  4MRX A;  1BG1 A;  3PSR A;  1NX3 A;  4MRY A;  1F54 A;  3DF0 B;  2GGZ A;  3GK4 X;  5AAN A;  5KSZ A;  1GJY A;  1KFX L;  2LLT A;  1SCM C;  1LVC D;  1M31 A;  3TDU A;  4GFT A;  3EKH A;  4C0J A;  1SY9 A;  1K9U A;  1SNL A;  2K61 A;  2MHH A;  1N0Y A;  3CLN A;  4GUK A;  4GNK B;  5HLV A;  1OQP A;  1MF8 B;  3BFA A;  3L47 A;  3JTD C;  3OHM B;  2WCM A;  1PSR A;  2KAX A;  2FJY A;  1VRK A;  2E30 A;  1ORG A;  3DZT A;  1C07 A;  4YGB B;  3BUW B;  4PE0 A;  2MBX A;  2OS8 B;  2WCE A;  3SIB A;  3VRQ A;  1UUR A;  4FQT A;  3M0W A;  4KYN A;  1QV1 A;  3BQ3 A;  3FE8 A;  2JZI A;  4Q04 A;  1RRO A;  2KI6 C;  2ZKM X;  3FWB A;  1DF0 A;  4CFR A;  1W7I B;  4HRH A;  3FWC A;  3OGN A;  2CNP A;  1M45 A;  2JOJ A;  3DY9 A;  1IWQ A;  2AMI A;  3I5G C;  4N1G A;  2M1U A;  1TNQ A;  2JQ6 A;  4ORA B;  1KQV A;  1JSA A;  1EG4 A;  3JVT B;  4MN0 A;  2KGR A;  1D1O A;  3SS4 A;  1CFP A;  1BF5 A;  3RZS A;  1T14 A;  3DVK A;  1BR4 B;  1NYA A;  5AER A;  1QXP A;  1SR6 B;  2R2I A;  1M63 B;  4MZL A;  3I5F C;  1J1D A;  2BE6 A;  4I5L B;  2I2R E;  3HCM A;  1Q80 A;  1K9K A;  2M7N A;  1ZOT B;  1ZMZ A;  2K2A A;  2K7O A;  4CLN A;  1ZAC A;  1OMR A;  1A75 A;  1CKK A;  1U5I B;  2D8N A; 
#chains in the Genus database with same CATH homology
 2JC2 A;  2KQY A;  4A4C A;  1XFY O;  1FPW A;  2F2O A;  4M2O A;  1X02 A;  1SCM B;  3I5H B;  1UUS A;  2KDH A;  4ZCV A;  1M39 A;  1AK8 A;  1J7O A;  2WOS A;  2JT0 A;  2V53 A;  3H4S E;  1YX8 A;  2BBN A;  3JTD B;  1K93 D;  4QJ3 B;  4NDD A;  4MZJ A;  4MVF A;  1SCV A;  1J7R A;  1WDC B;  2WCF A;  3DD4 A;  2CXJ A;  1HQV A;  2PAL A;  3BOW A;  4I5J A;  2K0J A;  1NCY A;  3TDI A;  2OPO A;  5HKZ A;  1EXR A;  3PN7 C;  2JT3 A;  4XJK A;  2KYC A;  2K7C A;  2Y1N A;  1UHH A;  1B47 A;  1QAS A;  1NIW A;  3WNX B;  1WRZ A;  4BY5 A;  1B8R A;  2A4J A;  1SBJ A;  4DUQ A;  1DJG A;  2L0P A;  1KCY A;  4YGE B;  3D0Y A;  1JBA A;  3O2P A;  1CMG A;  1FI6 A;  3KEV A;  4OCI A;  2Y5I A;  1QJT A;  2JTT A;  4OV2 A;  4NDB A;  1A2X A;  1C7V A;  1BOD A;  1UHN A;  4M2Q A;  1G4Y R;  2L5X B;  1SL9 A;  3PAT A;  2ZFD A;  2OS8 C;  1B1G A;  2LHL A;  1BOC A;  1KFU L;  1YUR A;  3SJS A;  1J7P A;  3DVJ A;  3CS1 A;  4MEW A;  5K89 A;  4WQ2 A;  1DJY A;  2H61 C;  2PVB A;  1K8U A;  2Q4U A;  3VRO A;  4UPG A;  4DRW A;  4U8D A;  2RGI A;  5GQQ C;  1TNP A;  2LHI A;  1JF0 A;  5ER5 A;  1MWN A;  1CLB A;  4WRI A;  2ZN8 A;  1DMO A;  1XFV O;  3JVT C;  3SG7 A;  5DKR A;  2LMT A;  3O6B A;  1KWO B;  2KNE A;  1QLS A;  2AUC A;  1SR6 C;  1TRF A;  2KOT A;  2MLF C;  1F55 A;  2LP2 A;  2JXC A;  4E68 A;  1EH2 A;  1JWD A;  2KI4 C;  3PN7 B;  1CTR A;  1W7J B;  2G2B A;  3EKJ A;  1ALW A;  1QTX A;  1BMO A;  3BYA A;  1NWD A;  2KI6 D;  1GGW A;  4AOM A;  1CNP A;  3LK0 A;  3GK2 A;  1KSO A;  2LV7 A;  2ZN9 A;  3I5H C;  5HKW A;  3KO0 A;  1DGU A;  1NPQ A;  1SKT A;  5AXI A;  3NSO A;  3TDZ A;  4PE7 A;  4GGF C;  5KU1 A;  1TIZ A;  4DS7 A;  1JFJ A;  3DVM A;  1SRA A;  2KQ6 A;  3O4Y A;  1DVI A;  1K94 A;  1WDC C;  4PHM A;  3CGA A;  1QIW A;  3AAJ A;  1TTX A;  1B8L A;  1K90 D;  1CLM A;  3NSK A;  4QJ5 B;  2QAC A;  2COL B;  2LP3 A;  1YUS A;  1WLM A;  5CSJ A;  1F70 A;  1JFK A;  2BEC A;  3EVU A;  4YBH B;  2I94 A;  3RM1 A;  4R1E A;  4DCK A;  3ZWH A;  5DKN A;  1MXE A;  2ZRS A;  4ICB A;  4AQI A;  5HKY A;  5JOL A;  2O5G A;  5CSN A;  5CPV A;  4N1F A;  2MRD A;  2BE4 A;  1BJF A;  1H8B A;  1IRJ A;  1XVJ A;  1V1G A;  2BBM A;  1JF2 A;  4HSZ A;  1IJ5 A;  2K8M B;  4MLW A;  3VRN A;  1A03 A;  1FW4 A;  2JWW A;  3OB1 B;  2Q91 A;  2JT8 A;  1XA5 A;  2KI4 B;  2O60 A;  3WHT B;  2L4I A;  2BKH B;  1L2O B;  2BKI B;  3AKB A;  2LE9 B;  4F0Z B;  1CFD A;  4HRG A;  4NDC A;  1NCZ A;  1SK6 D;  1DJX A;  2Y4Q A;  4M2P A;  1LKJ A;  4JQ0 D;  3BUX B;  2LLS A;  2NZ0 A;  4ETO A;  4PHJ A;  5IBW A;  3BUM B;  2BL0 B;  4P5O E;  1XK4 C;  1FI5 A;  1RTP 1;  1XYD A;  3CR4 X;  1YVL A;  1MHO A;  1QAT A;  3ZNI A;  1KWO C;  3IQO A;  1KK7 Z;  4JPZ B;  1EL4 A;  3ICB A;  2NLN A;  1PVA A;  1B8C A;  1SYM A;  1YRU B;  3LL8 B;  5FYX A;  2KYF A;  1TOP A;  1TCO B;  1QIV A;  2PMY A;  1ODB A;  1CFF A;  2F8P A;  1UHI A;  1SL8 A;  1MR8 A;  3NSL A;  2BCX A;  2JRF A;  2L51 A;  5I2O A;  1EG3 A;  5AFP A;  2M9G A;  1Y1A A;  2CT9 A;  2LLU A;  3NSI A;  1NSH A;  1DF0 B;  1S6C A;  2KGB C;  3SG6 A;  3TUY B;  1Y1U A;  3KF9 A;  5HLO A;  5CSF A;  2I7A A;  2FCD A;  2MLE C;  1CMF A;  3DF0 A;  3EK4 A;  1F8H A;  1ZFS A;  2WND A;  4ORB B;  3AKA A;  4PAL A;  3GOF A;  2HQW A;  1DJZ A;  3AAK A;  4GPL B;  4PDZ A;  3OX5 A;  1UHJ A;  5BPJ A;  2LVV A;  4WQ3 A;  1M46 A;  2LCP A;  3SIA A;  2FCE A;  2WC8 A;  1B7T Z;  3K21 A;  1ALV A;  1A75 B;  1IG5 A;  1PSB A;  1SMG A;  1KK8 B;  2GV5 A;  1NX0 A;  2LNK A;  5D69 A;  2LAP A;  3VGO A;  1CDP A;  2PAS A;  4YRU A;  2ZND A;  2CCM A;  4OKH A;  1MUX A;  2H61 A;  4A4B A;  2M8U A;  1V1F A;  4P2Y B;  1QVI Z;  1L7Z A;  5PAL A;  2F3Z A;  2M1K B;  1KK7 Y;  1K95 A;  2G9B A;  1AHR A;  1PAL A;  1LA0 A;  2WOR A;  4GAO A;  1L2O C;  4D1E A;  2KFF A;  5KTY A;  1SW8 A;  1F71 A;  5AEQ A;  3BOW B;  1PRW A;  1EJ3 A;  3CWG A;  2BCA A;  1XFX O;  1KQM B;  1TNX A;  4XJK B;  1A29 A;  2JPT A;  1YTZ C;  2HF5 A;  1BU3 A;  5TNC A;  1HT9 A;  1YUU A;  2BL0 C;  3PAL A;  5ER4 X;  2VRG A;  3A4U B;  1LXF C;  1SL7 A;  2LUC A;  1U5I A;  1UHK A;  3SG4 A;  3WXA A;  1Y1X A;  4XYN A;  2LVK A;  3D0Y B;  1K96 A;  5I2Q A;  1FF1 A;  3KHE A;  2F3Y A;  1NCX A;  2ZNE A;  4GGF A;  4MZK A;  5I2L A;  1C7W A;  2JTZ A;  3KPX A;  1S5G Z;  2P6B B;  1QV0 A;  2JU0 A;  1IQ3 A;  1QX7 A;  2FJU B;  1R6P A;  3OP0 A;  3FIA A;  2L98 A;  1TN4 A;  1Y6W A;  2H2K A;  1MQ1 A;  5D7F A;  2SCP A;  1IKU A;  2M3W A;  1IJ6 A;  2OTG C;  1WLZ A;  1ZUZ A;  3GK1 A;  2JXL A;  1B7T Y;  1S6J A;  4TNC A;  3QRX A;  1S36 A;  2LC5 A;  1IH0 A;  1QS7 A;  4NQG A;  3TUY C;  3TS5 B;  1IQ5 A;  1MXL C;  1J55 A;  1DJW A;  4FTG A;  4MSP A;  3BUN B;  4YGD B;  1J1E A;  1SPY A;  2MJW B;  3C1V A;  4C0L A;  1R2U A;  1TNW A;  1JUO A;  1S3P A;  2L2E A;  5DKQ A;  3I5I C;  1DT7 B;  1UP5 A;  2M7L A;  2M29 A;  1F4Q A;  1QVI Y;  3PM8 A;  2AAO A;  3BUO B;  4C0K A;  1FBV A;  1BT6 A;  3VRR A;  4GGN A;  2CBL A;  1YR5 A;  1S1E A;  2HPS A;  4ZCU A;  1CDN A;  1OOJ A;  2ISD A;  2M49 B;  4CID A;  3IQQ A;  5F6T A;  2CTN A;  3LCP C;  2LVJ A;  1KFU S;  2NXQ A;  1AUI B;  2K7D A;  5JJG A;  1RK9 A;  5B8I B;  1DGV A;  1KK8 C;  4YI9 A;  2K7B A;  2DOQ A;  4IL1 A;  1RWY A;  1B4C A;  1J7Q A;  3CR2 A;  4YGC B;  2MAZ A;  1OZO A;  4MBE A;  2IS9 A;  2BCB A;  4QJ4 B;  1AJ4 A;  3IF7 A;  1CLL A;  1XK4 A;  4DIR A;  2NCO A;  2M97 A;  3SG3 A;  3FS7 A;  1A4P A;  1PK0 D;  1RFJ A;  2KBM A;  3LK1 A;  5I8N A;  1WY9 A;  2EHB A;  5G08 A;  1XFU O;  4JWQ A;  1S5G Y;  1TCF A;  1GQM A;  2LUX A;  2KAY A;  4GBA A;  2OTG B;  1PVB A;  1KQM C;  2M0R A;  1NP8 A;  4PHK A;  4HRE E;  1CDM A;  2EC6 C;  2QPT A;  1Y0V H;  3EK8 A;  5J3X A;  4PE4 A;  4PCW A;  2JNX A;  1KFX S;  2L50 A;  1REC A;  1YVH A;  1B9A A;  4YI8 A;  1CM1 A;  1OMV A;  1QX2 A;  1YX7 A;  2NCP A;  3I5I B;  4CPV A;  2L4H A;  2KSP A;  1NX2 A;  1XFZ O;  1CFC A;  3RLZ A;  2JUL A;  1JC2 A;  1S6I A;  3BXK A;  1BR1 B;  1AVS A;  2ZRT A;  3PFV A;  3I5G B;  1QLK A;  1RJV A;  4OVN F;  2FOT A;  4PHN A;  1PUL A;  1BLQ A;  1UWO A;  1H4B A;  1YUT A;  1OSA A;  2EGD A;  1KSM A;  2HQ8 A;  2LAN A;  1YRT B;  3TZ1 A;  2F2P A;  1IGV A;  4OR9 B;  1G33 A;  2WCB A;  3I5F B;  4YGA A;  2KAV A;  4L9M A;  3TS5 C;  3OB2 B;  3SG2 A;  2MA2 A;  1XFW O;  3CZT X;  2KHN A;  3VRP A;  1NUB A;  3DVE A;  2LMV A;  4I5K A;  5HYD A;  2SAS A;  4PE1 A;  1K9P A;  1GGZ A;  5CSI A;  3LLE A;  2LVI A;  3EVV A;  1F4O A;  4ORC B;  4AQJ A;  2KBI A;  1DTL A;  1OZS A;  3HX4 A;  3WHU B;  3E3R A;  4USL A;  1OMD A;  1AP4 A;  1K2H A;  1CB1 A;  1N2D A;  1WRL A;  1NX1 A;  2PSR A;  4N5X A;  1S26 D;  1OE9 B;  3OX6 A;  4FQO A;  2K2F A;  2EC6 B;  1DJH A;  2F33 A;  1DJI A;  4I5N B;  1N65 A;  3EK7 A;  1CDL A;  1QX5 B;  2I18 A;  2PRU A;  2LM5 A;  2KFG A;  3EVR A;  3A8R A;  1AJ5 A;  3PLF B;  2B1U A;  2Y1M A;  4BY4 A;  2TN4 A;  3D10 A;  3O78 A;  1WRK A;  2JNF A;  3SG5 A;  1G8I A;  2HET A;  1LA3 A;  3CR5 X;  4CFQ A;  1LIN A;  2E6W A;  1CM4 A;  1E8A A;  3MSE B;  3NXA A;  3F45 A;  2KFH A;  2GGM A;  1XO5 A;  2LMU A;  3CTN A;  4MRX A;  1BG1 A;  1F54 A;  3PSR A;  1NX3 A;  4MRY A;  3DF0 B;  2GGZ A;  3GK4 X;  5AAN A;  5KSZ A;  1GJY A;  1KFX L;  2LLT A;  1SCM C;  1LVC D;  1M31 A;  3TDU A;  4GFT A;  3EKH A;  4C0J A;  1SY9 A;  1K9U A;  1SNL A;  2K61 A;  2MHH A;  1N0Y A;  3CLN A;  4GUK A;  4GNK B;  5HLV A;  1OQP A;  1MF8 B;  3JTD C;  3OHM B;  1PSR A;  2KAX A;  1VRK A;  2E30 A;  1C07 A;  4YGB B;  3BUW B;  4PE0 A;  2MBX A;  2OS8 B;  2WCE A;  3SIB A;  3VRQ A;  1UUR A;  3M0W A;  1QV1 A;  3BQ3 A;  4Q04 A;  2JZI A;  1RRO A;  2KI6 C;  2ZKM X;  3FWB A;  1DF0 A;  4CFR A;  1W7I B;  4HRH A;  3FWC A;  2CNP A;  1M45 A;  2JOJ A;  1IWQ A;  2AMI A;  3I5G C;  4N1G A;  2M1U A;  1TNQ A;  2JQ6 A;  4ORA B;  1KQV A;  1JSA A;  1EG4 A;  3JVT B;  4MN0 A;  2KGR A;  1D1O A;  1CFP A;  1BF5 A;  3DVK A;  1BR4 B;  1NYA A;  5AER A;  1QXP A;  1SR6 B;  2R2I A;  1M63 B;  4MZL A;  3I5F C;  1J1D A;  2BE6 A;  4I5L B;  2I2R E;  3HCM A;  1Q80 A;  1K9K A;  2M7N A;  1ZOT B;  1ZMZ A;  2K2A A;  2K7O A;  4CLN A;  1ZAC A;  1OMR A;  1A75 A;  1CKK A;  1U5I B;  2D8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...