1G8IA

Crystal structure of human frequenin (neuronal calcium sensor 1)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
187
structure length
182
Chain Sequence
SNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVLPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords NEURONAL CALCIUM SENSOR 1
publication title Immunocytochemical localization and crystal structure of human frequenin (neuronal calcium sensor 1).
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1g8iA02
4F0ZB 4MVFA 5HLVA 1IJ5A 3I5IB 1F55A 1A75A 1MXLC 1QX7A 2JULA 2PVBA 1A2XA 1NIWA 1M63B 3JVTB 1IH0A 1DJIA 1CDLA 1WRZA 1BT6A 2EHBA 1A03A 4ETOA 4OV2A 1SK6D 2L2EA 1DF0B 3K21A 2F3YA 5CSIA 2BKHB 1S26D 4PDZA 1K95A 4ZCUA 2COLB 1KFXS 1MXEA 4YI8A 4D1EA 1B9AA 2Y1MA 1TRFA 4PALA 1UHHA 1NX1A 1ZMZA 1SR6B 1RWYA 3ICBA 1DF0A 2KI6C 2KSPA 2CNPA 3O4YA 3PFVA 1SBJA 5PALA 5AERA 4YBHB 2KHNA 5I8NA 1E8AA 1Y1UA 4P2YB 1C7VA 2MLEC 1K2HA 1S5GY 1XFXO 2JNXA 3IQQA 2H2KA 4M2QA 2LANA 1RROA 3LL8B 1ALVA 1KFXL 3WXAA 2KDHA 3KF9A 1QIWA 1QJTA 1TNQA 2LAPA 2M0RA 2QACA 1R2UA 1CLLA 1KFUS 2PALA 1CFPA 2KFHA 1CFCA 2LM5A 1GGWA 5BPJA 2LV7A 1XFYO 1PSRA 2KBMA 3AKAA 4GAOA 1DTLA 1DGUA 1NP8A 1IG5A 3SG7A 1OZSA 2BL0C 5HKWA 3BUMB 3I5FC 3EKHA 4HRGA 1LA0A 2M97A 4R1EA 1X02A 1OOJA 1QV0A 3VROA 1BODA 1DJZA 1KFUL 1FF1A 3AAJA 4ORAB 2WORA 1G8IA 2PMYA 1YRUB 1XA5A 1IRJA 3EVRA 1CB1A 3OHMB 2K61A 1QS7A 2KQYA 2NZ0A 1M31A 1J7OA 4MRXA 1CFDA 1CTRA 2KBIA 5AXIA 2JNFA 2JXCA 1AJ4A 1K9KA 4WQ2A 1PVAA 3WHTB 2D8NA 1KWOC 2ZRSA 1CMFA 1QLKA 1MUXA 1ZUZA 4OR9B 2TN4A 1YUSA 1TNWA 1S6JA 2NXQA 1BR4B 4YGAA 1LINA 1CM1A 2L0PA 4YI9A 1KWOB 1VRKA 3A8RA 1B8CA 1CMGA 1QXPA 1QATA 2K7OA 1Y0VH 4PHJA 2MBXA 2JXLA 4E68A 2JOJA 1TIZA 1EJ3A 2FCDA 1YURA 2A4JA 2JC2A 1S1EA 4AQIA 3OP0A 2WNDA 4IL1A 4PE7A 4GPLB 5B8IB 4DIRA 1A29A 2I7AA 4PHNA 3D10A 3IF7A 3SIAA 3TS5B 1DT7B 1N65A 4OVNF 5ER5A 1IJ6A 1NWDA 3KPXA 1YR5A 1N0YA 1K8UA 1NCYA 2QPTA 2K7CA 3MSEB 3NSKA 1IKUA 3EVVA 2Q91A 3KO0A 3PM8A 4MZJA 4MEWA 1R6PA 3PN7C 5D69A 4FQOA 4NDDA 1TCOB 1SL9A 1QX2A 2L98A 1JUOA 4WRIA 3M0WA 1KSOA 4CFQA 3PN7B 2BCXA 2WOSA 1XK4A 2JWWA 3BUOB 2Y4QA 2LMUA 3BUNB 4MSPA 3CR4X 3RM1A 5HYDA 3SIBA 1N2DA 3SG4A 2VRGA 1JBAA 2I94A 3CTNA 3OX5A 3O78A 1WDCC 1AJ5A 2BBNA 2AAOA 2LVVA 1S3PA 1W7JB 2JQ6A 2L5XB 2Q4UA 1FW4A 2CT9A 4A4BA 1BJFA 1H8BA 3EVUA 1SY9A 1IGVA 1RJVA 1WDCB 3OB1B 4NQGA 2F8PA 1LVCD 4YGEB 2BE4A 5F6TA 1YUTA 4PE1A 5KTYA 1FI5A 4GNKB 4UPGA 2M1KB 2G2BA 5AANA 2KAVA 3H4SE 1W7IB 5CSJA 4YRUA 2KI4C 5CSFA 1RTP1 2LP3A 2M7NA 5J3XA 1FBVA 2FOTA 1TNPA 2BKIB 2BCBA 1FPWA 1B47A 2KI4B 1OZOA 1K9PA 3NXAA 1CDNA 1HQVA 1Y1AA 1YX7A 2LHIA 2V53A 1HT9A 1EXRA 2KAYA 1NSHA 2K2AA 1G33A 1QIVA 3I5HC 1CFFA 2DOQA 1SRAA 1B7TZ 2CXJA 2MHHA 3CWGA 4NDCA 4A4CA 3ZNIA 4GBAA 1L2OC 1BMOA 2L4HA 1YRTB 3EK4A 4JPZB 3I5HB 1LA3A 2KI6D 2L51A 2EC6C 3HX4A 2OS8C 2AMIA 4MZKA 4GUKA 1OQPA 1CDMA 1F4QA 1L2OB 4TNCA 4YGDB 1NUBA 2KQ6A 1KQVA 3A4UB 1QX5B 4M2PA 1PK0D 2LP2A 2MRDA 1RFJA 4ICBA 2OS8B 1AP4A 1UHIA 2JT0A 1OE9B 3CGAA 1TN4A 1MF8B 2HQWA 2KGBC 2F33A 1JFKA 3LK1A 1SKTA 4JQ0D 3CZTX 2KYCA 1F8HA 1NCXA 2JPTA 1J1EA 3CR5X 2ZN8A 3TDUA 3CLNA 1WY9A 2LNKA 2LCPA 1DJYA 3SG3A 2WCFA 3EK7A 4C0KA 3VGOA 2SASA 2BL0B 2I2RE 3I5FB 4PCWA 1DJWA 2PASA 2B1UA 2M8UA 2NCPA 1CLBA 2BBMA 1CNPA 1YVHA 1EG3A 4N1GA 2MAZA 2GGMA 2JT3A 1SCVA 2E6WA 3BUXB 3PSRA 2LLTA 1SPYA 4QJ5B 1MR8A 3DVKA 4N1FA 3GK2A 4BY4A 1K96A 1SW8A 3C1VA 2JZIA 5D7FA 1ZACA 3EKJA 1F71A 1ZFSA 1KSMA 4MZLA 1PSBA 1KQMC 1SYMA 4OKHA 1BF5A 1GQMA 1LXFC 1OMDA 2LVKA 3I5GC 1WRKA 4C0JA 1LKJA 2M9GA 1YTZC 5KSZA 3IQOA 1CDPA 1K9UA 1Y1XA 3GK1A 5IBWA 1KQMB 1AHRA 3BXKA 1DJGA 2LLUA 3DVMA 1S6CA 3F45A 4NDBA 2KFFA 5DKRA 1UP5A 4MN0A 4AOMA 2HF5A 4C0LA 1M45A 3FS7A 1BG1A 3D0YB 2M3WA 4OCIA 4WQ3A 1AUIB 2HETA 4M2OA 4QJ3B 2LMVA 1UUSA 4PE4A 1XO5A 1UWOA 1XFUO 2ZRTA 1KK8C 1ZOTB 3BOWB 1S36A 3D0YA 3WHUB 5FYXA 2LUCA 2HPSA 1IQ5A 4GGFC 2ZN9A 4XJKB 2F2PA 3DF0B 2JT8A 1CLMA 1NX2A 4PHMA 1M46A 1FI6A 1QLSA 3TZ1A 1JFJA 1BU3A 4GGNA 1G4YR 2KFGA 2OPOA 4HREE 3FWCA 2H61C 3KEVA 3DF0A 2SCPA 2O60A 1GJYA 1TCFA 1DMOA 3PATA 3NSIA 4CFRA 2L50A 1SL7A 4GGFA 1KK7Z 4GFTA 1A75B 1B4CA 4HSZA 3LK0A 4I5KA 5I2OA 1WRLA 4U8DA 2GGZA 3OX6A 4ZCVA 4CIDA 1JSAA 3VRQA 2Y5IA 2Y1NA 3GOFA 2JTZA 1XFWO 2OTGC 3DVEA 2H61A 2PRUA 2LMTA 1JF2A 2KYFA 5TNCA 3WNXB 1PALA 2F3ZA 3O6BA 2M29A 4N5XA 2IS9A 1QVIZ 1CM4A 2OTGB 1XFZO 2K7BA 1J7PA 3FWBA 2BECA 1SNLA 1OMRA 1NX3A 1F4OA 2JU0A 2NLNA 4PHKA 1NCZA 1QVIY 1L7ZA 1U5IB 1H4BA 1SR6C 2R2IA 3TDZA 4DCKA 5K89A 3JTDC 1ALWA 3GK4X 5I2QA 5KU1A 4I5NB 5DKNA 1B7TY 5ER4X 3TDIA 1RECA 1ODBA 5DKQA 1C07A 5CSNA 2MJWB 2ZKMX 3CS1A 3SG6A 1IWQA 1V1FA 3FIAA 3JTDB 1U5IA 2LC5A 2LUXA 2WCBA 1XFVO 1S5GZ 2MA2A 2EC6B 3NSLA 3TUYC 2LHLA 5G08A 1NX0A 2M1UA 1JWDA 3E3RA 1K93D 1UHNA 1DGVA 3TUYB 2CTNA 2GV5A 2ZFDA 2K7DA 2ISDA 1A4PA 3RLZA 2WC8A 2K8MB 4MBEA 2EGDA 1PVBA 2I18A 3VRNA 1YVLA 1Q80A 1M39A 1J7QA 4MRYA 1MWNA 3EK8A 4DUQA 4QJ4B 1S6IA 1XVJA 2CBLA 1NPQA 3O2PA 4PE0A 2E30A 4USLA 5JOLA 1BLQA 3AAKA 1MQ1A 4ORCB 4AQJA 4DRWA 5HKZA 1B1GA 3QRXA 1RK9A 1V1GA 4P5OE 2FCEA 1QASA 1WLZA 2LE9B 4I5JA 3LCPC 5HKYA 4CLNA 3AKBA 1EH2A 2LVIA 2M7LA 1YX8A 2HQ8A 1GGZA 5AFPA 3HCMA 4YGCB 2KGRA 1AK8A 1PRWA 1Y6WA 2BCAA 2JRFA 1J7RA 5I2LA 1OSAA 1DJXA 2F2OA 4BY5A 4Q04A 2M49B 2FJUB 1QTXA 2RGIA 4JWQA 4YGBB 1DVIA 5GQQC 1SCMC 1UHJA 3I5GB 1BOCA 1K94A 2K0JA 2PSRA 3OB2B 1XYDA 3SG2A 1QV1A 1SCMB 2JTTA 3BQ3A 1BR1B 3BYAA 1MHOA 1TTXA 2WCEA 2K2FA 1TOPA 3KHEA 3PLFB 3TS5C 1EL4A 5HLOA 1DJHA 1D1OA 3DVJA 1B8RA 1J55A 2LLSA 3DD4A 1NYAA 2LVJA 1AVSA 5AEQA 2MLFC 3VRPA 5JJGA 1F54A 1UHKA 1UURA 3NSOA 1JC2A 1XK4C 1K90D 1KK8B 3LLEA 1J1DA 4HRHA 2O5GA 1EG4A 2ZNDA 3BOWA 1TNXA 2ZNEA 1B8LA 2CCMA 4MLWA 4FTGA 4XJKA 2KNEA 1OMVA 2L4IA 1IQ3A 4ORBB 4L9MA 1WLMA 1C7WA 2KOTA 1KCYA 1F70A 2P6BB 2BE6A 3PALA 1PULA 1YUUA 4XYNA 3SJSA 1JF0A 3VRRA 1CKKA 3BUWB 2AUCA 4I5LB 3SG5A 4DS7A 3ZWHA 3I5IC 2G9BA 3CR2A 4CPVA 2KAXA 5CPVA 1SL8A 1KK7Y 2NCOA 3JVTC 1SMGA
chains in the Genus database with same CATH superfamily
4F0ZB 4MVFA 5HLVA 1IJ5A 3I5IB 1F55A 1A75A 1MXLC 1QX7A 2JPOA 3CABA 2JULA 2PVBA 1A2XA 1NIWA 1M63B 3JVTB 1IH0A 1DJIA 1CDLA 1WRZA 1BT6A 2EHBA 1A03A 4ETOA 4OV2A 1SK6D 2L2EA 1DF0B 3K21A 2F3YA 5CSIA 2BKHB 1S26D 4PDZA 1K95A 4ZCUA 2COLB 1KFXS 1MXEA 4YI8A 4D1EA 1B9AA 2Y1MA 1TRFA 4PALA 1UHHA 1NX1A 1ZMZA 1SR6B 1RWYA 3ICBA 1DF0A 2KI6C 2KSPA 2CNPA 3O4YA 3PFVA 1SBJA 5PALA 5AERA 4YBHB 2KHNA 5FI6A 5I8NA 1E8AA 1Y1UA 4P2YB 1C7VA 2MLEC 1K2HA 1S5GY 1XFXO 4INWA 2JNXA 3IVTA 3IQQA 2H2KA 4M2QA 3DYEA 2LANA 1RROA 3LL8B 1ALVA 3UNWA 2K60A 1KFXL 3WXAA 1IIOA 2KDHA 3KF9A 3B7AA 1QIWA 1QJTA 1TNQA 2LAPA 2M0RA 2QACA 1R2UA 1CLLA 1KFUS 2PALA 1CFPA 2KFHA 1CFCA 2LM5A 1GGWA 5BPJA 2LV7A 1XFYO 1PSRA 5DICA 1TUZA 2KBMA 3AKAA 1DQEA 4GAOA 1DTLA 1DGUA 1NP8A 1IG5A 2PYQA 3SG7A 1OZSA 2BL0C 5HKWA 3BUMB 3I5FC 3EKHA 4HRGA 1LA0A 2M97A 4R1EA 1X02A 1OOJA 2QEBA 1QV0A 3VROA 1BODA 1DJZA 1KFUL 1FF1A 3AAJA 4ORAB 2WORA 1G8IA 2PMYA 1YRUB 1XA5A 1IRJA 3EVRA 1CB1A 3OHMB 2K61A 1QS7A 2KQYA 2NZ0A 1M31A 1P28A 4MRXA 1CFDA 1J7OA 1CTRA 2KBIA 5AXIA 2P70A 2JNFA 2JXCA 1AJ4A 1K9KA 4WQ2A 1PVAA 3WHTB 2D8NA 1KWOC 2ZRSA 1CMFA 1QLKA 1MUXA 1ZUZA 4OR9B 2TN4A 1YUSA 1TNWA 1S6JA 2NXQA 1BR4B 4YGAA 1LINA 2KPHA 1CM1A 2L0PA 4YI9A 1GM0A 1KWOB 1VRKA 3A8RA 1B8CA 1CMGA 1QXPA 3S0BA 1QATA 2K7OA 1Y0VH 4PHJA 2MBXA 2JXLA 4E68A 2JOJA 1TIZA 3RZSA 1EJ3A 2FCDA 1YURA 2A4JA 2JC2A 1S1EA 4AQIA 3OP0A 2WNDA 4IL1A 4PE7A 4GPLB 5B8IB 4DIRA 1A29A 2I7AA 4PHNA 3D10A 3IF7A 3SIAA 3TS5B 1DT7B 1N65A 2L5YA 4OVNF 5ER5A 1IJ6A 1NWDA 3KPXA 1YR5A 1N0YA 1K8UA 1NCYA 2QPTA 1TWOA 2K7CA 3MSEB 3NSKA 1IKUA 3EVVA 2Q91A 2P71A 3KO0A 3PM8A 3R1PA 4MZJA 4MEWA 1R6PA 3PN7C 5D69A 4FQOA 4NDDA 1TCOB 2QDIA 1SL9A 4OZDA 3BJHA 1QX2A 2L98A 1JUOA 4WRIA 3M0WA 1KSOA 4CFQA 3PN7B 2BCXA 2WOSA 1XK4A 2JWWA 1Z4HA 2Y4QA 3BUOB 2LMUA 3BUNB 4MSPA 3CR4X 3RM1A 5HYDA 3SIBA 1N2DA 3SG4A 2VRGA 1JBAA 2ERBA 2I94A 3CTNA 3OX5A 3O78A 1WDCC 1AJ5A 2BBNA 2AAOA 2LVVA 1S3PA 1ORGA 1W7JB 2JQ6A 2L5XB 2KLDA 2Q4UA 3QMEA 1FW4A 2CT9A 4A4BA 1BJFA 1H8BA 3EVUA 1SY9A 5HL1A 1IGVA 1RJVA 1WDCB 3OB1B 4NQGA 2F8PA 1LVCD 4YGEB 2BE4A 5F6TA 1YUTA 4PE1A 3B6XA 3NGVA 5KTYA 4GNKB 4UPGA 1Z2CB 2M1KB 2G2BA 4FQTA 5AANA 1FI5A 2KAVA 3H4SE 1W7IB 5CSJA 4YRUA 2KI4C 5CSFA 1RTP1 2LP3A 2WCKA 2M7NA 2BNXA 5J3XA 2H8VA 1FBVA 2FOTA 1TNPA 2BKIB 2BCBA 1FPWA 1B47A 2KI4B 3DZTA 1OZOA 1K9PA 3NXAA 1CDNA 1HQVA 1Y1AA 1YX7A 2LHIA 2V53A 1HT9A 1EXRA 2KAYA 1NSHA 2K2AA 1C3YA 1G33A 1QIVA 3I5HC 1CFFA 1DEKA 2DOQA 1SRAA 2PQLA 1B7TZ 3CZ1A 2CXJA 2MHHA 3CWGA 4NDCA 4A4CA 3ZNIA 4GBAA 1L2OC 1BMOA 2L4HA 3D77A 1YRTB 3EK4A 4JPZB 3I5HB 1LA3A 2KI6D 2L51A 2EC6C 3HX4A 2OS8C 2AMIA 4MZKA 4GUKA 1OQPA 1CDMA 1F4QA 1L2OB 4TNCA 1SSEB 1NUBA 2KQ6A 2QEHA 3A4UB 4YGDB 1QX5B 1KQVA 4M2PA 3BFHA 1PK0D 2LP2A 2MRDA 1RFJA 4ICBA 4JKTA 2OS8B 1AP4A 1UHIA 2JT0A 1OE9B 3CGAA 1TN4A 1MF8B 2HQWA 2KGBC 2F33A 1JFKA 2BAPA 3LK1A 2QEOA 3B88A 1SKTA 1OW4A 4JQ0D 3CZTX 2KYCA 1F8HA 1LS8A 1NCXA 2JPTA 2WC5A 3CDNA 1J1EA 3CR5X 4PT1A 2ZN8A 3TDUA 3CLNA 3K1EA 1WY9A 3B86A 2LNKA 3S0EA 2LCPA 1DJYA 3SG3A 3PM2A 2WCFA 3EK7A 4C0KA 3VGOA 2SASA 2BL0B 2I2RE 3I5FB 4PCWA 1DJWA 2PASA 3OBVA 2B1UA 2M8UA 2NCPA 1CLBA 2BBMA 1CNPA 1YVHA 1EG3A 4N1GA 2MAZA 2GGMA 2JT3A 1SCVA 2E6WA 3BUXB 3PSRA 2LLTA 1SPYA 3R1VA 4QJ5B 1MR8A 3DVKA 4N1FA 3GK2A 4BY4A 1K96A 1SW8A 3C1VA 2JZIA 5D7FA 1ZACA 2WCJA 3EKJA 1F71A 1ZFSA 1KSMA 5FI7A 4MZLA 1PSBA 2FJYA 1KQMC 1SYMA 3S0AA 4OKHA 1BF5A 1GQMA 1LXFC 1OMDA 2LVKA 3I5GC 1WRKA 4C0JA 1LKJA 3CZ2A 2M9GA 3N7HA 3NHTA 1YTZC 5KSZA 3IQOA 1CDPA 1K9UA 1Y1XA 3GK1A 5IBWA 3S0FA 1KQMB 1AHRA 3OGNA 3BXKA 1W9ZA 1DJGA 2LLUA 3DVMA 1S6CA 3F45A 4NDBA 2KFFA 5DKRA 1UP5A 4MN0A 4AOMA 2HF5A 4C0LA 1M45A 3FS7A 1BG1A 3D0YB 2M3WA 4OCIA 4WQ3A 1AUIB 2HETA 4M2OA 2KLEA 1OOHA 4QJ3B 2LMVA 3D73A 1UUSA 1T14A 4PE4A 1XO5A 3D74A 1UWOA 1XFUO 2ZRTA 1KK8C 1ZOTB 3BOWB 1S36A 3D0YA 3D75A 3WHUB 5FYXA 2LUCA 2HPSA 1IQ5A 4GGFC 2ZN9A 4XJKB 2F2PA 3DF0B 2JT8A 1CLMA 1NX2A 4PHMA 1M46A 1FI6A 1QLSA 3TZ1A 1JFJA 1BU3A 4GGNA 1G4YR 3D78A 2KFGA 2OPOA 4HREE 3FWCA 2H61C 3KEVA 3S0DA 3DF0A 2SCPA 2O60A 1GJYA 1TCFA 1DMOA 3PATA 3NSIA 4CFRA 2L50A 1SL7A 4GGFA 1KK7Z 4GFTA 1A75B 1B4CA 4HSZA 3LK0A 4I5KA 5I2OA 1WRLA 4U8DA 1DELA 2GGZA 3OX6A 4ZCVA 4CIDA 1JSAA 3VRQA 2Y5IA 2Y1NA 3GOFA 1OOIX 2JTZA 1XFWO 2OTGC 3DVEA 2H61A 4KYNA 2PRUA 2LMTA 3V2LA 1JF2A 2KYFA 2WCLA 5TNCA 1PALA 2F3ZA 3WNXB 3EG5B 3O6BA 2M29A 4N5XA 1XFRA 2IS9A 1QVIZ 1OOGA 1DC1A 1CM4A 2OTGB 1XFZO 2K7BA 3L4AA 3UO9A 3FWBA 1J7PA 2BECA 1SNLA 3BFAA 1OMRA 3D76A 1NX3A 1F4OA 2JU0A 2NLNA 4PHKA 1NCZA 1QVIY 1L7ZA 1U5IB 1H4BA 1SR6C 2R2IA 3TDZA 4DCKA 5K89A 3JTDC 1ALWA 3GK4X 5I2QA 5KU1A 4I5NB 5DKNA 1B7TY 2WCHA 5ER4X 3TDIA 1RECA 1ODBA 5DKQA 1C07A 5CSNA 2MJWB 2ZKMX 3CS1A 3R1OA 1IWQA 1V1FA 3FIAA 3SG6A 3JTDB 1U5IA 2LC5A 2LUXA 2WCBA 1XFVO 1C3ZA 1S5GZ 2MA2A 2EC6B 3CYZA 3NSLA 3TUYC 2LHLA 5G08A 1NX0A 3L47A 2M1UA 1JWDA 3E3RA 1K93D 1UHNA 1DGVA 3TUYB 2CTNA 2GV5A 2ZFDA 2K7DA 2ISDA 1A4PA 3RLZA 2WC8A 2K8MB 1OOFA 2EGDA 1PVBA 4MBEA 3SS4A 2I18A 3VRNA 1YVLA 3BFBA 1Q80A 1M39A 1J7QA 4MRYA 1MWNA 3EK8A 4DUQA 4QJ4B 1S6IA 1XVJA 2CBLA 1NPQA 2GTEA 3O2PA 4IJ7A 3S0GA 4F7FA 4PE0A 3SS5A 2E30A 2QEVA 4USLA 3O4XA 5JOLA 1BLQA 3AAKA 1MQ1A 4ORCB 4AQJA 4DRWA 5HKZA 1B1GA 3QRXA 1RK9A 1V1GA 4P5OE 2FCEA 1QASA 1WLZA 2LE9B 4I5JA 3LCPC 5HKYA 4CLNA 3NHIA 2WCMA 3AKBA 1EH2A 2LVIA 2M7LA 1YX8A 2HQ8A 1GGZA 5AFPA 3Q8IA 3CZ0A 3HCMA 4YGCB 2KGRA 1AK8A 1PRWA 1Y6WA 2BCAA 2JRFA 1J7RA 2WC6A 3PJIA 5I2LA 1OSAA 1DJXA 2F2OA 2L2CA 3L4LA 1TUJA 1QWVA 3FE8A 4BY5A 4Q04A 2M49B 2FJUB 1QTXA 2RGIA 4JWQA 4YGBB 5FI2A 1DVIA 5GQQC 1SCMC 1UHJA 3B87A 3FE9A 3I5GB 1BOCA 1K94A 2K0JA 2PSRA 3OB2B 1XYDA 4JD9A 3SG2A 1QV1A 1SCMB 2JTTA 3BQ3A 1BR1B 3BYAA 1MHOA 1TTXA 2WCEA 5EL2A 2K2FA 1TOPA 3KHEA 3PLFB 3TS5C 1EL4A 5HLOA 1DJHA 1D1OA 3DVJA 1B8RA 1J55A 2LLSA 3DD4A 1NYAA 2LVJA 1AVSA 5AEQA 2MLFC 3VRPA 5JJGA 1F54A 1UHKA 1UURA 3NSOA 1JC2A 1XK4C 1K90D 1KK8B 3FE6A 1J1DA 3DY9A 2O5GA 3LLEA 4HRHA 1EG4A 4INXA 2ZNDA 3DXLA 3BOWA 1TNXA 3R72A 2ZNEA 3SS3A 1B8LA 2CCMA 4MLWA 4FTGA 4XJKA 2KNEA 1OMVA 2L4IA 1IQ3A 4ORBB 4L9MA 1WLMA 1C7WA 2KOTA 2YGUA 1KCYA 1F70A 2P6BB 2BE6A 5I94A 3PALA 1PULA 1YUUA 4XYNA 3SJSA 1JF0A 3VRRA 1CKKA 3BUWB 2AUCA 4I5LB 3SG5A 4DS7A 3ZWHA 3I5IC 2G9BA 5D3OA 3CR2A 3VB1A 4CPVA 2KAXA 5CPVA 1SL8A 1KK7Y 2NCOA 3JVTC 1SMGA
chains in the Genus database with same CATH topology
4F0ZB 4MVFA 5HLVA 1IJ5A 3I5IB 1F55A 1A75A 1MXLC 1QX7A 2JULA 2PVBA 1A2XA 1NIWA 1M63B 3JVTB 1IH0A 1DJIA 1CDLA 1WRZA 1BT6A 2EHBA 1A03A 4ETOA 4OV2A 1SK6D 2L2EA 1DF0B 3K21A 2F3YA 5CSIA 2BKHB 1S26D 4PDZA 1K95A 4ZCUA 2COLB 1KFXS 1MXEA 4YI8A 4D1EA 1B9AA 2Y1MA 1TRFA 4PALA 1UHHA 1NX1A 1ZMZA 1SR6B 1RWYA 3ICBA 1DF0A 2KI6C 2KSPA 2CNPA 3O4YA 3PFVA 1SBJA 5PALA 5AERA 4YBHB 2KHNA 5I8NA 1E8AA 1Y1UA 4P2YB 1C7VA 2MLEC 1K2HA 1S5GY 1XFXO 2JNXA 3IQQA 2H2KA 4M2QA 2LANA 1RROA 3LL8B 1ALVA 1KFXL 3WXAA 2KDHA 3KF9A 1QIWA 1QJTA 1TNQA 2LAPA 2M0RA 2QACA 1R2UA 1CLLA 1KFUS 2PALA 1CFPA 2KFHA 1CFCA 2LM5A 1GGWA 5BPJA 2LV7A 1XFYO 1PSRA 2KBMA 3AKAA 4GAOA 1DTLA 1DGUA 1NP8A 1IG5A 3SG7A 1OZSA 2BL0C 5HKWA 3BUMB 3I5FC 3EKHA 4HRGA 1LA0A 2M97A 4R1EA 1X02A 1OOJA 1QV0A 3VROA 1BODA 1DJZA 1KFUL 1FF1A 3AAJA 4ORAB 2WORA 1G8IA 2PMYA 1YRUB 1XA5A 1IRJA 3EVRA 1CB1A 3OHMB 2K61A 1QS7A 2KQYA 2NZ0A 1M31A 1J7OA 4MRXA 1CFDA 1CTRA 2KBIA 5AXIA 2JNFA 2JXCA 1AJ4A 1K9KA 4WQ2A 1PVAA 3WHTB 2D8NA 1KWOC 2ZRSA 1CMFA 1QLKA 1MUXA 1ZUZA 4OR9B 2TN4A 1YUSA 1TNWA 1S6JA 2NXQA 1BR4B 4YGAA 1LINA 1CM1A 2L0PA 4YI9A 1KWOB 1VRKA 3A8RA 1B8CA 1CMGA 1QXPA 1QATA 2K7OA 1Y0VH 4PHJA 2MBXA 2JXLA 4E68A 2JOJA 1TIZA 1EJ3A 2FCDA 1YURA 2A4JA 2JC2A 1S1EA 4AQIA 3OP0A 2WNDA 4IL1A 4PE7A 4GPLB 5B8IB 4DIRA 1A29A 2I7AA 4PHNA 3D10A 3IF7A 3SIAA 3TS5B 1DT7B 1N65A 4OVNF 5ER5A 1IJ6A 1NWDA 3KPXA 1YR5A 1N0YA 1K8UA 1NCYA 2QPTA 2K7CA 3MSEB 3NSKA 1IKUA 3EVVA 2Q91A 3KO0A 3PM8A 4MZJA 4MEWA 1R6PA 3PN7C 5D69A 4FQOA 4NDDA 1TCOB 1SL9A 1QX2A 2L98A 1JUOA 4WRIA 3M0WA 1KSOA 4CFQA 3PN7B 2BCXA 2WOSA 1XK4A 2JWWA 3BUOB 2Y4QA 2LMUA 3BUNB 4MSPA 3CR4X 3RM1A 5HYDA 3SIBA 1N2DA 3SG4A 2VRGA 1JBAA 2I94A 3CTNA 3OX5A 3O78A 1WDCC 1AJ5A 2BBNA 2AAOA 2LVVA 1S3PA 1W7JB 2JQ6A 2L5XB 2Q4UA 1FW4A 2CT9A 4A4BA 1BJFA 1H8BA 3EVUA 1SY9A 1IGVA 1RJVA 1WDCB 3OB1B 4NQGA 2F8PA 1LVCD 4YGEB 2BE4A 5F6TA 1YUTA 4PE1A 5KTYA 1FI5A 4GNKB 4UPGA 2M1KB 2G2BA 5AANA 2KAVA 3H4SE 1W7IB 5CSJA 4YRUA 2KI4C 5CSFA 1RTP1 2LP3A 2M7NA 5J3XA 1FBVA 2FOTA 1TNPA 2BKIB 2BCBA 1FPWA 1B47A 2KI4B 1OZOA 1K9PA 3NXAA 1CDNA 1HQVA 1Y1AA 1YX7A 2LHIA 2V53A 1HT9A 1EXRA 2KAYA 1NSHA 2K2AA 1G33A 1QIVA 3I5HC 1CFFA 2DOQA 1SRAA 1B7TZ 2CXJA 2MHHA 3CWGA 4NDCA 4A4CA 3ZNIA 4GBAA 1L2OC 1BMOA 2L4HA 1YRTB 3EK4A 4JPZB 3I5HB 1LA3A 2KI6D 2L51A 2EC6C 3HX4A 2OS8C 2AMIA 4MZKA 4GUKA 1OQPA 1CDMA 1F4QA 1L2OB 4TNCA 4YGDB 1NUBA 2KQ6A 1KQVA 3A4UB 1QX5B 4M2PA 1PK0D 2LP2A 2MRDA 1RFJA 4ICBA 2OS8B 1AP4A 1UHIA 2JT0A 1OE9B 3CGAA 1TN4A 1MF8B 2HQWA 2KGBC 2F33A 1JFKA 3LK1A 1SKTA 4JQ0D 3CZTX 2KYCA 1F8HA 1NCXA 2JPTA 1J1EA 3CR5X 2ZN8A 3TDUA 3CLNA 1WY9A 2LNKA 2LCPA 1DJYA 3SG3A 2WCFA 3EK7A 4C0KA 3VGOA 2SASA 2BL0B 2I2RE 3I5FB 4PCWA 1DJWA 2PASA 2B1UA 2M8UA 2NCPA 1CLBA 2BBMA 1CNPA 1YVHA 1EG3A 4N1GA 2MAZA 2GGMA 2JT3A 1SCVA 2E6WA 3BUXB 3PSRA 2LLTA 1SPYA 4QJ5B 1MR8A 3DVKA 4N1FA 3GK2A 4BY4A 1K96A 1SW8A 3C1VA 2JZIA 5D7FA 1ZACA 3EKJA 1F71A 1ZFSA 1KSMA 4MZLA 1PSBA 1KQMC 1SYMA 4OKHA 1BF5A 1GQMA 1LXFC 1OMDA 2LVKA 3I5GC 1WRKA 4C0JA 1LKJA 2M9GA 1YTZC 5KSZA 3IQOA 1CDPA 1K9UA 1Y1XA 3GK1A 5IBWA 1KQMB 1AHRA 3BXKA 1DJGA 2LLUA 3DVMA 1S6CA 3F45A 4NDBA 2KFFA 5DKRA 1UP5A 4MN0A 4AOMA 2HF5A 4C0LA 1M45A 3FS7A 1BG1A 3D0YB 2M3WA 4OCIA 4WQ3A 1AUIB 2HETA 4M2OA 4QJ3B 2LMVA 1UUSA 4PE4A 1XO5A 1UWOA 1XFUO 2ZRTA 1KK8C 1ZOTB 3BOWB 1S36A 3D0YA 3WHUB 5FYXA 2LUCA 2HPSA 1IQ5A 4GGFC 2ZN9A 4XJKB 2F2PA 3DF0B 2JT8A 1CLMA 1NX2A 4PHMA 1M46A 1FI6A 1QLSA 3TZ1A 1JFJA 1BU3A 4GGNA 1G4YR 2KFGA 2OPOA 4HREE 3FWCA 2H61C 3KEVA 3DF0A 2SCPA 2O60A 1GJYA 1TCFA 1DMOA 3PATA 3NSIA 4CFRA 2L50A 1SL7A 4GGFA 1KK7Z 4GFTA 1A75B 1B4CA 4HSZA 3LK0A 4I5KA 5I2OA 1WRLA 4U8DA 2GGZA 3OX6A 4ZCVA 4CIDA 1JSAA 3VRQA 2Y5IA 2Y1NA 3GOFA 2JTZA 1XFWO 2OTGC 3DVEA 2H61A 2PRUA 2LMTA 1JF2A 2KYFA 5TNCA 3WNXB 1PALA 2F3ZA 3O6BA 2M29A 4N5XA 2IS9A 1QVIZ 1CM4A 2OTGB 1XFZO 2K7BA 1J7PA 3FWBA 2BECA 1SNLA 1OMRA 1NX3A 1F4OA 2JU0A 2NLNA 4PHKA 1NCZA 1QVIY 1L7ZA 1U5IB 1H4BA 1SR6C 2R2IA 3TDZA 4DCKA 5K89A 3JTDC 1ALWA 3GK4X 5I2QA 5KU1A 4I5NB 5DKNA 1B7TY 5ER4X 3TDIA 1RECA 1ODBA 5DKQA 1C07A 5CSNA 2MJWB 2ZKMX 3CS1A 3SG6A 1IWQA 1V1FA 3FIAA 3JTDB 1U5IA 2LC5A 2LUXA 2WCBA 1XFVO 1S5GZ 2MA2A 2EC6B 3NSLA 3TUYC 2LHLA 5G08A 1NX0A 2M1UA 1JWDA 3E3RA 1K93D 1UHNA 1DGVA 3TUYB 2CTNA 2GV5A 2ZFDA 2K7DA 2ISDA 1A4PA 3RLZA 2WC8A 2K8MB 4MBEA 2EGDA 1PVBA 2I18A 3VRNA 1YVLA 1Q80A 1M39A 1J7QA 4MRYA 1MWNA 3EK8A 4DUQA 4QJ4B 1S6IA 1XVJA 2CBLA 1NPQA 3O2PA 4PE0A 2E30A 4USLA 5JOLA 1BLQA 3AAKA 1MQ1A 4ORCB 4AQJA 4DRWA 5HKZA 1B1GA 3QRXA 1RK9A 1V1GA 4P5OE 2FCEA 1QASA 1WLZA 2LE9B 4I5JA 3LCPC 5HKYA 4CLNA 3AKBA 1EH2A 2LVIA 2M7LA 1YX8A 2HQ8A 1GGZA 5AFPA 3HCMA 4YGCB 2KGRA 1AK8A 1PRWA 1Y6WA 2BCAA 2JRFA 1J7RA 5I2LA 1OSAA 1DJXA 2F2OA 4BY5A 4Q04A 2M49B 2FJUB 1QTXA 2RGIA 4JWQA 4YGBB 1DVIA 5GQQC 1SCMC 1UHJA 3I5GB 1BOCA 1K94A 2K0JA 2PSRA 3OB2B 1XYDA 3SG2A 1QV1A 1SCMB 2JTTA 3BQ3A 1BR1B 3BYAA 1MHOA 1TTXA 2WCEA 2K2FA 1TOPA 3KHEA 3PLFB 3TS5C 1EL4A 5HLOA 1DJHA 1D1OA 3DVJA 1B8RA 1J55A 2LLSA 3DD4A 1NYAA 2LVJA 1AVSA 5AEQA 2MLFC 3VRPA 5JJGA 1F54A 1UHKA 1UURA 3NSOA 1JC2A 1XK4C 1K90D 1KK8B 3LLEA 1J1DA 4HRHA 2O5GA 1EG4A 2ZNDA 3BOWA 1TNXA 2ZNEA 1B8LA 2CCMA 4MLWA 4FTGA 4XJKA 2KNEA 1OMVA 2L4IA 1IQ3A 4ORBB 4L9MA 1WLMA 1C7WA 2KOTA 1KCYA 1F70A 2P6BB 2BE6A 3PALA 1PULA 1YUUA 4XYNA 3SJSA 1JF0A 3VRRA 1CKKA 3BUWB 2AUCA 4I5LB 3SG5A 4DS7A 3ZWHA 3I5IC 2G9BA 3CR2A 4CPVA 2KAXA 5CPVA 1SL8A 1KK7Y 2NCOA 3JVTC 1SMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Z B;  4MVF A;  5HLV A;  1IJ5 A;  3I5I B;  1F55 A;  1A75 A;  1MXL C;  1QX7 A;  2JUL A;  2PVB A;  1A2X A;  1NIW A;  1M63 B;  3JVT B;  1IH0 A;  1DJI A;  1CDL A;  1WRZ A;  1BT6 A;  2EHB A;  1A03 A;  4ETO A;  4OV2 A;  1SK6 D;  2L2E A;  1DF0 B;  3K21 A;  2F3Y A;  5CSI A;  2BKH B;  1S26 D;  4PDZ A;  1K95 A;  4ZCU A;  2COL B;  1KFX S;  1MXE A;  4YI8 A;  4D1E A;  1B9A A;  2Y1M A;  1TRF A;  4PAL A;  1UHH A;  1NX1 A;  1ZMZ A;  1SR6 B;  1RWY A;  3ICB A;  1DF0 A;  2KI6 C;  2KSP A;  2CNP A;  3O4Y A;  3PFV A;  1SBJ A;  5PAL A;  5AER A;  4YBH B;  2KHN A;  5I8N A;  1E8A A;  1Y1U A;  4P2Y B;  1C7V A;  2MLE C;  1K2H A;  1S5G Y;  1XFX O;  2JNX A;  3IQQ A;  2H2K A;  4M2Q A;  2LAN A;  1RRO A;  3LL8 B;  1ALV A;  1KFX L;  3WXA A;  2KDH A;  3KF9 A;  1QIW A;  1QJT A;  1TNQ A;  2LAP A;  2M0R A;  2QAC A;  1R2U A;  1CLL A;  1KFU S;  2PAL A;  1CFP A;  2KFH A;  1CFC A;  2LM5 A;  1GGW A;  5BPJ A;  2LV7 A;  1XFY O;  1PSR A;  2KBM A;  3AKA A;  4GAO A;  1DTL A;  1DGU A;  1NP8 A;  1IG5 A;  3SG7 A;  1OZS A;  2BL0 C;  5HKW A;  3BUM B;  3I5F C;  3EKH A;  4HRG A;  1LA0 A;  2M97 A;  4R1E A;  1X02 A;  1OOJ A;  1QV0 A;  3VRO A;  1BOD A;  1DJZ A;  1KFU L;  1FF1 A;  3AAJ A;  4ORA B;  2WOR A;  1G8I A;  2PMY A;  1YRU B;  1XA5 A;  1IRJ A;  3EVR A;  1CB1 A;  3OHM B;  2K61 A;  1QS7 A;  2KQY A;  2NZ0 A;  1M31 A;  1J7O A;  4MRX A;  1CFD A;  1CTR A;  2KBI A;  5AXI A;  2JNF A;  2JXC A;  1AJ4 A;  1K9K A;  4WQ2 A;  1PVA A;  3WHT B;  2D8N A;  1KWO C;  2ZRS A;  1CMF A;  1QLK A;  1MUX A;  1ZUZ A;  4OR9 B;  2TN4 A;  1YUS A;  1TNW A;  1S6J A;  2NXQ A;  1BR4 B;  4YGA A;  1LIN A;  1CM1 A;  2L0P A;  4YI9 A;  1KWO B;  1VRK A;  3A8R A;  1B8C A;  1CMG A;  1QXP A;  1QAT A;  2K7O A;  1Y0V H;  4PHJ A;  2MBX A;  2JXL A;  4E68 A;  2JOJ A;  1TIZ A;  1EJ3 A;  2FCD A;  1YUR A;  2A4J A;  2JC2 A;  1S1E A;  4AQI A;  3OP0 A;  2WND A;  4IL1 A;  4PE7 A;  4GPL B;  5B8I B;  4DIR A;  1A29 A;  2I7A A;  4PHN A;  3D10 A;  3IF7 A;  3SIA A;  3TS5 B;  1DT7 B;  1N65 A;  4OVN F;  5ER5 A;  1IJ6 A;  1NWD A;  3KPX A;  1YR5 A;  1N0Y A;  1K8U A;  1NCY A;  2QPT A;  2K7C A;  3MSE B;  3NSK A;  1IKU A;  3EVV A;  2Q91 A;  3KO0 A;  3PM8 A;  4MZJ A;  4MEW A;  1R6P A;  3PN7 C;  5D69 A;  4FQO A;  4NDD A;  1TCO B;  1SL9 A;  1QX2 A;  2L98 A;  1JUO A;  4WRI A;  3M0W A;  1KSO A;  4CFQ A;  3PN7 B;  2BCX A;  2WOS A;  1XK4 A;  2JWW A;  3BUO B;  2Y4Q A;  2LMU A;  3BUN B;  4MSP A;  3CR4 X;  3RM1 A;  5HYD A;  3SIB A;  1N2D A;  3SG4 A;  2VRG A;  1JBA A;  2I94 A;  3CTN A;  3OX5 A;  3O78 A;  1WDC C;  1AJ5 A;  2BBN A;  2AAO A;  2LVV A;  1S3P A;  1W7J B;  2JQ6 A;  2L5X B;  2Q4U A;  1FW4 A;  2CT9 A;  4A4B A;  1BJF A;  1H8B A;  3EVU A;  1SY9 A;  1IGV A;  1RJV A;  1WDC B;  3OB1 B;  4NQG A;  2F8P A;  1LVC D;  4YGE B;  2BE4 A;  5F6T A;  1YUT A;  4PE1 A;  5KTY A;  1FI5 A;  4GNK B;  4UPG A;  2M1K B;  2G2B A;  5AAN A;  2KAV A;  3H4S E;  1W7I B;  5CSJ A;  4YRU A;  2KI4 C;  5CSF A;  1RTP 1;  2LP3 A;  2M7N A;  5J3X A;  1FBV A;  2FOT A;  1TNP A;  2BKI B;  2BCB A;  1FPW A;  1B47 A;  2KI4 B;  1OZO A;  1K9P A;  3NXA A;  1CDN A;  1HQV A;  1Y1A A;  1YX7 A;  2LHI A;  2V53 A;  1HT9 A;  1EXR A;  2KAY A;  1NSH A;  2K2A A;  1G33 A;  1QIV A;  3I5H C;  1CFF A;  2DOQ A;  1SRA A;  1B7T Z;  2CXJ A;  2MHH A;  3CWG A;  4NDC A;  4A4C A;  3ZNI A;  4GBA A;  1L2O C;  1BMO A;  2L4H A;  1YRT B;  3EK4 A;  4JPZ B;  3I5H B;  1LA3 A;  2KI6 D;  2L51 A;  2EC6 C;  3HX4 A;  2OS8 C;  2AMI A;  4MZK A;  4GUK A;  1OQP A;  1CDM A;  1F4Q A;  1L2O B;  4TNC A;  4YGD B;  1NUB A;  2KQ6 A;  1KQV A;  3A4U B;  1QX5 B;  4M2P A;  1PK0 D;  2LP2 A;  2MRD A;  1RFJ A;  4ICB A;  2OS8 B;  1AP4 A;  1UHI A;  2JT0 A;  1OE9 B;  3CGA A;  1TN4 A;  1MF8 B;  2HQW A;  2KGB C;  2F33 A;  1JFK A;  3LK1 A;  1SKT A;  4JQ0 D;  3CZT X;  2KYC A;  1F8H A;  1NCX A;  2JPT A;  1J1E A;  3CR5 X;  2ZN8 A;  3TDU A;  3CLN A;  1WY9 A;  2LNK A;  2LCP A;  1DJY A;  3SG3 A;  2WCF A;  3EK7 A;  4C0K A;  3VGO A;  2SAS A;  2BL0 B;  2I2R E;  3I5F B;  4PCW A;  1DJW A;  2PAS A;  2B1U A;  2M8U A;  2NCP A;  1CLB A;  2BBM A;  1CNP A;  1YVH A;  1EG3 A;  4N1G A;  2MAZ A;  2GGM A;  2JT3 A;  1SCV A;  2E6W A;  3BUX B;  3PSR A;  2LLT A;  1SPY A;  4QJ5 B;  1MR8 A;  3DVK A;  4N1F A;  3GK2 A;  4BY4 A;  1K96 A;  1SW8 A;  3C1V A;  2JZI A;  5D7F A;  1ZAC A;  3EKJ A;  1F71 A;  1ZFS A;  1KSM A;  4MZL A;  1PSB A;  1KQM C;  1SYM A;  4OKH A;  1BF5 A;  1GQM A;  1LXF C;  1OMD A;  2LVK A;  3I5G C;  1WRK A;  4C0J A;  1LKJ A;  2M9G A;  1YTZ C;  5KSZ A;  3IQO A;  1CDP A;  1K9U A;  1Y1X A;  3GK1 A;  5IBW A;  1KQM B;  1AHR A;  3BXK A;  1DJG A;  2LLU A;  3DVM A;  1S6C A;  3F45 A;  4NDB A;  2KFF A;  5DKR A;  1UP5 A;  4MN0 A;  4AOM A;  2HF5 A;  4C0L A;  1M45 A;  3FS7 A;  1BG1 A;  3D0Y B;  2M3W A;  4OCI A;  4WQ3 A;  1AUI B;  2HET A;  4M2O A;  4QJ3 B;  2LMV A;  1UUS A;  4PE4 A;  1XO5 A;  1UWO A;  1XFU O;  2ZRT A;  1KK8 C;  1ZOT B;  3BOW B;  1S36 A;  3D0Y A;  3WHU B;  5FYX A;  2LUC A;  2HPS A;  1IQ5 A;  4GGF C;  2ZN9 A;  4XJK B;  2F2P A;  3DF0 B;  2JT8 A;  1CLM A;  1NX2 A;  4PHM A;  1M46 A;  1FI6 A;  1QLS A;  3TZ1 A;  1JFJ A;  1BU3 A;  4GGN A;  1G4Y R;  2KFG A;  2OPO A;  4HRE E;  3FWC A;  2H61 C;  3KEV A;  3DF0 A;  2SCP A;  2O60 A;  1GJY A;  1TCF A;  1DMO A;  3PAT A;  3NSI A;  4CFR A;  2L50 A;  1SL7 A;  4GGF A;  1KK7 Z;  4GFT A;  1A75 B;  1B4C A;  4HSZ A;  3LK0 A;  4I5K A;  5I2O A;  1WRL A;  4U8D A;  2GGZ A;  3OX6 A;  4ZCV A;  4CID A;  1JSA A;  3VRQ A;  2Y5I A;  2Y1N A;  3GOF A;  2JTZ A;  1XFW O;  2OTG C;  3DVE A;  2H61 A;  2PRU A;  2LMT A;  1JF2 A;  2KYF A;  5TNC A;  3WNX B;  1PAL A;  2F3Z A;  3O6B A;  2M29 A;  4N5X A;  2IS9 A;  1QVI Z;  1CM4 A;  2OTG B;  1XFZ O;  2K7B A;  1J7P A;  3FWB A;  2BEC A;  1SNL A;  1OMR A;  1NX3 A;  1F4O A;  2JU0 A;  2NLN A;  4PHK A;  1NCZ A;  1QVI Y;  1L7Z A;  1U5I B;  1H4B A;  1SR6 C;  2R2I A;  3TDZ A;  4DCK A;  5K89 A;  3JTD C;  1ALW A;  3GK4 X;  5I2Q A;  5KU1 A;  4I5N B;  5DKN A;  1B7T Y;  5ER4 X;  3TDI A;  1REC A;  1ODB A;  5DKQ A;  1C07 A;  5CSN A;  2MJW B;  2ZKM X;  3CS1 A;  3SG6 A;  1IWQ A;  1V1F A;  3FIA A;  3JTD B;  1U5I A;  2LC5 A;  2LUX A;  2WCB A;  1XFV O;  1S5G Z;  2MA2 A;  2EC6 B;  3NSL A;  3TUY C;  2LHL A;  5G08 A;  1NX0 A;  2M1U A;  1JWD A;  3E3R A;  1K93 D;  1UHN A;  1DGV A;  3TUY B;  2CTN A;  2GV5 A;  2ZFD A;  2K7D A;  2ISD A;  1A4P A;  3RLZ A;  2WC8 A;  2K8M B;  4MBE A;  2EGD A;  1PVB A;  2I18 A;  3VRN A;  1YVL A;  1Q80 A;  1M39 A;  1J7Q A;  4MRY A;  1MWN A;  3EK8 A;  4DUQ A;  4QJ4 B;  1S6I A;  1XVJ A;  2CBL A;  1NPQ A;  3O2P A;  4PE0 A;  2E30 A;  4USL A;  5JOL A;  1BLQ A;  3AAK A;  1MQ1 A;  4ORC B;  4AQJ A;  4DRW A;  5HKZ A;  1B1G A;  3QRX A;  1RK9 A;  1V1G A;  4P5O E;  2FCE A;  1QAS A;  1WLZ A;  2LE9 B;  4I5J A;  3LCP C;  5HKY A;  4CLN A;  3AKB A;  1EH2 A;  2LVI A;  2M7L A;  1YX8 A;  2HQ8 A;  1GGZ A;  5AFP A;  3HCM A;  4YGC B;  2KGR A;  1AK8 A;  1PRW A;  1Y6W A;  2BCA A;  2JRF A;  1J7R A;  5I2L A;  1OSA A;  1DJX A;  2F2O A;  4BY5 A;  4Q04 A;  2M49 B;  2FJU B;  1QTX A;  2RGI A;  4JWQ A;  4YGB B;  1DVI A;  5GQQ C;  1SCM C;  1UHJ A;  3I5G B;  1BOC A;  1K94 A;  2K0J A;  2PSR A;  3OB2 B;  1XYD A;  3SG2 A;  1QV1 A;  1SCM B;  2JTT A;  3BQ3 A;  1BR1 B;  3BYA A;  1MHO A;  1TTX A;  2WCE A;  2K2F A;  1TOP A;  3KHE A;  3PLF B;  3TS5 C;  1EL4 A;  5HLO A;  1DJH A;  1D1O A;  3DVJ A;  1B8R A;  1J55 A;  2LLS A;  3DD4 A;  1NYA A;  2LVJ A;  1AVS A;  5AEQ A;  2MLF C;  3VRP A;  5JJG A;  1F54 A;  1UHK A;  1UUR A;  3NSO A;  1JC2 A;  1XK4 C;  1K90 D;  1KK8 B;  3LLE A;  1J1D A;  4HRH A;  2O5G A;  1EG4 A;  2ZND A;  3BOW A;  1TNX A;  2ZNE A;  1B8L A;  2CCM A;  4MLW A;  4FTG A;  4XJK A;  2KNE A;  1OMV A;  2L4I A;  1IQ3 A;  4ORB B;  4L9M A;  1WLM A;  1C7W A;  2KOT A;  1KCY A;  1F70 A;  2P6B B;  2BE6 A;  3PAL A;  1PUL A;  1YUU A;  4XYN A;  3SJS A;  1JF0 A;  3VRR A;  1CKK A;  3BUW B;  2AUC A;  4I5L B;  3SG5 A;  4DS7 A;  3ZWH A;  3I5I C;  2G9B A;  3CR2 A;  4CPV A;  2KAX A;  5CPV A;  1SL8 A;  1KK7 Y;  2NCO A;  3JVT C;  1SMG A; 
#chains in the Genus database with same CATH topology
 4F0Z B;  4MVF A;  5HLV A;  1IJ5 A;  3I5I B;  1F55 A;  1A75 A;  1MXL C;  1QX7 A;  2JPO A;  3CAB A;  2JUL A;  2PVB A;  1A2X A;  1NIW A;  1M63 B;  3JVT B;  1IH0 A;  1DJI A;  1CDL A;  1WRZ A;  1BT6 A;  2EHB A;  1A03 A;  4ETO A;  4OV2 A;  1SK6 D;  2L2E A;  1DF0 B;  3K21 A;  2F3Y A;  5CSI A;  2BKH B;  1S26 D;  4PDZ A;  1K95 A;  4ZCU A;  2COL B;  1KFX S;  1MXE A;  4YI8 A;  4D1E A;  1B9A A;  2Y1M A;  1TRF A;  4PAL A;  1UHH A;  1NX1 A;  1ZMZ A;  1SR6 B;  1RWY A;  3ICB A;  1DF0 A;  2KI6 C;  2KSP A;  2CNP A;  3O4Y A;  3PFV A;  1SBJ A;  5PAL A;  5AER A;  4YBH B;  2KHN A;  5FI6 A;  5I8N A;  1E8A A;  1Y1U A;  4P2Y B;  1C7V A;  2MLE C;  1K2H A;  1S5G Y;  1XFX O;  4INW A;  2JNX A;  3IVT A;  3IQQ A;  2H2K A;  4M2Q A;  3DYE A;  2LAN A;  1RRO A;  3LL8 B;  1ALV A;  3UNW A;  2K60 A;  1KFX L;  3WXA A;  1IIO A;  2KDH A;  3KF9 A;  3B7A A;  1QIW A;  1QJT A;  1TNQ A;  2LAP A;  2M0R A;  2QAC A;  1R2U A;  1CLL A;  1KFU S;  2PAL A;  1CFP A;  2KFH A;  1CFC A;  2LM5 A;  1GGW A;  5BPJ A;  2LV7 A;  1XFY O;  1PSR A;  5DIC A;  1TUZ A;  2KBM A;  3AKA A;  1DQE A;  4GAO A;  1DTL A;  1DGU A;  1NP8 A;  1IG5 A;  2PYQ A;  3SG7 A;  1OZS A;  2BL0 C;  5HKW A;  3BUM B;  3I5F C;  3EKH A;  4HRG A;  1LA0 A;  2M97 A;  4R1E A;  1X02 A;  1OOJ A;  2QEB A;  1QV0 A;  3VRO A;  1BOD A;  1DJZ A;  1KFU L;  1FF1 A;  3AAJ A;  4ORA B;  2WOR A;  1G8I A;  2PMY A;  1YRU B;  1XA5 A;  1IRJ A;  3EVR A;  1CB1 A;  3OHM B;  2K61 A;  1QS7 A;  2KQY A;  2NZ0 A;  1M31 A;  1P28 A;  4MRX A;  1CFD A;  1J7O A;  1CTR A;  2KBI A;  5AXI A;  2P70 A;  2JNF A;  2JXC A;  1AJ4 A;  1K9K A;  4WQ2 A;  1PVA A;  3WHT B;  2D8N A;  1KWO C;  2ZRS A;  1CMF A;  1QLK A;  1MUX A;  1ZUZ A;  4OR9 B;  2TN4 A;  1YUS A;  1TNW A;  1S6J A;  2NXQ A;  1BR4 B;  4YGA A;  1LIN A;  2KPH A;  1CM1 A;  2L0P A;  4YI9 A;  1GM0 A;  1KWO B;  1VRK A;  3A8R A;  1B8C A;  1CMG A;  1QXP A;  3S0B A;  1QAT A;  2K7O A;  1Y0V H;  4PHJ A;  2MBX A;  2JXL A;  4E68 A;  2JOJ A;  1TIZ A;  3RZS A;  1EJ3 A;  2FCD A;  1YUR A;  2A4J A;  2JC2 A;  1S1E A;  4AQI A;  3OP0 A;  2WND A;  4IL1 A;  4PE7 A;  4GPL B;  5B8I B;  4DIR A;  1A29 A;  2I7A A;  4PHN A;  3D10 A;  3IF7 A;  3SIA A;  3TS5 B;  1DT7 B;  1N65 A;  2L5Y A;  4OVN F;  5ER5 A;  1IJ6 A;  1NWD A;  3KPX A;  1YR5 A;  1N0Y A;  1K8U A;  1NCY A;  2QPT A;  1TWO A;  2K7C A;  3MSE B;  3NSK A;  1IKU A;  3EVV A;  2Q91 A;  2P71 A;  3KO0 A;  3PM8 A;  3R1P A;  4MZJ A;  4MEW A;  1R6P A;  3PN7 C;  5D69 A;  4FQO A;  4NDD A;  1TCO B;  2QDI A;  1SL9 A;  4OZD A;  3BJH A;  1QX2 A;  2L98 A;  1JUO A;  4WRI A;  3M0W A;  1KSO A;  4CFQ A;  3PN7 B;  2BCX A;  2WOS A;  1XK4 A;  2JWW A;  1Z4H A;  2Y4Q A;  3BUO B;  2LMU A;  3BUN B;  4MSP A;  3CR4 X;  3RM1 A;  5HYD A;  3SIB A;  1N2D A;  3SG4 A;  2VRG A;  1JBA A;  2ERB A;  2I94 A;  3CTN A;  3OX5 A;  3O78 A;  1WDC C;  1AJ5 A;  2BBN A;  2AAO A;  2LVV A;  1S3P A;  1ORG A;  1W7J B;  2JQ6 A;  2L5X B;  2KLD A;  2Q4U A;  3QME A;  1FW4 A;  2CT9 A;  4A4B A;  1BJF A;  1H8B A;  3EVU A;  1SY9 A;  5HL1 A;  1IGV A;  1RJV A;  1WDC B;  3OB1 B;  4NQG A;  2F8P A;  1LVC D;  4YGE B;  2BE4 A;  5F6T A;  1YUT A;  4PE1 A;  3B6X A;  3NGV A;  5KTY A;  4GNK B;  4UPG A;  1Z2C B;  2M1K B;  2G2B A;  4FQT A;  5AAN A;  1FI5 A;  2KAV A;  3H4S E;  1W7I B;  5CSJ A;  4YRU A;  2KI4 C;  5CSF A;  1RTP 1;  2LP3 A;  2WCK A;  2M7N A;  2BNX A;  5J3X A;  2H8V A;  1FBV A;  2FOT A;  1TNP A;  2BKI B;  2BCB A;  1FPW A;  1B47 A;  2KI4 B;  3DZT A;  1OZO A;  1K9P A;  3NXA A;  1CDN A;  1HQV A;  1Y1A A;  1YX7 A;  2LHI A;  2V53 A;  1HT9 A;  1EXR A;  2KAY A;  1NSH A;  2K2A A;  1C3Y A;  1G33 A;  1QIV A;  3I5H C;  1CFF A;  1DEK A;  2DOQ A;  1SRA A;  2PQL A;  1B7T Z;  3CZ1 A;  2CXJ A;  2MHH A;  3CWG A;  4NDC A;  4A4C A;  3ZNI A;  4GBA A;  1L2O C;  1BMO A;  2L4H A;  3D77 A;  1YRT B;  3EK4 A;  4JPZ B;  3I5H B;  1LA3 A;  2KI6 D;  2L51 A;  2EC6 C;  3HX4 A;  2OS8 C;  2AMI A;  4MZK A;  4GUK A;  1OQP A;  1CDM A;  1F4Q A;  1L2O B;  4TNC A;  1SSE B;  1NUB A;  2KQ6 A;  2QEH A;  3A4U B;  4YGD B;  1QX5 B;  1KQV A;  4M2P A;  3BFH A;  1PK0 D;  2LP2 A;  2MRD A;  1RFJ A;  4ICB A;  4JKT A;  2OS8 B;  1AP4 A;  1UHI A;  2JT0 A;  1OE9 B;  3CGA A;  1TN4 A;  1MF8 B;  2HQW A;  2KGB C;  2F33 A;  1JFK A;  2BAP A;  3LK1 A;  2QEO A;  3B88 A;  1SKT A;  1OW4 A;  4JQ0 D;  3CZT X;  2KYC A;  1F8H A;  1LS8 A;  1NCX A;  2JPT A;  2WC5 A;  3CDN A;  1J1E A;  3CR5 X;  4PT1 A;  2ZN8 A;  3TDU A;  3CLN A;  3K1E A;  1WY9 A;  3B86 A;  2LNK A;  3S0E A;  2LCP A;  1DJY A;  3SG3 A;  3PM2 A;  2WCF A;  3EK7 A;  4C0K A;  3VGO A;  2SAS A;  2BL0 B;  2I2R E;  3I5F B;  4PCW A;  1DJW A;  2PAS A;  3OBV A;  2B1U A;  2M8U A;  2NCP A;  1CLB A;  2BBM A;  1CNP A;  1YVH A;  1EG3 A;  4N1G A;  2MAZ A;  2GGM A;  2JT3 A;  1SCV A;  2E6W A;  3BUX B;  3PSR A;  2LLT A;  1SPY A;  3R1V A;  4QJ5 B;  1MR8 A;  3DVK A;  4N1F A;  3GK2 A;  4BY4 A;  1K96 A;  1SW8 A;  3C1V A;  2JZI A;  5D7F A;  1ZAC A;  2WCJ A;  3EKJ A;  1F71 A;  1ZFS A;  1KSM A;  5FI7 A;  4MZL A;  1PSB A;  2FJY A;  1KQM C;  1SYM A;  3S0A A;  4OKH A;  1BF5 A;  1GQM A;  1LXF C;  1OMD A;  2LVK A;  3I5G C;  1WRK A;  4C0J A;  1LKJ A;  3CZ2 A;  2M9G A;  3N7H A;  3NHT A;  1YTZ C;  5KSZ A;  3IQO A;  1CDP A;  1K9U A;  1Y1X A;  3GK1 A;  5IBW A;  3S0F A;  1KQM B;  1AHR A;  3OGN A;  3BXK A;  1W9Z A;  1DJG A;  2LLU A;  3DVM A;  1S6C A;  3F45 A;  4NDB A;  2KFF A;  5DKR A;  1UP5 A;  4MN0 A;  4AOM A;  2HF5 A;  4C0L A;  1M45 A;  3FS7 A;  1BG1 A;  3D0Y B;  2M3W A;  4OCI A;  4WQ3 A;  1AUI B;  2HET A;  4M2O A;  2KLE A;  1OOH A;  4QJ3 B;  2LMV A;  3D73 A;  1UUS A;  1T14 A;  4PE4 A;  1XO5 A;  3D74 A;  1UWO A;  1XFU O;  2ZRT A;  1KK8 C;  1ZOT B;  3BOW B;  1S36 A;  3D0Y A;  3D75 A;  3WHU B;  5FYX A;  2LUC A;  2HPS A;  1IQ5 A;  4GGF C;  2ZN9 A;  4XJK B;  2F2P A;  3DF0 B;  2JT8 A;  1CLM A;  1NX2 A;  4PHM A;  1M46 A;  1FI6 A;  1QLS A;  3TZ1 A;  1JFJ A;  1BU3 A;  4GGN A;  1G4Y R;  3D78 A;  2KFG A;  2OPO A;  4HRE E;  3FWC A;  2H61 C;  3KEV A;  3S0D A;  3DF0 A;  2SCP A;  2O60 A;  1GJY A;  1TCF A;  1DMO A;  3PAT A;  3NSI A;  4CFR A;  2L50 A;  1SL7 A;  4GGF A;  1KK7 Z;  4GFT A;  1A75 B;  1B4C A;  4HSZ A;  3LK0 A;  4I5K A;  5I2O A;  1WRL A;  4U8D A;  1DEL A;  2GGZ A;  3OX6 A;  4ZCV A;  4CID A;  1JSA A;  3VRQ A;  2Y5I A;  2Y1N A;  3GOF A;  1OOI X;  2JTZ A;  1XFW O;  2OTG C;  3DVE A;  2H61 A;  4KYN A;  2PRU A;  2LMT A;  3V2L A;  1JF2 A;  2KYF A;  2WCL A;  5TNC A;  1PAL A;  2F3Z A;  3WNX B;  3EG5 B;  3O6B A;  2M29 A;  4N5X A;  1XFR A;  2IS9 A;  1QVI Z;  1OOG A;  1DC1 A;  1CM4 A;  2OTG B;  1XFZ O;  2K7B A;  3L4A A;  3UO9 A;  3FWB A;  1J7P A;  2BEC A;  1SNL A;  3BFA A;  1OMR A;  3D76 A;  1NX3 A;  1F4O A;  2JU0 A;  2NLN A;  4PHK A;  1NCZ A;  1QVI Y;  1L7Z A;  1U5I B;  1H4B A;  1SR6 C;  2R2I A;  3TDZ A;  4DCK A;  5K89 A;  3JTD C;  1ALW A;  3GK4 X;  5I2Q A;  5KU1 A;  4I5N B;  5DKN A;  1B7T Y;  2WCH A;  5ER4 X;  3TDI A;  1REC A;  1ODB A;  5DKQ A;  1C07 A;  5CSN A;  2MJW B;  2ZKM X;  3CS1 A;  3R1O A;  1IWQ A;  1V1F A;  3FIA A;  3SG6 A;  3JTD B;  1U5I A;  2LC5 A;  2LUX A;  2WCB A;  1XFV O;  1C3Z A;  1S5G Z;  2MA2 A;  2EC6 B;  3CYZ A;  3NSL A;  3TUY C;  2LHL A;  5G08 A;  1NX0 A;  3L47 A;  2M1U A;  1JWD A;  3E3R A;  1K93 D;  1UHN A;  1DGV A;  3TUY B;  2CTN A;  2GV5 A;  2ZFD A;  2K7D A;  2ISD A;  1A4P A;  3RLZ A;  2WC8 A;  2K8M B;  1OOF A;  2EGD A;  1PVB A;  4MBE A;  3SS4 A;  2I18 A;  3VRN A;  1YVL A;  3BFB A;  1Q80 A;  1M39 A;  1J7Q A;  4MRY A;  1MWN A;  3EK8 A;  4DUQ A;  4QJ4 B;  1S6I A;  1XVJ A;  2CBL A;  1NPQ A;  2GTE A;  3O2P A;  4IJ7 A;  3S0G A;  4F7F A;  4PE0 A;  3SS5 A;  2E30 A;  2QEV A;  4USL A;  3O4X A;  5JOL A;  1BLQ A;  3AAK A;  1MQ1 A;  4ORC B;  4AQJ A;  4DRW A;  5HKZ A;  1B1G A;  3QRX A;  1RK9 A;  1V1G A;  4P5O E;  2FCE A;  1QAS A;  1WLZ A;  2LE9 B;  4I5J A;  3LCP C;  5HKY A;  4CLN A;  3NHI A;  2WCM A;  3AKB A;  1EH2 A;  2LVI A;  2M7L A;  1YX8 A;  2HQ8 A;  1GGZ A;  5AFP A;  3Q8I A;  3CZ0 A;  3HCM A;  4YGC B;  2KGR A;  1AK8 A;  1PRW A;  1Y6W A;  2BCA A;  2JRF A;  1J7R A;  2WC6 A;  3PJI A;  5I2L A;  1OSA A;  1DJX A;  2F2O A;  2L2C A;  3L4L A;  1TUJ A;  1QWV A;  3FE8 A;  4BY5 A;  4Q04 A;  2M49 B;  2FJU B;  1QTX A;  2RGI A;  4JWQ A;  4YGB B;  5FI2 A;  1DVI A;  5GQQ C;  1SCM C;  1UHJ A;  3B87 A;  3FE9 A;  3I5G B;  1BOC A;  1K94 A;  2K0J A;  2PSR A;  3OB2 B;  1XYD A;  4JD9 A;  3SG2 A;  1QV1 A;  1SCM B;  2JTT A;  3BQ3 A;  1BR1 B;  3BYA A;  1MHO A;  1TTX A;  2WCE A;  5EL2 A;  2K2F A;  1TOP A;  3KHE A;  3PLF B;  3TS5 C;  1EL4 A;  5HLO A;  1DJH A;  1D1O A;  3DVJ A;  1B8R A;  1J55 A;  2LLS A;  3DD4 A;  1NYA A;  2LVJ A;  1AVS A;  5AEQ A;  2MLF C;  3VRP A;  5JJG A;  1F54 A;  1UHK A;  1UUR A;  3NSO A;  1JC2 A;  1XK4 C;  1K90 D;  1KK8 B;  3FE6 A;  1J1D A;  3DY9 A;  2O5G A;  3LLE A;  4HRH A;  1EG4 A;  4INX A;  2ZND A;  3DXL A;  3BOW A;  1TNX A;  3R72 A;  2ZNE A;  3SS3 A;  1B8L A;  2CCM A;  4MLW A;  4FTG A;  4XJK A;  2KNE A;  1OMV A;  2L4I A;  1IQ3 A;  4ORB B;  4L9M A;  1WLM A;  1C7W A;  2KOT A;  2YGU A;  1KCY A;  1F70 A;  2P6B B;  2BE6 A;  5I94 A;  3PAL A;  1PUL A;  1YUU A;  4XYN A;  3SJS A;  1JF0 A;  3VRR A;  1CKK A;  3BUW B;  2AUC A;  4I5L B;  3SG5 A;  4DS7 A;  3ZWH A;  3I5I C;  2G9B A;  5D3O A;  3CR2 A;  3VB1 A;  4CPV A;  2KAX A;  5CPV A;  1SL8 A;  1KK7 Y;  2NCO A;  3JVT C;  1SMG A; 
#chains in the Genus database with same CATH homology
 4F0Z B;  4MVF A;  5HLV A;  1IJ5 A;  3I5I B;  1F55 A;  1A75 A;  1MXL C;  1QX7 A;  2JUL A;  2PVB A;  1A2X A;  1NIW A;  1M63 B;  3JVT B;  1IH0 A;  1DJI A;  1CDL A;  1WRZ A;  1BT6 A;  2EHB A;  1A03 A;  4ETO A;  4OV2 A;  1SK6 D;  2L2E A;  1DF0 B;  3K21 A;  2F3Y A;  5CSI A;  2BKH B;  1S26 D;  4PDZ A;  1K95 A;  4ZCU A;  2COL B;  1KFX S;  1MXE A;  4YI8 A;  4D1E A;  1B9A A;  2Y1M A;  1TRF A;  4PAL A;  1UHH A;  1NX1 A;  1ZMZ A;  1SR6 B;  1RWY A;  3ICB A;  1DF0 A;  2KI6 C;  2KSP A;  2CNP A;  3O4Y A;  3PFV A;  1SBJ A;  5PAL A;  5AER A;  4YBH B;  2KHN A;  5I8N A;  1E8A A;  1Y1U A;  4P2Y B;  1C7V A;  2MLE C;  1K2H A;  1S5G Y;  1XFX O;  2JNX A;  3IQQ A;  2H2K A;  4M2Q A;  2LAN A;  1RRO A;  3LL8 B;  1ALV A;  1KFX L;  3WXA A;  2KDH A;  3KF9 A;  1QIW A;  1QJT A;  1TNQ A;  2LAP A;  2M0R A;  2QAC A;  1R2U A;  1CLL A;  1KFU S;  2PAL A;  1CFP A;  2KFH A;  1CFC A;  2LM5 A;  1GGW A;  5BPJ A;  2LV7 A;  1XFY O;  1PSR A;  2KBM A;  3AKA A;  4GAO A;  1DTL A;  1DGU A;  1NP8 A;  1IG5 A;  3SG7 A;  1OZS A;  2BL0 C;  5HKW A;  3BUM B;  3I5F C;  3EKH A;  4HRG A;  1LA0 A;  2M97 A;  4R1E A;  1X02 A;  1OOJ A;  1QV0 A;  3VRO A;  1BOD A;  1DJZ A;  1KFU L;  1FF1 A;  3AAJ A;  4ORA B;  2WOR A;  1G8I A;  2PMY A;  1YRU B;  1XA5 A;  1IRJ A;  3EVR A;  1CB1 A;  3OHM B;  2K61 A;  1QS7 A;  2KQY A;  2NZ0 A;  1M31 A;  1J7O A;  4MRX A;  1CFD A;  1CTR A;  2KBI A;  5AXI A;  2JNF A;  2JXC A;  1AJ4 A;  1K9K A;  4WQ2 A;  1PVA A;  3WHT B;  2D8N A;  1KWO C;  2ZRS A;  1CMF A;  1QLK A;  1MUX A;  1ZUZ A;  4OR9 B;  2TN4 A;  1YUS A;  1TNW A;  1S6J A;  2NXQ A;  1BR4 B;  4YGA A;  1LIN A;  1CM1 A;  2L0P A;  4YI9 A;  1KWO B;  1VRK A;  3A8R A;  1B8C A;  1CMG A;  1QXP A;  1QAT A;  2K7O A;  1Y0V H;  4PHJ A;  2MBX A;  2JXL A;  4E68 A;  2JOJ A;  1TIZ A;  1EJ3 A;  2FCD A;  1YUR A;  2A4J A;  2JC2 A;  1S1E A;  4AQI A;  3OP0 A;  2WND A;  4IL1 A;  4PE7 A;  4GPL B;  5B8I B;  4DIR A;  1A29 A;  2I7A A;  4PHN A;  3D10 A;  3IF7 A;  3SIA A;  3TS5 B;  1DT7 B;  1N65 A;  4OVN F;  5ER5 A;  1IJ6 A;  1NWD A;  3KPX A;  1YR5 A;  1N0Y A;  1K8U A;  1NCY A;  2QPT A;  2K7C A;  3MSE B;  3NSK A;  1IKU A;  3EVV A;  2Q91 A;  3KO0 A;  3PM8 A;  4MZJ A;  4MEW A;  1R6P A;  3PN7 C;  5D69 A;  4FQO A;  4NDD A;  1TCO B;  1SL9 A;  1QX2 A;  2L98 A;  1JUO A;  4WRI A;  3M0W A;  1KSO A;  4CFQ A;  3PN7 B;  2BCX A;  2WOS A;  1XK4 A;  2JWW A;  3BUO B;  2Y4Q A;  2LMU A;  3BUN B;  4MSP A;  3CR4 X;  3RM1 A;  5HYD A;  3SIB A;  1N2D A;  3SG4 A;  2VRG A;  1JBA A;  2I94 A;  3CTN A;  3OX5 A;  3O78 A;  1WDC C;  1AJ5 A;  2BBN A;  2AAO A;  2LVV A;  1S3P A;  1W7J B;  2JQ6 A;  2L5X B;  2Q4U A;  1FW4 A;  2CT9 A;  4A4B A;  1BJF A;  1H8B A;  3EVU A;  1SY9 A;  1IGV A;  1RJV A;  1WDC B;  3OB1 B;  4NQG A;  2F8P A;  1LVC D;  4YGE B;  2BE4 A;  5F6T A;  1YUT A;  4PE1 A;  5KTY A;  1FI5 A;  4GNK B;  4UPG A;  2M1K B;  2G2B A;  5AAN A;  2KAV A;  3H4S E;  1W7I B;  5CSJ A;  4YRU A;  2KI4 C;  5CSF A;  1RTP 1;  2LP3 A;  2M7N A;  5J3X A;  1FBV A;  2FOT A;  1TNP A;  2BKI B;  2BCB A;  1FPW A;  1B47 A;  2KI4 B;  1OZO A;  1K9P A;  3NXA A;  1CDN A;  1HQV A;  1Y1A A;  1YX7 A;  2LHI A;  2V53 A;  1HT9 A;  1EXR A;  2KAY A;  1NSH A;  2K2A A;  1G33 A;  1QIV A;  3I5H C;  1CFF A;  2DOQ A;  1SRA A;  1B7T Z;  2CXJ A;  2MHH A;  3CWG A;  4NDC A;  4A4C A;  3ZNI A;  4GBA A;  1L2O C;  1BMO A;  2L4H A;  1YRT B;  3EK4 A;  4JPZ B;  3I5H B;  1LA3 A;  2KI6 D;  2L51 A;  2EC6 C;  3HX4 A;  2OS8 C;  2AMI A;  4MZK A;  4GUK A;  1OQP A;  1CDM A;  1F4Q A;  1L2O B;  4TNC A;  4YGD B;  1NUB A;  2KQ6 A;  1KQV A;  3A4U B;  1QX5 B;  4M2P A;  1PK0 D;  2LP2 A;  2MRD A;  1RFJ A;  4ICB A;  2OS8 B;  1AP4 A;  1UHI A;  2JT0 A;  1OE9 B;  3CGA A;  1TN4 A;  1MF8 B;  2HQW A;  2KGB C;  2F33 A;  1JFK A;  3LK1 A;  1SKT A;  4JQ0 D;  3CZT X;  2KYC A;  1F8H A;  1NCX A;  2JPT A;  1J1E A;  3CR5 X;  2ZN8 A;  3TDU A;  3CLN A;  1WY9 A;  2LNK A;  2LCP A;  1DJY A;  3SG3 A;  2WCF A;  3EK7 A;  4C0K A;  3VGO A;  2SAS A;  2BL0 B;  2I2R E;  3I5F B;  4PCW A;  1DJW A;  2PAS A;  2B1U A;  2M8U A;  2NCP A;  1CLB A;  2BBM A;  1CNP A;  1YVH A;  1EG3 A;  4N1G A;  2MAZ A;  2GGM A;  2JT3 A;  1SCV A;  2E6W A;  3BUX B;  3PSR A;  2LLT A;  1SPY A;  4QJ5 B;  1MR8 A;  3DVK A;  4N1F A;  3GK2 A;  4BY4 A;  1K96 A;  1SW8 A;  3C1V A;  2JZI A;  5D7F A;  1ZAC A;  3EKJ A;  1F71 A;  1ZFS A;  1KSM A;  4MZL A;  1PSB A;  1KQM C;  1SYM A;  4OKH A;  1BF5 A;  1GQM A;  1LXF C;  1OMD A;  2LVK A;  3I5G C;  1WRK A;  4C0J A;  1LKJ A;  2M9G A;  1YTZ C;  5KSZ A;  3IQO A;  1CDP A;  1K9U A;  1Y1X A;  3GK1 A;  5IBW A;  1KQM B;  1AHR A;  3BXK A;  1DJG A;  2LLU A;  3DVM A;  1S6C A;  3F45 A;  4NDB A;  2KFF A;  5DKR A;  1UP5 A;  4MN0 A;  4AOM A;  2HF5 A;  4C0L A;  1M45 A;  3FS7 A;  1BG1 A;  3D0Y B;  2M3W A;  4OCI A;  4WQ3 A;  1AUI B;  2HET A;  4M2O A;  4QJ3 B;  2LMV A;  1UUS A;  4PE4 A;  1XO5 A;  1UWO A;  1XFU O;  2ZRT A;  1KK8 C;  1ZOT B;  3BOW B;  1S36 A;  3D0Y A;  3WHU B;  5FYX A;  2LUC A;  2HPS A;  1IQ5 A;  4GGF C;  2ZN9 A;  4XJK B;  2F2P A;  3DF0 B;  2JT8 A;  1CLM A;  1NX2 A;  4PHM A;  1M46 A;  1FI6 A;  1QLS A;  3TZ1 A;  1JFJ A;  1BU3 A;  4GGN A;  1G4Y R;  2KFG A;  2OPO A;  4HRE E;  3FWC A;  2H61 C;  3KEV A;  3DF0 A;  2SCP A;  2O60 A;  1GJY A;  1TCF A;  1DMO A;  3PAT A;  3NSI A;  4CFR A;  2L50 A;  1SL7 A;  4GGF A;  1KK7 Z;  4GFT A;  1A75 B;  1B4C A;  4HSZ A;  3LK0 A;  4I5K A;  5I2O A;  1WRL A;  4U8D A;  2GGZ A;  3OX6 A;  4ZCV A;  4CID A;  1JSA A;  3VRQ A;  2Y5I A;  2Y1N A;  3GOF A;  2JTZ A;  1XFW O;  2OTG C;  3DVE A;  2H61 A;  2PRU A;  2LMT A;  1JF2 A;  2KYF A;  5TNC A;  3WNX B;  1PAL A;  2F3Z A;  3O6B A;  2M29 A;  4N5X A;  2IS9 A;  1QVI Z;  1CM4 A;  2OTG B;  1XFZ O;  2K7B A;  1J7P A;  3FWB A;  2BEC A;  1SNL A;  1OMR A;  1NX3 A;  1F4O A;  2JU0 A;  2NLN A;  4PHK A;  1NCZ A;  1QVI Y;  1L7Z A;  1U5I B;  1H4B A;  1SR6 C;  2R2I A;  3TDZ A;  4DCK A;  5K89 A;  3JTD C;  1ALW A;  3GK4 X;  5I2Q A;  5KU1 A;  4I5N B;  5DKN A;  1B7T Y;  5ER4 X;  3TDI A;  1REC A;  1ODB A;  5DKQ A;  1C07 A;  5CSN A;  2MJW B;  2ZKM X;  3CS1 A;  3SG6 A;  1IWQ A;  1V1F A;  3FIA A;  3JTD B;  1U5I A;  2LC5 A;  2LUX A;  2WCB A;  1XFV O;  1S5G Z;  2MA2 A;  2EC6 B;  3NSL A;  3TUY C;  2LHL A;  5G08 A;  1NX0 A;  2M1U A;  1JWD A;  3E3R A;  1K93 D;  1UHN A;  1DGV A;  3TUY B;  2CTN A;  2GV5 A;  2ZFD A;  2K7D A;  2ISD A;  1A4P A;  3RLZ A;  2WC8 A;  2K8M B;  4MBE A;  2EGD A;  1PVB A;  2I18 A;  3VRN A;  1YVL A;  1Q80 A;  1M39 A;  1J7Q A;  4MRY A;  1MWN A;  3EK8 A;  4DUQ A;  4QJ4 B;  1S6I A;  1XVJ A;  2CBL A;  1NPQ A;  3O2P A;  4PE0 A;  2E30 A;  4USL A;  5JOL A;  1BLQ A;  3AAK A;  1MQ1 A;  4ORC B;  4AQJ A;  4DRW A;  5HKZ A;  1B1G A;  3QRX A;  1RK9 A;  1V1G A;  4P5O E;  2FCE A;  1QAS A;  1WLZ A;  2LE9 B;  4I5J A;  3LCP C;  5HKY A;  4CLN A;  3AKB A;  1EH2 A;  2LVI A;  2M7L A;  1YX8 A;  2HQ8 A;  1GGZ A;  5AFP A;  3HCM A;  4YGC B;  2KGR A;  1AK8 A;  1PRW A;  1Y6W A;  2BCA A;  2JRF A;  1J7R A;  5I2L A;  1OSA A;  1DJX A;  2F2O A;  4BY5 A;  4Q04 A;  2M49 B;  2FJU B;  1QTX A;  2RGI A;  4JWQ A;  4YGB B;  1DVI A;  5GQQ C;  1SCM C;  1UHJ A;  3I5G B;  1BOC A;  1K94 A;  2K0J A;  2PSR A;  3OB2 B;  1XYD A;  3SG2 A;  1QV1 A;  1SCM B;  2JTT A;  3BQ3 A;  1BR1 B;  3BYA A;  1MHO A;  1TTX A;  2WCE A;  2K2F A;  1TOP A;  3KHE A;  3PLF B;  3TS5 C;  1EL4 A;  5HLO A;  1DJH A;  1D1O A;  3DVJ A;  1B8R A;  1J55 A;  2LLS A;  3DD4 A;  1NYA A;  2LVJ A;  1AVS A;  5AEQ A;  2MLF C;  3VRP A;  5JJG A;  1F54 A;  1UHK A;  1UUR A;  3NSO A;  1JC2 A;  1XK4 C;  1K90 D;  1KK8 B;  3LLE A;  1J1D A;  4HRH A;  2O5G A;  1EG4 A;  2ZND A;  3BOW A;  1TNX A;  2ZNE A;  1B8L A;  2CCM A;  4MLW A;  4FTG A;  4XJK A;  2KNE A;  1OMV A;  2L4I A;  1IQ3 A;  4ORB B;  4L9M A;  1WLM A;  1C7W A;  2KOT A;  1KCY A;  1F70 A;  2P6B B;  2BE6 A;  3PAL A;  1PUL A;  1YUU A;  4XYN A;  3SJS A;  1JF0 A;  3VRR A;  1CKK A;  3BUW B;  2AUC A;  4I5L B;  3SG5 A;  4DS7 A;  3ZWH A;  3I5I C;  2G9B A;  3CR2 A;  4CPV A;  2KAX A;  5CPV A;  1SL8 A;  1KK7 Y;  2NCO A;  3JVT C;  1SMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...