1AP4A

Regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium-binding
molecule keywords CARDIAC N-TROPONIN C
publication title Calcium-induced structural transition in the regulatory domain of human cardiac troponin C.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 1997-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ap4A00
3SG3A 4MN0A 1XO5A 1EL4A 1NCXA 1J7PA 4GNKB 3DVEA 1F4OA 2K2FA 3I5GB 5HLOA 3WHTB 3HCMA 1BG1A 1ALVA 3CWGA 5KU1A 2LC5A 1CDLA 3A8RA 5HYDA 4PALA 3O4YA 1X02A 2GGZA 1SL9A 2H2KA 2H61C 2KQ6A 1W7JB 1JF0A 1CDNA 1KSMA 1XFYO 5CSIA 4XJKA 3BUNB 1KQMB 1TOPA 3I5GC 3O78A 3KHEA 4A4BA 5I2OA 4M2PA 3QRXA 1CFFA 4FTGA 1JWDA 1A03A 1KK7Y 2Q91A 4PE0A 1NX1A 3CLNA 4ORAB 3BUWB 2JZIA 1AHRA 2LMTA 2JC2A 4MZJA 3TS5B 1F8HA 1WLMA 3DVJA 1CDPA 3JVTB 1Y1UA 4USLA 3F45A 1V1FA 2LANA 5HKWA 1TN4A 1XFVO 3D10A 2QACA 1TNQA 1PVBA 1UHHA 3BUOB 4PHMA 1Q80A 3ZWHA 4MSPA 2BKIB 3M0WA 1AUIB 1XFWO 2F3YA 5GQQC 1IG5A 2M1UA 1LVCD 1ZFSA 3TS5C 1S1EA 1YRUB 2K7CA 5JOLA 3JVTC 4DIRA 2LUCA 2LP3A 4M2OA 1B7TY 2BBMA 1OMVA 5DKQA 1WDCB 2KYFA 1A29A 1CDMA 2MAZA 4C0LA 1BR4B 3I5IB 1IQ5A 2WCEA 4WQ3A 1F71A 1NX0A 2ZRTA 2L0PA 1S6JA 1EXRA 1DJIA 4NDCA 4ZCVA 2WNDA 1UURA 2HF5A 1CKKA 1UHIA 1DJHA 1DF0A 2LVKA 5CSJA 1XK4A 2M7NA 1WDCC 4ETOA 1OMRA 1TIZA 2LV7A 4MLWA 4MEWA 2FCEA 1ZOTB 1DJYA 2JTTA 2L4IA 3EK7A 3SIAA 3TUYC 2JXLA 1QLKA 5CPVA 3SG6A 1C7VA 3WNXB 1DJWA 2KBIA 4I5KA 2KHNA 2MLEC 2LMUA 2BL0C 3NXAA 3PLFB 5D69A 2OTGB 2Y4QA 3CR4X 1RFJA 1TNXA 4OV2A 4PE4A 1DT7B 1K9KA 1ZMZA 1E8AA 2BCBA 2D8NA 4I5JA 1B7TZ 2LCPA 2I2RE 1B4CA 3FIAA 1JSAA 4GGNA 2MLFC 1RROA 4OVNF 5K89A 2KDHA 3NSIA 1SRAA 1F4QA 1GGZA 5I2LA 3IF7A 1A75A 2E30A 2FOTA 1CM4A 2QPTA 3SG5A 4MBEA 3BXKA 2COLB 2Q4UA 1MHOA 2LAPA 1FI6A 2GGMA 3KEVA 1BF5A 1A2XA 1L2OB 4IL1A 4C0JA 1XVJA 4MRXA 3NSKA 1H4BA 1NCZA 3DVKA 1JBAA 1L7ZA 1UHNA 2I94A 1PULA 3PN7C 2EGDA 3AKBA 1OQPA 1V1GA 2SASA 2MBXA 1Y1AA 3D0YA 3PATA 1BLQA 4OKHA 2ZRSA 1K90D 1L2OC 1UP5A 1NIWA 2KSPA 3OB1B 1J7OA 2MHHA 4JPZB 1NWDA 2LLUA 5G08A 4AQJA 1ODBA 4BY5A 4XYNA 3KF9A 4D1EA 1WRZA 2KFFA 2K2AA 4AOMA 3BOWB 5DKNA 2O5GA 4CPVA 1FF1A 1RWYA 1NX2A 1U5IB 4YGAA 1QS7A 1NSHA 1M63B 1OOJA 1IWQA 1BT6A 1SCVA 4TNCA 1AP4A 2NCOA 2F8PA 1J7QA 3KO0A 3OB2B 1ALWA 3DD4A 1Y0VH 4GAOA 4R1EA 1EJ3A 2KI6D 3VRPA 3BYAA 2ISDA 3CZTX 5D7FA 1GGWA 2B1UA 3PALA 4M2QA 2KQYA 1QV0A 4F0ZB 1F70A 1DJGA 1PALA 1W7IB 4NDDA 5BPJA 4DCKA 1YUUA 2I7AA 4GGFC 3VRRA 5KTYA 1D1OA 1IJ5A 2HPSA 1S6CA 2O60A 2LHLA 3ICBA 2M9GA 4PHJA 5ER4X 1Y6WA 1Y1XA 1RJVA 3BQ3A 3GOFA 5KSZA 3LK0A 1OE9B 1ZACA 2JT8A 4GUKA 1RTP1 3BUMB 5CSFA 1S3PA 3WXAA 4YRUA 1IH0A 2WC8A 3PFVA 4UPGA 2M1KB 5IBWA 1FW4A 3EVUA 2I18A 3OX5A 1DMOA 1MWNA 1TNWA 1KSOA 2IS9A 1UHJA 3DF0A 1QIVA 1TNPA 1MF8B 2KGBC 2M7LA 2KNEA 4OR9B 4Q04A 4WQ2A 2PASA 4YBHB 2JPTA 2FCDA 2G2BA 1MUXA 2RGIA 1A4PA 4FQOA 4PHNA 1YRTB 4U8DA 2LLSA 5TNCA 1EG4A 2LP2A 3CGAA 2ZFDA 1HT9A 3LLEA 1FI5A 5HKYA 3SJSA 2M97A 2CCMA 2JNFA 1KFUS 4GBAA 2WORA 2BKHB 2K0JA 3TUYB 4CFQA 2JULA 3BUXB 3RLZA 3VGOA 1ZUZA 2P6BB 2MRDA 1AK8A 2BL0B 1J1EA 1XYDA 2NCPA 4A4CA 1XFXO 1XFUO 1KFUL 2A4JA 2KI6C 4DRWA 1LINA 1YURA 3O6BA 5J3XA 2LVJA 3EKJA 4PE1A 4ZCUA 4PCWA 1QV1A 1DTLA 3DVMA 3AKAA 2M8UA 3O2PA 4HRHA 4XJKB 1SCMB 3MSEB 5AFPA 1QATA 2KOTA 1JFKA 5JJGA 1CB1A 1B9AA 1IKUA 5F6TA 1JF2A 1YR5A 2ZNDA 1F54A 1OZOA 2Y1NA 2EC6C 1QASA 2H61A 2ZKMX 3EKHA 5PALA 1K94A 1B8RA 1JC2A 1CLMA 2K7OA 1DJZA 1B8CA 4E68A 2AMIA 1B1GA 1YUTA 4MZLA 1SR6B 1SCMC 1LA3A 2HETA 1YVHA 1AJ4A 2JTZA 1PK0D 3PN7B 1BR1B 2VRGA 1SY9A 1QXPA 1KK8B 5AERA 1AVSA 2JWWA 2HQWA 3AAKA 1K9UA 1CFCA 1MR8A 2WCFA 4MZKA 1SR6C 2KI4C 3JTDC 3OX6A 4N1GA 1BU3A 4QJ5B 1DGVA 3FS7A 3I5FC 4C0KA 5I8NA 1LXFC 4BY4A 4GFTA 2EHBA 1VRKA 3E3RA 3SG4A 1CMFA 1C07A 3GK2A 1YX7A 1IRJA 1KK8C 1MXLC 2GV5A 1YX8A 2V53A 1M45A 1K2HA 1S5GY 3TDIA 1PSRA 1DF0B 1YVLA 1K9PA 2JU0A 4NQGA 3VRQA 1CTRA 1QLSA 3EK8A 1NCYA 3EVVA 1BOCA 2M29A 2KAYA 1QVIY 2WOSA 3VRNA 2K7BA 3EVRA 4ORBB 4N5XA 3TZ1A 1G8IA 1EH2A 1DJXA 1AJ5A 1XFZO 1UUSA 5HKZA 1BJFA 1TCFA 2ZN9A 1R2UA 1MQ1A 1XK4C 2F3ZA 2JOJA 1BODA 2M0RA 2Y5IA 2JT3A 3AAJA 3I5HC 4YGEB 1IQ3A 2LLTA 3HX4A 1CLBA 1B8LA 2ZN8A 1DGUA 5B8IB 1PSBA 1A75B 1N0YA 1CFPA 1H8BA 1K93D 1S5GZ 2SCPA 1S26D 4L9MA 1CFDA 1QX7A 1PRWA 2K61A 2PMYA 1OMDA 2Y1MA 2L98A 1RECA 2LVVA 3C1VA 3LK1A 1J7RA 1WY9A 4PDZA 1NYAA 1SNLA 2L51A 1TCOB 3ZNIA 4P2YB 3WHUB 2KBMA 2KAXA 2NZ0A 2G9BA 1WRLA 2HQ8A 2CXJA 1XA5A 2BCXA 1QVIZ 1CLLA 4I5NB 2E6WA 3FWCA 1QTXA 1KFXS 2PVBA 5AXIA 3CR5X 4MRYA 4YI9A 4CLNA 1JFJA 3D0YB 4CFRA 1CM1A 1LKJA 2K8MB 2KGRA 1R6PA 2BECA 2JRFA 3SG2A 4P5OE 1G4YR 3A4UB 3PSRA 1KFXL 1KQMC 2DOQA 3H4SE 1YUSA 2BE6A 2JQ6A 1G33A 2BBNA 2F2OA 2LE9B 2TN4A 3CR2A 4QJ3B 3EK4A 1J55A 4PE7A 1IJ6A 2KAVA 1FPWA 1KWOB 1K95A 2JNXA 2M3WA 2PSRA 1QJTA 4MVFA 4AQIA 1F55A 1KCYA 3TDUA 1IGVA 1K8UA 1SPYA 2BCAA 2EC6B 2F33A 3SG7A 2KYCA 1B47A 1EG3A 3VROA 2JT0A 1QX2A 1BMOA 2L4HA 1UWOA 4HSZA 1JUOA 2NLNA 1SW8A 1QX5B 2OPOA 2LM5A 1KWOC 4NDBA 4WRIA 3CTNA 1SMGA 4CIDA 2CBLA 1KK7Z 1NPQA 3TDZA 1GJYA 1RK9A 3NSOA 4DS7A 1M46A 5CSNA 5AEQA 3CS1A 3KPXA 2WCBA 1PVAA 1TTXA 4JQ0D 1OZSA 3FWBA 4HREE 1YTZC 4YGCB 1FBVA 2KI4B 3JTDB 3BOWA 1SYMA 2MJWB 3I5IC 1U5IA 3I5FB 4I5LB 2AUCA 4GGFA 3DF0B 1M39A 1LA0A 2BE4A 3OP0A 2OS8B 1SL8A 4QJ4B 1S36A 1N65A 1SKTA 3NSLA 2M49B 1HQVA 1J1DA 3GK1A 1SL7A 5HLVA 2AAOA 2PRUA 3LL8B 2K7DA 1KQVA 3PM8A 2CNPA 4ICBA 1K96A 1MXEA 1CNPA 2R2IA 1DVIA 3RM1A 3OHMB 2LHIA 2LMVA 2OS8C 2L50A 2LNKA 4DUQA 2OTGC 2KFGA 1S6IA 2NXQA 2PALA 1WLZA 2LVIA 1QIWA 1SBJA 1GQMA 4ORCB 2MA2A 3LCPC 1CMGA 4YGBB 2ZNEA 1NP8A 1NUBA 1TRFA 5ER5A 1M31A 2FJUB 3K21A 5AANA 1WRKA 1OSAA 4YGDB 2CT9A 3IQOA 4JWQA 3I5HB 3IQQA 1N2DA 2F2PA 1NX3A 4OCIA 4PHKA 2L2EA 2L5XB 4YI8A 1C7WA 1SK6D 4N1FA 5I2QA 4GPLB 2JXCA 2KFHA 2CTNA 3GK4X 5DKRA 1UHKA 5FYXA 4HRGA 3SIBA 2LUXA
chains in the Genus database with same CATH superfamily
3SG3A 4MN0A 1XO5A 1EL4A 5FI6A 1NCXA 1J7PA 4GNKB 3DVEA 1F4OA 2K2FA 3I5GB 5HLOA 3WHTB 3HCMA 3V2LA 3UNWA 1BG1A 3R72A 1ALVA 3CWGA 5DICA 5KU1A 2LC5A 1CDLA 3A8RA 5HYDA 4PALA 3O4YA 1X02A 1DEKA 2GGZA 1SL9A 2H2KA 2H61C 2KQ6A 1W7JB 1JF0A 3FE8A 1CDNA 1KSMA 1XFYO 3D74A 5CSIA 3CYZA 4XJKA 3BUNB 1KQMB 1TOPA 3I5GC 2L2CA 3O78A 3KHEA 4A4BA 5I2OA 4M2PA 2GTEA 3QRXA 1CFFA 4FTGA 1JWDA 3NHIA 3S0FA 1A03A 1Z2CB 1KK7Y 2Q91A 4PE0A 1NX1A 3CLNA 4ORAB 3BUWB 2JZIA 1AHRA 2LMTA 2JC2A 4MZJA 3TS5B 1SSEB 1WLMA 3DVJA 1CDPA 3JVTB 1F8HA 1Y1UA 4USLA 3BFBA 1TUZA 2PYQA 3F45A 1V1FA 3SS5A 2LANA 5HKWA 1TN4A 1XFVO 3D10A 2QACA 1TNQA 1PVBA 1UHHA 1IIOA 3NHTA 3BUOB 4PHMA 1Q80A 3ZWHA 4MSPA 2BKIB 2WCLA 3M0WA 1AUIB 1XFWO 2F3YA 5GQQC 1IG5A 2M1UA 1LVCD 1ZFSA 3TS5C 1S1EA 1YRUB 2K7CA 5JOLA 3JVTC 4DIRA 2LUCA 3BJHA 2LP3A 4M2OA 1B7TY 4OZDA 2BBMA 1OMVA 5DKQA 3D77A 1WDCB 3Q8IA 2KYFA 1A29A 1CDMA 3EG5B 2MAZA 4C0LA 3CZ1A 1BR4B 3I5IB 1IQ5A 3CZ2A 2WCEA 4WQ3A 1F71A 1NX0A 2ZRTA 2L0PA 1S6JA 1EXRA 1DJIA 4NDCA 4ZCVA 2WNDA 1UURA 2HF5A 1CKKA 1UHIA 1DJHA 1DF0A 2LVKA 3CDNA 5CSJA 1XK4A 2QDIA 2M7NA 1WDCC 3FE9A 4JKTA 4ETOA 1OMRA 1TIZA 2LV7A 4MLWA 1TWOA 4MEWA 2FCEA 1ZOTB 1DJYA 2JTTA 2L4IA 3EK7A 3SIAA 3TUYC 2JXLA 3S0GA 5FI7A 1QLKA 5CPVA 3SG6A 1C7VA 3WNXB 1DJWA 2KBIA 2KLDA 4I5KA 2KHNA 2MLEC 2LMUA 2BL0C 3NXAA 3PLFB 5D69A 2PQLA 2OTGB 2Y4QA 1LS8A 3CR4X 3UO9A 1RFJA 1TNXA 4OV2A 4PE4A 1DT7B 2ERBA 1K9KA 1ZMZA 1E8AA 2BCBA 2D8NA 4I5JA 1B7TZ 2LCPA 2I2RE 4INXA 4KYNA 1B4CA 3FIAA 1JSAA 4GGNA 2MLFC 1RROA 4OVNF 2BNXA 5K89A 3NGVA 2KDHA 3NSIA 1SRAA 1F4QA 1GGZA 5I2LA 3IF7A 1A75A 2E30A 2FOTA 1CM4A 2QPTA 3SG5A 3CZ0A 4MBEA 3BXKA 2COLB 2Q4UA 1MHOA 2LAPA 1FI6A 2GGMA 3KEVA 1BF5A 1A2XA 1L2OB 4IL1A 4C0JA 1XVJA 4MRXA 3NSKA 1H4BA 1NCZA 3DVKA 1JBAA 1L7ZA 1UHNA 2I94A 1PULA 3PN7C 1GM0A 2EGDA 3AKBA 1OQPA 1V1GA 2SASA 3L4LA 2P70A 2MBXA 1Y1AA 2WC5A 3D0YA 3PATA 1BLQA 2K60A 2ZRSA 1K90D 4OKHA 1L2OC 2QEOA 1UP5A 1NIWA 2KSPA 3OB1B 1J7OA 2MHHA 4JPZB 1NWDA 2LLUA 5G08A 4AQJA 1ODBA 4BY5A 4XYNA 3KF9A 4D1EA 1WRZA 3B88A 2KFFA 1Z4HA 2K2AA 4AOMA 3BOWB 5DKNA 2O5GA 4CPVA 1FF1A 1RWYA 1NX2A 1U5IB 4YGAA 1QS7A 1NSHA 1M63B 1OOJA 1IWQA 1BT6A 1SCVA 4TNCA 1AP4A 2NCOA 2F8PA 1J7QA 3KO0A 3OB2B 1ALWA 3DD4A 1Y0VH 2FJYA 4GAOA 4R1EA 1EJ3A 2KI6D 3VRPA 3BYAA 2ISDA 3CZTX 5D7FA 1GGWA 2B1UA 3PALA 4M2QA 2KQYA 1QV0A 4F0ZB 1F70A 1DJGA 1PALA 1W7IB 4NDDA 5BPJA 4DCKA 1YUUA 2I7AA 4GGFC 3VRRA 5KTYA 1D1OA 1IJ5A 2HPSA 1S6CA 2O60A 2LHLA 2BAPA 3ICBA 2M9GA 4PHJA 5ER4X 1Y6WA 1Y1XA 1RJVA 3BQ3A 3GOFA 5KSZA 3LK0A 1OE9B 1ZACA 2JT8A 4GUKA 1RTP1 3BUMB 5CSFA 1S3PA 3WXAA 4YRUA 1IH0A 2QEVA 2WC8A 3PFVA 4UPGA 2M1KB 5IBWA 1T14A 1FW4A 3EVUA 3RZSA 2I18A 3OX5A 1DMOA 1MWNA 1TNWA 3D78A 1KSOA 2IS9A 1UHJA 3DF0A 1QIVA 3R1OA 1TNPA 1MF8B 2KGBC 2M7LA 2KNEA 5EL2A 1OW4A 3CABA 4OR9B 4Q04A 4INWA 4WQ2A 2PASA 4YBHB 2JPTA 2FCDA 2G2BA 1MUXA 2RGIA 1A4PA 3N7HA 4FQOA 4PHNA 1YRTB 4U8DA 2LLSA 4F7FA 5TNCA 1EG4A 2LP2A 3CGAA 2ZFDA 1HT9A 3LLEA 1FI5A 5HKYA 3SJSA 2M97A 2CCMA 2JNFA 1KFUS 4GBAA 3B6XA 2WORA 2BKHB 2K0JA 3TUYB 4CFQA 2JULA 5I94A 3BUXB 3RLZA 3VGOA 2WCHA 1ZUZA 2P6BB 1OOHA 2MRDA 1AK8A 2BL0B 1J1EA 1XYDA 2NCPA 2WCKA 4A4CA 1XFXO 1XFUO 1KFUL 2A4JA 2KI6C 4DRWA 1LINA 1YURA 1P28A 3O6BA 5J3XA 2LVJA 3EKJA 4PE1A 4ZCUA 1TUJA 4PCWA 1QV1A 2QEHA 1DTLA 3DVMA 3AKAA 2M8UA 3O2PA 3L47A 4HRHA 4XJKB 1SCMB 3BFHA 3MSEB 1W9ZA 1QATA 2KOTA 1JFKA 5AFPA 5JJGA 1CB1A 1B9AA 1IKUA 5F6TA 1JF2A 1YR5A 2ZNDA 1F54A 1ORGA 1OZOA 2Y1NA 2EC6C 1QASA 2H61A 2ZKMX 3EKHA 5PALA 1K94A 1B8RA 1JC2A 1CLMA 2K7OA 1DJZA 1B8CA 4E68A 2AMIA 1B1GA 1YUTA 4MZLA 1SR6B 1SCMC 1LA3A 2HETA 1YVHA 3D75A 1AJ4A 2JTZA 1OOGA 4JD9A 1PK0D 3FE6A 3PN7B 1BR1B 2VRGA 1SY9A 1QXPA 1KK8B 5AERA 1AVSA 2JWWA 2HQWA 3AAKA 1K9UA 1CFCA 1MR8A 2WCFA 4MZKA 1SR6C 2KI4C 3JTDC 3OX6A 4N1GA 3B86A 1BU3A 4QJ5B 1DGVA 3FS7A 3I5FC 4C0KA 5I8NA 1LXFC 1DELA 4BY4A 4GFTA 2EHBA 1VRKA 3E3RA 3SG4A 1CMFA 3S0AA 1C07A 3GK2A 1YX7A 1IRJA 3OBVA 1KK8C 1MXLC 2GV5A 1YX8A 2V53A 1M45A 1K2HA 1S5GY 3TDIA 1PSRA 4IJ7A 1DF0B 1YVLA 2WCJA 1K9PA 2JU0A 4NQGA 3VRQA 1CTRA 1QLSA 3DXLA 3EK8A 1NCYA 3EVVA 1BOCA 2M29A 1C3ZA 3OGNA 2KAYA 3QMEA 1QVIY 2WOSA 3VRNA 2K7BA 3DYEA 3EVRA 4ORBB 4N5XA 3TZ1A 2H8VA 1G8IA 1EH2A 1DJXA 1AJ5A 1XFZO 1UUSA 5HKZA 1BJFA 1TCFA 2ZN9A 1C3YA 1R2UA 2P71A 1MQ1A 1XK4C 2F3ZA 2JOJA 1BODA 2M0RA 3L4AA 2Y5IA 2JT3A 3AAJA 3I5HC 4YGEB 1OOIX 3S0BA 1IQ3A 2LLTA 3HX4A 1CLBA 1B8LA 2ZN8A 1DGUA 5B8IB 1PSBA 1A75B 1N0YA 4PT1A 1CFPA 1K93D 1H8BA 2YGUA 3D76A 1S5GZ 2SCPA 1S26D 4L9MA 1CFDA 1QX7A 1PRWA 2K61A 2PMYA 1OMDA 2Y1MA 3PM2A 2L98A 3PJIA 1RECA 2LVVA 3C1VA 3LK1A 1J7RA 1WY9A 3K1EA 3R1VA 4PDZA 1NYAA 1SNLA 2L51A 1TCOB 3ZNIA 4P2YB 3WHUB 2KBMA 2KAXA 2NZ0A 2G9BA 1WRLA 2HQ8A 2CXJA 1XA5A 2BCXA 1QVIZ 1CLLA 4I5NB 2E6WA 2WCMA 3FWCA 3DY9A 3S0DA 1QTXA 1KFXS 2PVBA 5AXIA 3CR5X 4MRYA 4YI9A 4CLNA 1JFJA 3D0YB 4CFRA 1CM1A 1LKJA 2K8MB 5HL1A 2KGRA 1R6PA 2BECA 2JRFA 3SG2A 4P5OE 1G4YR 2JPOA 3A4UB 3PSRA 1KFXL 1KQMC 2DOQA 3H4SE 1YUSA 2BE6A 2JQ6A 1G33A 2BBNA 2F2OA 2LE9B 2TN4A 3CR2A 4QJ3B 3EK4A 1J55A 4PE7A 1IJ6A 1QWVA 2KAVA 1FPWA 1KWOB 1K95A 2JNXA 3SS3A 2M3WA 2PSRA 1QJTA 4MVFA 4AQIA 1F55A 1KCYA 3TDUA 1IGVA 1K8UA 1SPYA 2BCAA 2EC6B 2F33A 3SG7A 2KYCA 1B47A 1EG3A 3VROA 2JT0A 1QX2A 1BMOA 2L4HA 3IVTA 1UWOA 4HSZA 1JUOA 2NLNA 1SW8A 1QX5B 2OPOA 2LM5A 1KWOC 4NDBA 4WRIA 3CTNA 1SMGA 4CIDA 2CBLA 2L5YA 1KK7Z 2KPHA 1NPQA 3TDZA 1GJYA 1RK9A 3NSOA 4DS7A 1M46A 5CSNA 1OOFA 5AEQA 3CS1A 3KPXA 2WCBA 1PVAA 1TTXA 4JQ0D 1OZSA 3FWBA 4HREE 1YTZC 3B87A 4YGCB 1FBVA 2KI4B 3JTDB 3BOWA 1SYMA 2MJWB 3I5IC 1U5IA 3I5FB 4I5LB 2AUCA 4GGFA 3DF0B 1M39A 3R1PA 1LA0A 3BFAA 2BE4A 3OP0A 2OS8B 1SL8A 4QJ4B 1S36A 1N65A 1SKTA 3DZTA 3NSLA 2M49B 1HQVA 1J1DA 3GK1A 1SL7A 2WC6A 5HLVA 2AAOA 2PRUA 3LL8B 2K7DA 1DC1A 1KQVA 3PM8A 2CNPA 4ICBA 1K96A 1MXEA 1CNPA 2R2IA 1DVIA 3RM1A 3OHMB 2LHIA 2LMVA 2OS8C 2QEBA 5D3OA 2L50A 2LNKA 3S0EA 4DUQA 1DQEA 2OTGC 3B7AA 2KFGA 1S6IA 2NXQA 2PALA 4FQTA 5FI2A 2KLEA 1WLZA 2LVIA 1QIWA 3D73A 1SBJA 1GQMA 4ORCB 2MA2A 3LCPC 3SS4A 1CMGA 4YGBB 2ZNEA 1NP8A 1NUBA 1TRFA 5ER5A 1M31A 2FJUB 3K21A 5AANA 1WRKA 1XFRA 1OSAA 4YGDB 2CT9A 3IQOA 4JWQA 3I5HB 3IQQA 1N2DA 2F2PA 1NX3A 4OCIA 4PHKA 2L2EA 2L5XB 4YI8A 1C7WA 1SK6D 4N1FA 5I2QA 4GPLB 2JXCA 2KFHA 3O4XA 2CTNA 3VB1A 3GK4X 5DKRA 1UHKA 5FYXA 4HRGA 3SIBA 2LUXA
chains in the Genus database with same CATH topology
3SG3A 4MN0A 1XO5A 1EL4A 1NCXA 1J7PA 4GNKB 3DVEA 1F4OA 2K2FA 3I5GB 5HLOA 3WHTB 3HCMA 1BG1A 1ALVA 3CWGA 5KU1A 2LC5A 1CDLA 3A8RA 5HYDA 4PALA 3O4YA 1X02A 2GGZA 1SL9A 2H2KA 2H61C 2KQ6A 1W7JB 1JF0A 1CDNA 1KSMA 1XFYO 5CSIA 4XJKA 3BUNB 1KQMB 1TOPA 3I5GC 3O78A 3KHEA 4A4BA 5I2OA 4M2PA 3QRXA 1CFFA 4FTGA 1JWDA 1A03A 1KK7Y 2Q91A 4PE0A 1NX1A 3CLNA 4ORAB 3BUWB 2JZIA 1AHRA 2LMTA 2JC2A 4MZJA 3TS5B 1F8HA 1WLMA 3DVJA 1CDPA 3JVTB 1Y1UA 4USLA 3F45A 1V1FA 2LANA 5HKWA 1TN4A 1XFVO 3D10A 2QACA 1TNQA 1PVBA 1UHHA 3BUOB 4PHMA 1Q80A 3ZWHA 4MSPA 2BKIB 3M0WA 1AUIB 1XFWO 2F3YA 5GQQC 1IG5A 2M1UA 1LVCD 1ZFSA 3TS5C 1S1EA 1YRUB 2K7CA 5JOLA 3JVTC 4DIRA 2LUCA 2LP3A 4M2OA 1B7TY 2BBMA 1OMVA 5DKQA 1WDCB 2KYFA 1A29A 1CDMA 2MAZA 4C0LA 1BR4B 3I5IB 1IQ5A 2WCEA 4WQ3A 1F71A 1NX0A 2ZRTA 2L0PA 1S6JA 1EXRA 1DJIA 4NDCA 4ZCVA 2WNDA 1UURA 2HF5A 1CKKA 1UHIA 1DJHA 1DF0A 2LVKA 5CSJA 1XK4A 2M7NA 1WDCC 4ETOA 1OMRA 1TIZA 2LV7A 4MLWA 4MEWA 2FCEA 1ZOTB 1DJYA 2JTTA 2L4IA 3EK7A 3SIAA 3TUYC 2JXLA 1QLKA 5CPVA 3SG6A 1C7VA 3WNXB 1DJWA 2KBIA 4I5KA 2KHNA 2MLEC 2LMUA 2BL0C 3NXAA 3PLFB 5D69A 2OTGB 2Y4QA 3CR4X 1RFJA 1TNXA 4OV2A 4PE4A 1DT7B 1K9KA 1ZMZA 1E8AA 2BCBA 2D8NA 4I5JA 1B7TZ 2LCPA 2I2RE 1B4CA 3FIAA 1JSAA 4GGNA 2MLFC 1RROA 4OVNF 5K89A 2KDHA 3NSIA 1SRAA 1F4QA 1GGZA 5I2LA 3IF7A 1A75A 2E30A 2FOTA 1CM4A 2QPTA 3SG5A 4MBEA 3BXKA 2COLB 2Q4UA 1MHOA 2LAPA 1FI6A 2GGMA 3KEVA 1BF5A 1A2XA 1L2OB 4IL1A 4C0JA 1XVJA 4MRXA 3NSKA 1H4BA 1NCZA 3DVKA 1JBAA 1L7ZA 1UHNA 2I94A 1PULA 3PN7C 2EGDA 3AKBA 1OQPA 1V1GA 2SASA 2MBXA 1Y1AA 3D0YA 3PATA 1BLQA 4OKHA 2ZRSA 1K90D 1L2OC 1UP5A 1NIWA 2KSPA 3OB1B 1J7OA 2MHHA 4JPZB 1NWDA 2LLUA 5G08A 4AQJA 1ODBA 4BY5A 4XYNA 3KF9A 4D1EA 1WRZA 2KFFA 2K2AA 4AOMA 3BOWB 5DKNA 2O5GA 4CPVA 1FF1A 1RWYA 1NX2A 1U5IB 4YGAA 1QS7A 1NSHA 1M63B 1OOJA 1IWQA 1BT6A 1SCVA 4TNCA 1AP4A 2NCOA 2F8PA 1J7QA 3KO0A 3OB2B 1ALWA 3DD4A 1Y0VH 4GAOA 4R1EA 1EJ3A 2KI6D 3VRPA 3BYAA 2ISDA 3CZTX 5D7FA 1GGWA 2B1UA 3PALA 4M2QA 2KQYA 1QV0A 4F0ZB 1F70A 1DJGA 1PALA 1W7IB 4NDDA 5BPJA 4DCKA 1YUUA 2I7AA 4GGFC 3VRRA 5KTYA 1D1OA 1IJ5A 2HPSA 1S6CA 2O60A 2LHLA 3ICBA 2M9GA 4PHJA 5ER4X 1Y6WA 1Y1XA 1RJVA 3BQ3A 3GOFA 5KSZA 3LK0A 1OE9B 1ZACA 2JT8A 4GUKA 1RTP1 3BUMB 5CSFA 1S3PA 3WXAA 4YRUA 1IH0A 2WC8A 3PFVA 4UPGA 2M1KB 5IBWA 1FW4A 3EVUA 2I18A 3OX5A 1DMOA 1MWNA 1TNWA 1KSOA 2IS9A 1UHJA 3DF0A 1QIVA 1TNPA 1MF8B 2KGBC 2M7LA 2KNEA 4OR9B 4Q04A 4WQ2A 2PASA 4YBHB 2JPTA 2FCDA 2G2BA 1MUXA 2RGIA 1A4PA 4FQOA 4PHNA 1YRTB 4U8DA 2LLSA 5TNCA 1EG4A 2LP2A 3CGAA 2ZFDA 1HT9A 3LLEA 1FI5A 5HKYA 3SJSA 2M97A 2CCMA 2JNFA 1KFUS 4GBAA 2WORA 2BKHB 2K0JA 3TUYB 4CFQA 2JULA 3BUXB 3RLZA 3VGOA 1ZUZA 2P6BB 2MRDA 1AK8A 2BL0B 1J1EA 1XYDA 2NCPA 4A4CA 1XFXO 1XFUO 1KFUL 2A4JA 2KI6C 4DRWA 1LINA 1YURA 3O6BA 5J3XA 2LVJA 3EKJA 4PE1A 4ZCUA 4PCWA 1QV1A 1DTLA 3DVMA 3AKAA 2M8UA 3O2PA 4HRHA 4XJKB 1SCMB 3MSEB 5AFPA 1QATA 2KOTA 1JFKA 5JJGA 1CB1A 1B9AA 1IKUA 5F6TA 1JF2A 1YR5A 2ZNDA 1F54A 1OZOA 2Y1NA 2EC6C 1QASA 2H61A 2ZKMX 3EKHA 5PALA 1K94A 1B8RA 1JC2A 1CLMA 2K7OA 1DJZA 1B8CA 4E68A 2AMIA 1B1GA 1YUTA 4MZLA 1SR6B 1SCMC 1LA3A 2HETA 1YVHA 1AJ4A 2JTZA 1PK0D 3PN7B 1BR1B 2VRGA 1SY9A 1QXPA 1KK8B 5AERA 1AVSA 2JWWA 2HQWA 3AAKA 1K9UA 1CFCA 1MR8A 2WCFA 4MZKA 1SR6C 2KI4C 3JTDC 3OX6A 4N1GA 1BU3A 4QJ5B 1DGVA 3FS7A 3I5FC 4C0KA 5I8NA 1LXFC 4BY4A 4GFTA 2EHBA 1VRKA 3E3RA 3SG4A 1CMFA 1C07A 3GK2A 1YX7A 1IRJA 1KK8C 1MXLC 2GV5A 1YX8A 2V53A 1M45A 1K2HA 1S5GY 3TDIA 1PSRA 1DF0B 1YVLA 1K9PA 2JU0A 4NQGA 3VRQA 1CTRA 1QLSA 3EK8A 1NCYA 3EVVA 1BOCA 2M29A 2KAYA 1QVIY 2WOSA 3VRNA 2K7BA 3EVRA 4ORBB 4N5XA 3TZ1A 1G8IA 1EH2A 1DJXA 1AJ5A 1XFZO 1UUSA 5HKZA 1BJFA 1TCFA 2ZN9A 1R2UA 1MQ1A 1XK4C 2F3ZA 2JOJA 1BODA 2M0RA 2Y5IA 2JT3A 3AAJA 3I5HC 4YGEB 1IQ3A 2LLTA 3HX4A 1CLBA 1B8LA 2ZN8A 1DGUA 5B8IB 1PSBA 1A75B 1N0YA 1CFPA 1H8BA 1K93D 1S5GZ 2SCPA 1S26D 4L9MA 1CFDA 1QX7A 1PRWA 2K61A 2PMYA 1OMDA 2Y1MA 2L98A 1RECA 2LVVA 3C1VA 3LK1A 1J7RA 1WY9A 4PDZA 1NYAA 1SNLA 2L51A 1TCOB 3ZNIA 4P2YB 3WHUB 2KBMA 2KAXA 2NZ0A 2G9BA 1WRLA 2HQ8A 2CXJA 1XA5A 2BCXA 1QVIZ 1CLLA 4I5NB 2E6WA 3FWCA 1QTXA 1KFXS 2PVBA 5AXIA 3CR5X 4MRYA 4YI9A 4CLNA 1JFJA 3D0YB 4CFRA 1CM1A 1LKJA 2K8MB 2KGRA 1R6PA 2BECA 2JRFA 3SG2A 4P5OE 1G4YR 3A4UB 3PSRA 1KFXL 1KQMC 2DOQA 3H4SE 1YUSA 2BE6A 2JQ6A 1G33A 2BBNA 2F2OA 2LE9B 2TN4A 3CR2A 4QJ3B 3EK4A 1J55A 4PE7A 1IJ6A 2KAVA 1FPWA 1KWOB 1K95A 2JNXA 2M3WA 2PSRA 1QJTA 4MVFA 4AQIA 1F55A 1KCYA 3TDUA 1IGVA 1K8UA 1SPYA 2BCAA 2EC6B 2F33A 3SG7A 2KYCA 1B47A 1EG3A 3VROA 2JT0A 1QX2A 1BMOA 2L4HA 1UWOA 4HSZA 1JUOA 2NLNA 1SW8A 1QX5B 2OPOA 2LM5A 1KWOC 4NDBA 4WRIA 3CTNA 1SMGA 4CIDA 2CBLA 1KK7Z 1NPQA 3TDZA 1GJYA 1RK9A 3NSOA 4DS7A 1M46A 5CSNA 5AEQA 3CS1A 3KPXA 2WCBA 1PVAA 1TTXA 4JQ0D 1OZSA 3FWBA 4HREE 1YTZC 4YGCB 1FBVA 2KI4B 3JTDB 3BOWA 1SYMA 2MJWB 3I5IC 1U5IA 3I5FB 4I5LB 2AUCA 4GGFA 3DF0B 1M39A 1LA0A 2BE4A 3OP0A 2OS8B 1SL8A 4QJ4B 1S36A 1N65A 1SKTA 3NSLA 2M49B 1HQVA 1J1DA 3GK1A 1SL7A 5HLVA 2AAOA 2PRUA 3LL8B 2K7DA 1KQVA 3PM8A 2CNPA 4ICBA 1K96A 1MXEA 1CNPA 2R2IA 1DVIA 3RM1A 3OHMB 2LHIA 2LMVA 2OS8C 2L50A 2LNKA 4DUQA 2OTGC 2KFGA 1S6IA 2NXQA 2PALA 1WLZA 2LVIA 1QIWA 1SBJA 1GQMA 4ORCB 2MA2A 3LCPC 1CMGA 4YGBB 2ZNEA 1NP8A 1NUBA 1TRFA 5ER5A 1M31A 2FJUB 3K21A 5AANA 1WRKA 1OSAA 4YGDB 2CT9A 3IQOA 4JWQA 3I5HB 3IQQA 1N2DA 2F2PA 1NX3A 4OCIA 4PHKA 2L2EA 2L5XB 4YI8A 1C7WA 1SK6D 4N1FA 5I2QA 4GPLB 2JXCA 2KFHA 2CTNA 3GK4X 5DKRA 1UHKA 5FYXA 4HRGA 3SIBA 2LUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SG3 A;  4MN0 A;  1XO5 A;  1EL4 A;  1NCX A;  1J7P A;  4GNK B;  3DVE A;  1F4O A;  2K2F A;  3I5G B;  5HLO A;  3WHT B;  3HCM A;  1BG1 A;  1ALV A;  3CWG A;  5KU1 A;  2LC5 A;  1CDL A;  3A8R A;  5HYD A;  4PAL A;  3O4Y A;  1X02 A;  2GGZ A;  1SL9 A;  2H2K A;  2H61 C;  2KQ6 A;  1W7J B;  1JF0 A;  1CDN A;  1KSM A;  1XFY O;  5CSI A;  4XJK A;  3BUN B;  1KQM B;  1TOP A;  3I5G C;  3O78 A;  3KHE A;  4A4B A;  5I2O A;  4M2P A;  3QRX A;  1CFF A;  4FTG A;  1JWD A;  1A03 A;  1KK7 Y;  2Q91 A;  4PE0 A;  1NX1 A;  3CLN A;  4ORA B;  3BUW B;  2JZI A;  1AHR A;  2LMT A;  2JC2 A;  4MZJ A;  3TS5 B;  1F8H A;  1WLM A;  3DVJ A;  1CDP A;  3JVT B;  1Y1U A;  4USL A;  3F45 A;  1V1F A;  2LAN A;  5HKW A;  1TN4 A;  1XFV O;  3D10 A;  2QAC A;  1TNQ A;  1PVB A;  1UHH A;  3BUO B;  4PHM A;  1Q80 A;  3ZWH A;  4MSP A;  2BKI B;  3M0W A;  1AUI B;  1XFW O;  2F3Y A;  5GQQ C;  1IG5 A;  2M1U A;  1LVC D;  1ZFS A;  3TS5 C;  1S1E A;  1YRU B;  2K7C A;  5JOL A;  3JVT C;  4DIR A;  2LUC A;  2LP3 A;  4M2O A;  1B7T Y;  2BBM A;  1OMV A;  5DKQ A;  1WDC B;  2KYF A;  1A29 A;  1CDM A;  2MAZ A;  4C0L A;  1BR4 B;  3I5I B;  1IQ5 A;  2WCE A;  4WQ3 A;  1F71 A;  1NX0 A;  2ZRT A;  2L0P A;  1S6J A;  1EXR A;  1DJI A;  4NDC A;  4ZCV A;  2WND A;  1UUR A;  2HF5 A;  1CKK A;  1UHI A;  1DJH A;  1DF0 A;  2LVK A;  5CSJ A;  1XK4 A;  2M7N A;  1WDC C;  4ETO A;  1OMR A;  1TIZ A;  2LV7 A;  4MLW A;  4MEW A;  2FCE A;  1ZOT B;  1DJY A;  2JTT A;  2L4I A;  3EK7 A;  3SIA A;  3TUY C;  2JXL A;  1QLK A;  5CPV A;  3SG6 A;  1C7V A;  3WNX B;  1DJW A;  2KBI A;  4I5K A;  2KHN A;  2MLE C;  2LMU A;  2BL0 C;  3NXA A;  3PLF B;  5D69 A;  2OTG B;  2Y4Q A;  3CR4 X;  1RFJ A;  1TNX A;  4OV2 A;  4PE4 A;  1DT7 B;  1K9K A;  1ZMZ A;  1E8A A;  2BCB A;  2D8N A;  4I5J A;  1B7T Z;  2LCP A;  2I2R E;  1B4C A;  3FIA A;  1JSA A;  4GGN A;  2MLF C;  1RRO A;  4OVN F;  5K89 A;  2KDH A;  3NSI A;  1SRA A;  1F4Q A;  1GGZ A;  5I2L A;  3IF7 A;  1A75 A;  2E30 A;  2FOT A;  1CM4 A;  2QPT A;  3SG5 A;  4MBE A;  3BXK A;  2COL B;  2Q4U A;  1MHO A;  2LAP A;  1FI6 A;  2GGM A;  3KEV A;  1BF5 A;  1A2X A;  1L2O B;  4IL1 A;  4C0J A;  1XVJ A;  4MRX A;  3NSK A;  1H4B A;  1NCZ A;  3DVK A;  1JBA A;  1L7Z A;  1UHN A;  2I94 A;  1PUL A;  3PN7 C;  2EGD A;  3AKB A;  1OQP A;  1V1G A;  2SAS A;  2MBX A;  1Y1A A;  3D0Y A;  3PAT A;  1BLQ A;  4OKH A;  2ZRS A;  1K90 D;  1L2O C;  1UP5 A;  1NIW A;  2KSP A;  3OB1 B;  1J7O A;  2MHH A;  4JPZ B;  1NWD A;  2LLU A;  5G08 A;  4AQJ A;  1ODB A;  4BY5 A;  4XYN A;  3KF9 A;  4D1E A;  1WRZ A;  2KFF A;  2K2A A;  4AOM A;  3BOW B;  5DKN A;  2O5G A;  4CPV A;  1FF1 A;  1RWY A;  1NX2 A;  1U5I B;  4YGA A;  1QS7 A;  1NSH A;  1M63 B;  1OOJ A;  1IWQ A;  1BT6 A;  1SCV A;  4TNC A;  1AP4 A;  2NCO A;  2F8P A;  1J7Q A;  3KO0 A;  3OB2 B;  1ALW A;  3DD4 A;  1Y0V H;  4GAO A;  4R1E A;  1EJ3 A;  2KI6 D;  3VRP A;  3BYA A;  2ISD A;  3CZT X;  5D7F A;  1GGW A;  2B1U A;  3PAL A;  4M2Q A;  2KQY A;  1QV0 A;  4F0Z B;  1F70 A;  1DJG A;  1PAL A;  1W7I B;  4NDD A;  5BPJ A;  4DCK A;  1YUU A;  2I7A A;  4GGF C;  3VRR A;  5KTY A;  1D1O A;  1IJ5 A;  2HPS A;  1S6C A;  2O60 A;  2LHL A;  3ICB A;  2M9G A;  4PHJ A;  5ER4 X;  1Y6W A;  1Y1X A;  1RJV A;  3BQ3 A;  3GOF A;  5KSZ A;  3LK0 A;  1OE9 B;  1ZAC A;  2JT8 A;  4GUK A;  1RTP 1;  3BUM B;  5CSF A;  1S3P A;  3WXA A;  4YRU A;  1IH0 A;  2WC8 A;  3PFV A;  4UPG A;  2M1K B;  5IBW A;  1FW4 A;  3EVU A;  2I18 A;  3OX5 A;  1DMO A;  1MWN A;  1TNW A;  1KSO A;  2IS9 A;  1UHJ A;  3DF0 A;  1QIV A;  1TNP A;  1MF8 B;  2KGB C;  2M7L A;  2KNE A;  4OR9 B;  4Q04 A;  4WQ2 A;  2PAS A;  4YBH B;  2JPT A;  2FCD A;  2G2B A;  1MUX A;  2RGI A;  1A4P A;  4FQO A;  4PHN A;  1YRT B;  4U8D A;  2LLS A;  5TNC A;  1EG4 A;  2LP2 A;  3CGA A;  2ZFD A;  1HT9 A;  3LLE A;  1FI5 A;  5HKY A;  3SJS A;  2M97 A;  2CCM A;  2JNF A;  1KFU S;  4GBA A;  2WOR A;  2BKH B;  2K0J A;  3TUY B;  4CFQ A;  2JUL A;  3BUX B;  3RLZ A;  3VGO A;  1ZUZ A;  2P6B B;  2MRD A;  1AK8 A;  2BL0 B;  1J1E A;  1XYD A;  2NCP A;  4A4C A;  1XFX O;  1XFU O;  1KFU L;  2A4J A;  2KI6 C;  4DRW A;  1LIN A;  1YUR A;  3O6B A;  5J3X A;  2LVJ A;  3EKJ A;  4PE1 A;  4ZCU A;  4PCW A;  1QV1 A;  1DTL A;  3DVM A;  3AKA A;  2M8U A;  3O2P A;  4HRH A;  4XJK B;  1SCM B;  3MSE B;  5AFP A;  1QAT A;  2KOT A;  1JFK A;  5JJG A;  1CB1 A;  1B9A A;  1IKU A;  5F6T A;  1JF2 A;  1YR5 A;  2ZND A;  1F54 A;  1OZO A;  2Y1N A;  2EC6 C;  1QAS A;  2H61 A;  2ZKM X;  3EKH A;  5PAL A;  1K94 A;  1B8R A;  1JC2 A;  1CLM A;  2K7O A;  1DJZ A;  1B8C A;  4E68 A;  2AMI A;  1B1G A;  1YUT A;  4MZL A;  1SR6 B;  1SCM C;  1LA3 A;  2HET A;  1YVH A;  1AJ4 A;  2JTZ A;  1PK0 D;  3PN7 B;  1BR1 B;  2VRG A;  1SY9 A;  1QXP A;  1KK8 B;  5AER A;  1AVS A;  2JWW A;  2HQW A;  3AAK A;  1K9U A;  1CFC A;  1MR8 A;  2WCF A;  4MZK A;  1SR6 C;  2KI4 C;  3JTD C;  3OX6 A;  4N1G A;  1BU3 A;  4QJ5 B;  1DGV A;  3FS7 A;  3I5F C;  4C0K A;  5I8N A;  1LXF C;  4BY4 A;  4GFT A;  2EHB A;  1VRK A;  3E3R A;  3SG4 A;  1CMF A;  1C07 A;  3GK2 A;  1YX7 A;  1IRJ A;  1KK8 C;  1MXL C;  2GV5 A;  1YX8 A;  2V53 A;  1M45 A;  1K2H A;  1S5G Y;  3TDI A;  1PSR A;  1DF0 B;  1YVL A;  1K9P A;  2JU0 A;  4NQG A;  3VRQ A;  1CTR A;  1QLS A;  3EK8 A;  1NCY A;  3EVV A;  1BOC A;  2M29 A;  2KAY A;  1QVI Y;  2WOS A;  3VRN A;  2K7B A;  3EVR A;  4ORB B;  4N5X A;  3TZ1 A;  1G8I A;  1EH2 A;  1DJX A;  1AJ5 A;  1XFZ O;  1UUS A;  5HKZ A;  1BJF A;  1TCF A;  2ZN9 A;  1R2U A;  1MQ1 A;  1XK4 C;  2F3Z A;  2JOJ A;  1BOD A;  2M0R A;  2Y5I A;  2JT3 A;  3AAJ A;  3I5H C;  4YGE B;  1IQ3 A;  2LLT A;  3HX4 A;  1CLB A;  1B8L A;  2ZN8 A;  1DGU A;  5B8I B;  1PSB A;  1A75 B;  1N0Y A;  1CFP A;  1H8B A;  1K93 D;  1S5G Z;  2SCP A;  1S26 D;  4L9M A;  1CFD A;  1QX7 A;  1PRW A;  2K61 A;  2PMY A;  1OMD A;  2Y1M A;  2L98 A;  1REC A;  2LVV A;  3C1V A;  3LK1 A;  1J7R A;  1WY9 A;  4PDZ A;  1NYA A;  1SNL A;  2L51 A;  1TCO B;  3ZNI A;  4P2Y B;  3WHU B;  2KBM A;  2KAX A;  2NZ0 A;  2G9B A;  1WRL A;  2HQ8 A;  2CXJ A;  1XA5 A;  2BCX A;  1QVI Z;  1CLL A;  4I5N B;  2E6W A;  3FWC A;  1QTX A;  1KFX S;  2PVB A;  5AXI A;  3CR5 X;  4MRY A;  4YI9 A;  4CLN A;  1JFJ A;  3D0Y B;  4CFR A;  1CM1 A;  1LKJ A;  2K8M B;  2KGR A;  1R6P A;  2BEC A;  2JRF A;  3SG2 A;  4P5O E;  1G4Y R;  3A4U B;  3PSR A;  1KFX L;  1KQM C;  2DOQ A;  3H4S E;  1YUS A;  2BE6 A;  2JQ6 A;  1G33 A;  2BBN A;  2F2O A;  2LE9 B;  2TN4 A;  3CR2 A;  4QJ3 B;  3EK4 A;  1J55 A;  4PE7 A;  1IJ6 A;  2KAV A;  1FPW A;  1KWO B;  1K95 A;  2JNX A;  2M3W A;  2PSR A;  1QJT A;  4MVF A;  4AQI A;  1F55 A;  1KCY A;  3TDU A;  1IGV A;  1K8U A;  1SPY A;  2BCA A;  2EC6 B;  2F33 A;  3SG7 A;  2KYC A;  1B47 A;  1EG3 A;  3VRO A;  2JT0 A;  1QX2 A;  1BMO A;  2L4H A;  1UWO A;  4HSZ A;  1JUO A;  2NLN A;  1SW8 A;  1QX5 B;  2OPO A;  2LM5 A;  1KWO C;  4NDB A;  4WRI A;  3CTN A;  1SMG A;  4CID A;  2CBL A;  1KK7 Z;  1NPQ A;  3TDZ A;  1GJY A;  1RK9 A;  3NSO A;  4DS7 A;  1M46 A;  5CSN A;  5AEQ A;  3CS1 A;  3KPX A;  2WCB A;  1PVA A;  1TTX A;  4JQ0 D;  1OZS A;  3FWB A;  4HRE E;  1YTZ C;  4YGC B;  1FBV A;  2KI4 B;  3JTD B;  3BOW A;  1SYM A;  2MJW B;  3I5I C;  1U5I A;  3I5F B;  4I5L B;  2AUC A;  4GGF A;  3DF0 B;  1M39 A;  1LA0 A;  2BE4 A;  3OP0 A;  2OS8 B;  1SL8 A;  4QJ4 B;  1S36 A;  1N65 A;  1SKT A;  3NSL A;  2M49 B;  1HQV A;  1J1D A;  3GK1 A;  1SL7 A;  5HLV A;  2AAO A;  2PRU A;  3LL8 B;  2K7D A;  1KQV A;  3PM8 A;  2CNP A;  4ICB A;  1K96 A;  1MXE A;  1CNP A;  2R2I A;  1DVI A;  3RM1 A;  3OHM B;  2LHI A;  2LMV A;  2OS8 C;  2L50 A;  2LNK A;  4DUQ A;  2OTG C;  2KFG A;  1S6I A;  2NXQ A;  2PAL A;  1WLZ A;  2LVI A;  1QIW A;  1SBJ A;  1GQM A;  4ORC B;  2MA2 A;  3LCP C;  1CMG A;  4YGB B;  2ZNE A;  1NP8 A;  1NUB A;  1TRF A;  5ER5 A;  1M31 A;  2FJU B;  3K21 A;  5AAN A;  1WRK A;  1OSA A;  4YGD B;  2CT9 A;  3IQO A;  4JWQ A;  3I5H B;  3IQQ A;  1N2D A;  2F2P A;  1NX3 A;  4OCI A;  4PHK A;  2L2E A;  2L5X B;  4YI8 A;  1C7W A;  1SK6 D;  4N1F A;  5I2Q A;  4GPL B;  2JXC A;  2KFH A;  2CTN A;  3GK4 X;  5DKR A;  1UHK A;  5FYX A;  4HRG A;  3SIB A;  2LUX A; 
#chains in the Genus database with same CATH topology
 3SG3 A;  4MN0 A;  1XO5 A;  1EL4 A;  5FI6 A;  1NCX A;  1J7P A;  4GNK B;  3DVE A;  1F4O A;  2K2F A;  3I5G B;  5HLO A;  3WHT B;  3HCM A;  3V2L A;  3UNW A;  1BG1 A;  3R72 A;  1ALV A;  3CWG A;  5DIC A;  5KU1 A;  2LC5 A;  1CDL A;  3A8R A;  5HYD A;  4PAL A;  3O4Y A;  1X02 A;  1DEK A;  2GGZ A;  1SL9 A;  2H2K A;  2H61 C;  2KQ6 A;  1W7J B;  1JF0 A;  3FE8 A;  1CDN A;  1KSM A;  1XFY O;  3D74 A;  5CSI A;  3CYZ A;  4XJK A;  3BUN B;  1KQM B;  1TOP A;  3I5G C;  2L2C A;  3O78 A;  3KHE A;  4A4B A;  5I2O A;  4M2P A;  2GTE A;  3QRX A;  1CFF A;  4FTG A;  1JWD A;  3NHI A;  3S0F A;  1A03 A;  1Z2C B;  1KK7 Y;  2Q91 A;  4PE0 A;  1NX1 A;  3CLN A;  4ORA B;  3BUW B;  2JZI A;  1AHR A;  2LMT A;  2JC2 A;  4MZJ A;  3TS5 B;  1SSE B;  1WLM A;  3DVJ A;  1CDP A;  3JVT B;  1F8H A;  1Y1U A;  4USL A;  3BFB A;  1TUZ A;  2PYQ A;  3F45 A;  1V1F A;  3SS5 A;  2LAN A;  5HKW A;  1TN4 A;  1XFV O;  3D10 A;  2QAC A;  1TNQ A;  1PVB A;  1UHH A;  1IIO A;  3NHT A;  3BUO B;  4PHM A;  1Q80 A;  3ZWH A;  4MSP A;  2BKI B;  2WCL A;  3M0W A;  1AUI B;  1XFW O;  2F3Y A;  5GQQ C;  1IG5 A;  2M1U A;  1LVC D;  1ZFS A;  3TS5 C;  1S1E A;  1YRU B;  2K7C A;  5JOL A;  3JVT C;  4DIR A;  2LUC A;  3BJH A;  2LP3 A;  4M2O A;  1B7T Y;  4OZD A;  2BBM A;  1OMV A;  5DKQ A;  3D77 A;  1WDC B;  3Q8I A;  2KYF A;  1A29 A;  1CDM A;  3EG5 B;  2MAZ A;  4C0L A;  3CZ1 A;  1BR4 B;  3I5I B;  1IQ5 A;  3CZ2 A;  2WCE A;  4WQ3 A;  1F71 A;  1NX0 A;  2ZRT A;  2L0P A;  1S6J A;  1EXR A;  1DJI A;  4NDC A;  4ZCV A;  2WND A;  1UUR A;  2HF5 A;  1CKK A;  1UHI A;  1DJH A;  1DF0 A;  2LVK A;  3CDN A;  5CSJ A;  1XK4 A;  2QDI A;  2M7N A;  1WDC C;  3FE9 A;  4JKT A;  4ETO A;  1OMR A;  1TIZ A;  2LV7 A;  4MLW A;  1TWO A;  4MEW A;  2FCE A;  1ZOT B;  1DJY A;  2JTT A;  2L4I A;  3EK7 A;  3SIA A;  3TUY C;  2JXL A;  3S0G A;  5FI7 A;  1QLK A;  5CPV A;  3SG6 A;  1C7V A;  3WNX B;  1DJW A;  2KBI A;  2KLD A;  4I5K A;  2KHN A;  2MLE C;  2LMU A;  2BL0 C;  3NXA A;  3PLF B;  5D69 A;  2PQL A;  2OTG B;  2Y4Q A;  1LS8 A;  3CR4 X;  3UO9 A;  1RFJ A;  1TNX A;  4OV2 A;  4PE4 A;  1DT7 B;  2ERB A;  1K9K A;  1ZMZ A;  1E8A A;  2BCB A;  2D8N A;  4I5J A;  1B7T Z;  2LCP A;  2I2R E;  4INX A;  4KYN A;  1B4C A;  3FIA A;  1JSA A;  4GGN A;  2MLF C;  1RRO A;  4OVN F;  2BNX A;  5K89 A;  3NGV A;  2KDH A;  3NSI A;  1SRA A;  1F4Q A;  1GGZ A;  5I2L A;  3IF7 A;  1A75 A;  2E30 A;  2FOT A;  1CM4 A;  2QPT A;  3SG5 A;  3CZ0 A;  4MBE A;  3BXK A;  2COL B;  2Q4U A;  1MHO A;  2LAP A;  1FI6 A;  2GGM A;  3KEV A;  1BF5 A;  1A2X A;  1L2O B;  4IL1 A;  4C0J A;  1XVJ A;  4MRX A;  3NSK A;  1H4B A;  1NCZ A;  3DVK A;  1JBA A;  1L7Z A;  1UHN A;  2I94 A;  1PUL A;  3PN7 C;  1GM0 A;  2EGD A;  3AKB A;  1OQP A;  1V1G A;  2SAS A;  3L4L A;  2P70 A;  2MBX A;  1Y1A A;  2WC5 A;  3D0Y A;  3PAT A;  1BLQ A;  2K60 A;  2ZRS A;  1K90 D;  4OKH A;  1L2O C;  2QEO A;  1UP5 A;  1NIW A;  2KSP A;  3OB1 B;  1J7O A;  2MHH A;  4JPZ B;  1NWD A;  2LLU A;  5G08 A;  4AQJ A;  1ODB A;  4BY5 A;  4XYN A;  3KF9 A;  4D1E A;  1WRZ A;  3B88 A;  2KFF A;  1Z4H A;  2K2A A;  4AOM A;  3BOW B;  5DKN A;  2O5G A;  4CPV A;  1FF1 A;  1RWY A;  1NX2 A;  1U5I B;  4YGA A;  1QS7 A;  1NSH A;  1M63 B;  1OOJ A;  1IWQ A;  1BT6 A;  1SCV A;  4TNC A;  1AP4 A;  2NCO A;  2F8P A;  1J7Q A;  3KO0 A;  3OB2 B;  1ALW A;  3DD4 A;  1Y0V H;  2FJY A;  4GAO A;  4R1E A;  1EJ3 A;  2KI6 D;  3VRP A;  3BYA A;  2ISD A;  3CZT X;  5D7F A;  1GGW A;  2B1U A;  3PAL A;  4M2Q A;  2KQY A;  1QV0 A;  4F0Z B;  1F70 A;  1DJG A;  1PAL A;  1W7I B;  4NDD A;  5BPJ A;  4DCK A;  1YUU A;  2I7A A;  4GGF C;  3VRR A;  5KTY A;  1D1O A;  1IJ5 A;  2HPS A;  1S6C A;  2O60 A;  2LHL A;  2BAP A;  3ICB A;  2M9G A;  4PHJ A;  5ER4 X;  1Y6W A;  1Y1X A;  1RJV A;  3BQ3 A;  3GOF A;  5KSZ A;  3LK0 A;  1OE9 B;  1ZAC A;  2JT8 A;  4GUK A;  1RTP 1;  3BUM B;  5CSF A;  1S3P A;  3WXA A;  4YRU A;  1IH0 A;  2QEV A;  2WC8 A;  3PFV A;  4UPG A;  2M1K B;  5IBW A;  1T14 A;  1FW4 A;  3EVU A;  3RZS A;  2I18 A;  3OX5 A;  1DMO A;  1MWN A;  1TNW A;  3D78 A;  1KSO A;  2IS9 A;  1UHJ A;  3DF0 A;  1QIV A;  3R1O A;  1TNP A;  1MF8 B;  2KGB C;  2M7L A;  2KNE A;  5EL2 A;  1OW4 A;  3CAB A;  4OR9 B;  4Q04 A;  4INW A;  4WQ2 A;  2PAS A;  4YBH B;  2JPT A;  2FCD A;  2G2B A;  1MUX A;  2RGI A;  1A4P A;  3N7H A;  4FQO A;  4PHN A;  1YRT B;  4U8D A;  2LLS A;  4F7F A;  5TNC A;  1EG4 A;  2LP2 A;  3CGA A;  2ZFD A;  1HT9 A;  3LLE A;  1FI5 A;  5HKY A;  3SJS A;  2M97 A;  2CCM A;  2JNF A;  1KFU S;  4GBA A;  3B6X A;  2WOR A;  2BKH B;  2K0J A;  3TUY B;  4CFQ A;  2JUL A;  5I94 A;  3BUX B;  3RLZ A;  3VGO A;  2WCH A;  1ZUZ A;  2P6B B;  1OOH A;  2MRD A;  1AK8 A;  2BL0 B;  1J1E A;  1XYD A;  2NCP A;  2WCK A;  4A4C A;  1XFX O;  1XFU O;  1KFU L;  2A4J A;  2KI6 C;  4DRW A;  1LIN A;  1YUR A;  1P28 A;  3O6B A;  5J3X A;  2LVJ A;  3EKJ A;  4PE1 A;  4ZCU A;  1TUJ A;  4PCW A;  1QV1 A;  2QEH A;  1DTL A;  3DVM A;  3AKA A;  2M8U A;  3O2P A;  3L47 A;  4HRH A;  4XJK B;  1SCM B;  3BFH A;  3MSE B;  1W9Z A;  1QAT A;  2KOT A;  1JFK A;  5AFP A;  5JJG A;  1CB1 A;  1B9A A;  1IKU A;  5F6T A;  1JF2 A;  1YR5 A;  2ZND A;  1F54 A;  1ORG A;  1OZO A;  2Y1N A;  2EC6 C;  1QAS A;  2H61 A;  2ZKM X;  3EKH A;  5PAL A;  1K94 A;  1B8R A;  1JC2 A;  1CLM A;  2K7O A;  1DJZ A;  1B8C A;  4E68 A;  2AMI A;  1B1G A;  1YUT A;  4MZL A;  1SR6 B;  1SCM C;  1LA3 A;  2HET A;  1YVH A;  3D75 A;  1AJ4 A;  2JTZ A;  1OOG A;  4JD9 A;  1PK0 D;  3FE6 A;  3PN7 B;  1BR1 B;  2VRG A;  1SY9 A;  1QXP A;  1KK8 B;  5AER A;  1AVS A;  2JWW A;  2HQW A;  3AAK A;  1K9U A;  1CFC A;  1MR8 A;  2WCF A;  4MZK A;  1SR6 C;  2KI4 C;  3JTD C;  3OX6 A;  4N1G A;  3B86 A;  1BU3 A;  4QJ5 B;  1DGV A;  3FS7 A;  3I5F C;  4C0K A;  5I8N A;  1LXF C;  1DEL A;  4BY4 A;  4GFT A;  2EHB A;  1VRK A;  3E3R A;  3SG4 A;  1CMF A;  3S0A A;  1C07 A;  3GK2 A;  1YX7 A;  1IRJ A;  3OBV A;  1KK8 C;  1MXL C;  2GV5 A;  1YX8 A;  2V53 A;  1M45 A;  1K2H A;  1S5G Y;  3TDI A;  1PSR A;  4IJ7 A;  1DF0 B;  1YVL A;  2WCJ A;  1K9P A;  2JU0 A;  4NQG A;  3VRQ A;  1CTR A;  1QLS A;  3DXL A;  3EK8 A;  1NCY A;  3EVV A;  1BOC A;  2M29 A;  1C3Z A;  3OGN A;  2KAY A;  3QME A;  1QVI Y;  2WOS A;  3VRN A;  2K7B A;  3DYE A;  3EVR A;  4ORB B;  4N5X A;  3TZ1 A;  2H8V A;  1G8I A;  1EH2 A;  1DJX A;  1AJ5 A;  1XFZ O;  1UUS A;  5HKZ A;  1BJF A;  1TCF A;  2ZN9 A;  1C3Y A;  1R2U A;  2P71 A;  1MQ1 A;  1XK4 C;  2F3Z A;  2JOJ A;  1BOD A;  2M0R A;  3L4A A;  2Y5I A;  2JT3 A;  3AAJ A;  3I5H C;  4YGE B;  1OOI X;  3S0B A;  1IQ3 A;  2LLT A;  3HX4 A;  1CLB A;  1B8L A;  2ZN8 A;  1DGU A;  5B8I B;  1PSB A;  1A75 B;  1N0Y A;  4PT1 A;  1CFP A;  1K93 D;  1H8B A;  2YGU A;  3D76 A;  1S5G Z;  2SCP A;  1S26 D;  4L9M A;  1CFD A;  1QX7 A;  1PRW A;  2K61 A;  2PMY A;  1OMD A;  2Y1M A;  3PM2 A;  2L98 A;  3PJI A;  1REC A;  2LVV A;  3C1V A;  3LK1 A;  1J7R A;  1WY9 A;  3K1E A;  3R1V A;  4PDZ A;  1NYA A;  1SNL A;  2L51 A;  1TCO B;  3ZNI A;  4P2Y B;  3WHU B;  2KBM A;  2KAX A;  2NZ0 A;  2G9B A;  1WRL A;  2HQ8 A;  2CXJ A;  1XA5 A;  2BCX A;  1QVI Z;  1CLL A;  4I5N B;  2E6W A;  2WCM A;  3FWC A;  3DY9 A;  3S0D A;  1QTX A;  1KFX S;  2PVB A;  5AXI A;  3CR5 X;  4MRY A;  4YI9 A;  4CLN A;  1JFJ A;  3D0Y B;  4CFR A;  1CM1 A;  1LKJ A;  2K8M B;  5HL1 A;  2KGR A;  1R6P A;  2BEC A;  2JRF A;  3SG2 A;  4P5O E;  1G4Y R;  2JPO A;  3A4U B;  3PSR A;  1KFX L;  1KQM C;  2DOQ A;  3H4S E;  1YUS A;  2BE6 A;  2JQ6 A;  1G33 A;  2BBN A;  2F2O A;  2LE9 B;  2TN4 A;  3CR2 A;  4QJ3 B;  3EK4 A;  1J55 A;  4PE7 A;  1IJ6 A;  1QWV A;  2KAV A;  1FPW A;  1KWO B;  1K95 A;  2JNX A;  3SS3 A;  2M3W A;  2PSR A;  1QJT A;  4MVF A;  4AQI A;  1F55 A;  1KCY A;  3TDU A;  1IGV A;  1K8U A;  1SPY A;  2BCA A;  2EC6 B;  2F33 A;  3SG7 A;  2KYC A;  1B47 A;  1EG3 A;  3VRO A;  2JT0 A;  1QX2 A;  1BMO A;  2L4H A;  3IVT A;  1UWO A;  4HSZ A;  1JUO A;  2NLN A;  1SW8 A;  1QX5 B;  2OPO A;  2LM5 A;  1KWO C;  4NDB A;  4WRI A;  3CTN A;  1SMG A;  4CID A;  2CBL A;  2L5Y A;  1KK7 Z;  2KPH A;  1NPQ A;  3TDZ A;  1GJY A;  1RK9 A;  3NSO A;  4DS7 A;  1M46 A;  5CSN A;  1OOF A;  5AEQ A;  3CS1 A;  3KPX A;  2WCB A;  1PVA A;  1TTX A;  4JQ0 D;  1OZS A;  3FWB A;  4HRE E;  1YTZ C;  3B87 A;  4YGC B;  1FBV A;  2KI4 B;  3JTD B;  3BOW A;  1SYM A;  2MJW B;  3I5I C;  1U5I A;  3I5F B;  4I5L B;  2AUC A;  4GGF A;  3DF0 B;  1M39 A;  3R1P A;  1LA0 A;  3BFA A;  2BE4 A;  3OP0 A;  2OS8 B;  1SL8 A;  4QJ4 B;  1S36 A;  1N65 A;  1SKT A;  3DZT A;  3NSL A;  2M49 B;  1HQV A;  1J1D A;  3GK1 A;  1SL7 A;  2WC6 A;  5HLV A;  2AAO A;  2PRU A;  3LL8 B;  2K7D A;  1DC1 A;  1KQV A;  3PM8 A;  2CNP A;  4ICB A;  1K96 A;  1MXE A;  1CNP A;  2R2I A;  1DVI A;  3RM1 A;  3OHM B;  2LHI A;  2LMV A;  2OS8 C;  2QEB A;  5D3O A;  2L50 A;  2LNK A;  3S0E A;  4DUQ A;  1DQE A;  2OTG C;  3B7A A;  2KFG A;  1S6I A;  2NXQ A;  2PAL A;  4FQT A;  5FI2 A;  2KLE A;  1WLZ A;  2LVI A;  1QIW A;  3D73 A;  1SBJ A;  1GQM A;  4ORC B;  2MA2 A;  3LCP C;  3SS4 A;  1CMG A;  4YGB B;  2ZNE A;  1NP8 A;  1NUB A;  1TRF A;  5ER5 A;  1M31 A;  2FJU B;  3K21 A;  5AAN A;  1WRK A;  1XFR A;  1OSA A;  4YGD B;  2CT9 A;  3IQO A;  4JWQ A;  3I5H B;  3IQQ A;  1N2D A;  2F2P A;  1NX3 A;  4OCI A;  4PHK A;  2L2E A;  2L5X B;  4YI8 A;  1C7W A;  1SK6 D;  4N1F A;  5I2Q A;  4GPL B;  2JXC A;  2KFH A;  3O4X A;  2CTN A;  3VB1 A;  3GK4 X;  5DKR A;  1UHK A;  5FYX A;  4HRG A;  3SIB A;  2LUX A; 
#chains in the Genus database with same CATH homology
 3SG3 A;  4MN0 A;  1XO5 A;  1EL4 A;  1NCX A;  1J7P A;  4GNK B;  3DVE A;  1F4O A;  2K2F A;  3I5G B;  5HLO A;  3WHT B;  3HCM A;  1BG1 A;  1ALV A;  3CWG A;  5KU1 A;  2LC5 A;  1CDL A;  3A8R A;  5HYD A;  4PAL A;  3O4Y A;  1X02 A;  2GGZ A;  1SL9 A;  2H2K A;  2H61 C;  2KQ6 A;  1W7J B;  1JF0 A;  1CDN A;  1KSM A;  1XFY O;  5CSI A;  4XJK A;  3BUN B;  1KQM B;  1TOP A;  3I5G C;  3O78 A;  3KHE A;  4A4B A;  5I2O A;  4M2P A;  3QRX A;  1CFF A;  4FTG A;  1JWD A;  1A03 A;  1KK7 Y;  2Q91 A;  4PE0 A;  1NX1 A;  3CLN A;  4ORA B;  3BUW B;  2JZI A;  1AHR A;  2LMT A;  2JC2 A;  4MZJ A;  3TS5 B;  1F8H A;  1WLM A;  3DVJ A;  1CDP A;  3JVT B;  1Y1U A;  4USL A;  3F45 A;  1V1F A;  2LAN A;  5HKW A;  1TN4 A;  1XFV O;  3D10 A;  2QAC A;  1TNQ A;  1PVB A;  1UHH A;  3BUO B;  4PHM A;  1Q80 A;  3ZWH A;  4MSP A;  2BKI B;  3M0W A;  1AUI B;  1XFW O;  2F3Y A;  5GQQ C;  1IG5 A;  2M1U A;  1LVC D;  1ZFS A;  3TS5 C;  1S1E A;  1YRU B;  2K7C A;  5JOL A;  3JVT C;  4DIR A;  2LUC A;  2LP3 A;  4M2O A;  1B7T Y;  2BBM A;  1OMV A;  5DKQ A;  1WDC B;  2KYF A;  1A29 A;  1CDM A;  2MAZ A;  4C0L A;  1BR4 B;  3I5I B;  1IQ5 A;  2WCE A;  4WQ3 A;  1F71 A;  1NX0 A;  2ZRT A;  2L0P A;  1S6J A;  1EXR A;  1DJI A;  4NDC A;  4ZCV A;  2WND A;  1UUR A;  2HF5 A;  1CKK A;  1UHI A;  1DJH A;  1DF0 A;  2LVK A;  5CSJ A;  1XK4 A;  2M7N A;  1WDC C;  4ETO A;  1OMR A;  1TIZ A;  2LV7 A;  4MLW A;  4MEW A;  2FCE A;  1ZOT B;  1DJY A;  2JTT A;  2L4I A;  3EK7 A;  3SIA A;  3TUY C;  2JXL A;  1QLK A;  5CPV A;  3SG6 A;  1C7V A;  3WNX B;  1DJW A;  2KBI A;  4I5K A;  2KHN A;  2MLE C;  2LMU A;  2BL0 C;  3NXA A;  3PLF B;  5D69 A;  2OTG B;  2Y4Q A;  3CR4 X;  1RFJ A;  1TNX A;  4OV2 A;  4PE4 A;  1DT7 B;  1K9K A;  1ZMZ A;  1E8A A;  2BCB A;  2D8N A;  4I5J A;  1B7T Z;  2LCP A;  2I2R E;  1B4C A;  3FIA A;  1JSA A;  4GGN A;  2MLF C;  1RRO A;  4OVN F;  5K89 A;  2KDH A;  3NSI A;  1SRA A;  1F4Q A;  1GGZ A;  5I2L A;  3IF7 A;  1A75 A;  2E30 A;  2FOT A;  1CM4 A;  2QPT A;  3SG5 A;  4MBE A;  3BXK A;  2COL B;  2Q4U A;  1MHO A;  2LAP A;  1FI6 A;  2GGM A;  3KEV A;  1BF5 A;  1A2X A;  1L2O B;  4IL1 A;  4C0J A;  1XVJ A;  4MRX A;  3NSK A;  1H4B A;  1NCZ A;  3DVK A;  1JBA A;  1L7Z A;  1UHN A;  2I94 A;  1PUL A;  3PN7 C;  2EGD A;  3AKB A;  1OQP A;  1V1G A;  2SAS A;  2MBX A;  1Y1A A;  3D0Y A;  3PAT A;  1BLQ A;  4OKH A;  2ZRS A;  1K90 D;  1L2O C;  1UP5 A;  1NIW A;  2KSP A;  3OB1 B;  1J7O A;  2MHH A;  4JPZ B;  1NWD A;  2LLU A;  5G08 A;  4AQJ A;  1ODB A;  4BY5 A;  4XYN A;  3KF9 A;  4D1E A;  1WRZ A;  2KFF A;  2K2A A;  4AOM A;  3BOW B;  5DKN A;  2O5G A;  4CPV A;  1FF1 A;  1RWY A;  1NX2 A;  1U5I B;  4YGA A;  1QS7 A;  1NSH A;  1M63 B;  1OOJ A;  1IWQ A;  1BT6 A;  1SCV A;  4TNC A;  1AP4 A;  2NCO A;  2F8P A;  1J7Q A;  3KO0 A;  3OB2 B;  1ALW A;  3DD4 A;  1Y0V H;  4GAO A;  4R1E A;  1EJ3 A;  2KI6 D;  3VRP A;  3BYA A;  2ISD A;  3CZT X;  5D7F A;  1GGW A;  2B1U A;  3PAL A;  4M2Q A;  2KQY A;  1QV0 A;  4F0Z B;  1F70 A;  1DJG A;  1PAL A;  1W7I B;  4NDD A;  5BPJ A;  4DCK A;  1YUU A;  2I7A A;  4GGF C;  3VRR A;  5KTY A;  1D1O A;  1IJ5 A;  2HPS A;  1S6C A;  2O60 A;  2LHL A;  3ICB A;  2M9G A;  4PHJ A;  5ER4 X;  1Y6W A;  1Y1X A;  1RJV A;  3BQ3 A;  3GOF A;  5KSZ A;  3LK0 A;  1OE9 B;  1ZAC A;  2JT8 A;  4GUK A;  1RTP 1;  3BUM B;  5CSF A;  1S3P A;  3WXA A;  4YRU A;  1IH0 A;  2WC8 A;  3PFV A;  4UPG A;  2M1K B;  5IBW A;  1FW4 A;  3EVU A;  2I18 A;  3OX5 A;  1DMO A;  1MWN A;  1TNW A;  1KSO A;  2IS9 A;  1UHJ A;  3DF0 A;  1QIV A;  1TNP A;  1MF8 B;  2KGB C;  2M7L A;  2KNE A;  4OR9 B;  4Q04 A;  4WQ2 A;  2PAS A;  4YBH B;  2JPT A;  2FCD A;  2G2B A;  1MUX A;  2RGI A;  1A4P A;  4FQO A;  4PHN A;  1YRT B;  4U8D A;  2LLS A;  5TNC A;  1EG4 A;  2LP2 A;  3CGA A;  2ZFD A;  1HT9 A;  3LLE A;  1FI5 A;  5HKY A;  3SJS A;  2M97 A;  2CCM A;  2JNF A;  1KFU S;  4GBA A;  2WOR A;  2BKH B;  2K0J A;  3TUY B;  4CFQ A;  2JUL A;  3BUX B;  3RLZ A;  3VGO A;  1ZUZ A;  2P6B B;  2MRD A;  1AK8 A;  2BL0 B;  1J1E A;  1XYD A;  2NCP A;  4A4C A;  1XFX O;  1XFU O;  1KFU L;  2A4J A;  2KI6 C;  4DRW A;  1LIN A;  1YUR A;  3O6B A;  5J3X A;  2LVJ A;  3EKJ A;  4PE1 A;  4ZCU A;  4PCW A;  1QV1 A;  1DTL A;  3DVM A;  3AKA A;  2M8U A;  3O2P A;  4HRH A;  4XJK B;  1SCM B;  3MSE B;  5AFP A;  1QAT A;  2KOT A;  1JFK A;  5JJG A;  1CB1 A;  1B9A A;  1IKU A;  5F6T A;  1JF2 A;  1YR5 A;  2ZND A;  1F54 A;  1OZO A;  2Y1N A;  2EC6 C;  1QAS A;  2H61 A;  2ZKM X;  3EKH A;  5PAL A;  1K94 A;  1B8R A;  1JC2 A;  1CLM A;  2K7O A;  1DJZ A;  1B8C A;  4E68 A;  2AMI A;  1B1G A;  1YUT A;  4MZL A;  1SR6 B;  1SCM C;  1LA3 A;  2HET A;  1YVH A;  1AJ4 A;  2JTZ A;  1PK0 D;  3PN7 B;  1BR1 B;  2VRG A;  1SY9 A;  1QXP A;  1KK8 B;  5AER A;  1AVS A;  2JWW A;  2HQW A;  3AAK A;  1K9U A;  1CFC A;  1MR8 A;  2WCF A;  4MZK A;  1SR6 C;  2KI4 C;  3JTD C;  3OX6 A;  4N1G A;  1BU3 A;  4QJ5 B;  1DGV A;  3FS7 A;  3I5F C;  4C0K A;  5I8N A;  1LXF C;  4BY4 A;  4GFT A;  2EHB A;  1VRK A;  3E3R A;  3SG4 A;  1CMF A;  1C07 A;  3GK2 A;  1YX7 A;  1IRJ A;  1KK8 C;  1MXL C;  2GV5 A;  1YX8 A;  2V53 A;  1M45 A;  1K2H A;  1S5G Y;  3TDI A;  1PSR A;  1DF0 B;  1YVL A;  1K9P A;  2JU0 A;  4NQG A;  3VRQ A;  1CTR A;  1QLS A;  3EK8 A;  1NCY A;  3EVV A;  1BOC A;  2M29 A;  2KAY A;  1QVI Y;  2WOS A;  3VRN A;  2K7B A;  3EVR A;  4ORB B;  4N5X A;  3TZ1 A;  1G8I A;  1EH2 A;  1DJX A;  1AJ5 A;  1XFZ O;  1UUS A;  5HKZ A;  1BJF A;  1TCF A;  2ZN9 A;  1R2U A;  1MQ1 A;  1XK4 C;  2F3Z A;  2JOJ A;  1BOD A;  2M0R A;  2Y5I A;  2JT3 A;  3AAJ A;  3I5H C;  4YGE B;  1IQ3 A;  2LLT A;  3HX4 A;  1CLB A;  1B8L A;  2ZN8 A;  1DGU A;  5B8I B;  1PSB A;  1A75 B;  1N0Y A;  1CFP A;  1H8B A;  1K93 D;  1S5G Z;  2SCP A;  1S26 D;  4L9M A;  1CFD A;  1QX7 A;  1PRW A;  2K61 A;  2PMY A;  1OMD A;  2Y1M A;  2L98 A;  1REC A;  2LVV A;  3C1V A;  3LK1 A;  1J7R A;  1WY9 A;  4PDZ A;  1NYA A;  1SNL A;  2L51 A;  1TCO B;  3ZNI A;  4P2Y B;  3WHU B;  2KBM A;  2KAX A;  2NZ0 A;  2G9B A;  1WRL A;  2HQ8 A;  2CXJ A;  1XA5 A;  2BCX A;  1QVI Z;  1CLL A;  4I5N B;  2E6W A;  3FWC A;  1QTX A;  1KFX S;  2PVB A;  5AXI A;  3CR5 X;  4MRY A;  4YI9 A;  4CLN A;  1JFJ A;  3D0Y B;  4CFR A;  1CM1 A;  1LKJ A;  2K8M B;  2KGR A;  1R6P A;  2BEC A;  2JRF A;  3SG2 A;  4P5O E;  1G4Y R;  3A4U B;  3PSR A;  1KFX L;  1KQM C;  2DOQ A;  3H4S E;  1YUS A;  2BE6 A;  2JQ6 A;  1G33 A;  2BBN A;  2F2O A;  2LE9 B;  2TN4 A;  3CR2 A;  4QJ3 B;  3EK4 A;  1J55 A;  4PE7 A;  1IJ6 A;  2KAV A;  1FPW A;  1KWO B;  1K95 A;  2JNX A;  2M3W A;  2PSR A;  1QJT A;  4MVF A;  4AQI A;  1F55 A;  1KCY A;  3TDU A;  1IGV A;  1K8U A;  1SPY A;  2BCA A;  2EC6 B;  2F33 A;  3SG7 A;  2KYC A;  1B47 A;  1EG3 A;  3VRO A;  2JT0 A;  1QX2 A;  1BMO A;  2L4H A;  1UWO A;  4HSZ A;  1JUO A;  2NLN A;  1SW8 A;  1QX5 B;  2OPO A;  2LM5 A;  1KWO C;  4NDB A;  4WRI A;  3CTN A;  1SMG A;  4CID A;  2CBL A;  1KK7 Z;  1NPQ A;  3TDZ A;  1GJY A;  1RK9 A;  3NSO A;  4DS7 A;  1M46 A;  5CSN A;  5AEQ A;  3CS1 A;  3KPX A;  2WCB A;  1PVA A;  1TTX A;  4JQ0 D;  1OZS A;  3FWB A;  4HRE E;  1YTZ C;  4YGC B;  1FBV A;  2KI4 B;  3JTD B;  3BOW A;  1SYM A;  2MJW B;  3I5I C;  1U5I A;  3I5F B;  4I5L B;  2AUC A;  4GGF A;  3DF0 B;  1M39 A;  1LA0 A;  2BE4 A;  3OP0 A;  2OS8 B;  1SL8 A;  4QJ4 B;  1S36 A;  1N65 A;  1SKT A;  3NSL A;  2M49 B;  1HQV A;  1J1D A;  3GK1 A;  1SL7 A;  5HLV A;  2AAO A;  2PRU A;  3LL8 B;  2K7D A;  1KQV A;  3PM8 A;  2CNP A;  4ICB A;  1K96 A;  1MXE A;  1CNP A;  2R2I A;  1DVI A;  3RM1 A;  3OHM B;  2LHI A;  2LMV A;  2OS8 C;  2L50 A;  2LNK A;  4DUQ A;  2OTG C;  2KFG A;  1S6I A;  2NXQ A;  2PAL A;  1WLZ A;  2LVI A;  1QIW A;  1SBJ A;  1GQM A;  4ORC B;  2MA2 A;  3LCP C;  1CMG A;  4YGB B;  2ZNE A;  1NP8 A;  1NUB A;  1TRF A;  5ER5 A;  1M31 A;  2FJU B;  3K21 A;  5AAN A;  1WRK A;  1OSA A;  4YGD B;  2CT9 A;  3IQO A;  4JWQ A;  3I5H B;  3IQQ A;  1N2D A;  2F2P A;  1NX3 A;  4OCI A;  4PHK A;  2L2E A;  2L5X B;  4YI8 A;  1C7W A;  1SK6 D;  4N1F A;  5I2Q A;  4GPL B;  2JXC A;  2KFH A;  2CTN A;  3GK4 X;  5DKR A;  1UHK A;  5FYX A;  4HRG A;  3SIB A;  2LUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...