1B1GA

Solvated refinement of ca-loaded calbindin d9k
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN (CALBINDIN D9K)
publication title Protein solution structure calculations in solution: solvated molecular dynamics refinement of calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 21
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1998-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b1gA00
2MA2A 3EKHA 1Y1AA 1SL8A 1NIWA 3CGAA 2AMIA 4OKHA 4L9MA 1YUUA 1WRKA 2WOSA 1J1EA 1EH2A 5I2OA 1S6IA 4USLA 1FI5A 3AKBA 1X02A 2MHHA 3NSIA 2BCXA 3EK8A 1CFFA 2HQ8A 3TUYB 3FIAA 3BOWB 2JC2A 1K2HA 4C0JA 1DJXA 4YI9A 1B4CA 1U5IA 3C1VA 1TNWA 3A8RA 1IRJA 4FTGA 3SIAA 1B8LA 1UURA 4MRYA 1FPWA 2Y5IA 1YURA 3AAJA 2KI4B 4YGCB 1KCYA 1AHRA 3TDZA 3PN7B 1DJHA 5JJGA 2V53A 2CNPA 1MQ1A 1R6PA 2LVIA 1K93D 1QX5B 1R2UA 1S26D 4GAOA 4ZCVA 3SG4A 1EJ3A 1WLMA 3BUXB 5JOLA 2KOTA 1SRAA 2ZNDA 3LL8B 4YBHB 5D7FA 2ZN8A 1A75A 4Q04A 4WRIA 4ETOA 2COLB 1LA3A 3SJSA 2PVBA 1F4OA 1KFXL 1AK8A 2OS8C 2I2RE 1Y0VH 4PHKA 2K2AA 2KGRA 2LP3A 2DOQA 1AP4A 1CLBA 4PE7A 1AUIB 1IQ5A 1W7JB 1YVHA 2K7CA 5IBWA 1SR6B 2KI6D 1XFZO 3KHEA 1TRFA 1EXRA 2BKIB 1WLZA 1QTXA 3TUYC 1PSBA 1BLQA 4YRUA 2K61A 1KFUL 1ZFSA 3HCMA 3PATA 1QATA 2JT0A 1SPYA 3KPXA 2JT3A 4CFRA 1BF5A 1CFDA 3I5IC 3EVVA 1U5IB 3KF9A 3M0WA 1QVIZ 2KI4C 4N1GA 3PN7C 1N0YA 1V1FA 3DVJA 1B8RA 1SCMB 2BBNA 5PALA 1F8HA 3EKJA 3JVTC 4DCKA 1J7RA 5GQQC 2KBIA 5KSZA 3CWGA 2H2KA 1DJWA 5BPJA 2GGMA 1IJ5A 1J7OA 2NCPA 1UHNA 5D69A 1M46A 3BUWB 1QIWA 1XFXO 2JU0A 1OSAA 1E8AA 2P6BB 1CTRA 1YVLA 1LVCD 2IS9A 1YX8A 4QJ4B 1BT6A 2LHLA 3K21A 2H61C 2JT8A 2OPOA 3H4SE 1CM4A 1B47A 4CFQA 1BODA 3MSEB 2B1UA 4XJKB 1N65A 3NXAA 1MXLC 3SG2A 1S3PA 2HETA 2FOTA 5CSNA 1L2OC 4OV2A 2LLUA 2LP2A 3WHTB 1WDCB 1EG4A 1CMFA 4MZLA 3DVEA 3E3RA 1OOJA 4U8DA 2KFHA 4GGFA 4I5KA 3A4UB 2PRUA 2BE6A 2M1UA 1J7PA 1JSAA 2KYFA 2Y1MA 4GNKB 1SCMC 1JBAA 1CMGA 1K94A 2L4HA 2JTZA 4IL1A 1BR1B 1YRTB 3BXKA 1YRUB 1TN4A 5ER5A 1D1OA 5HKWA 3CR5X 3GK4X 4C0KA 3O4YA 2MLEC 1XYDA 3DD4A 1K95A 5ER4X 2LMTA 1C07A 1XA5A 4XYNA 4DRWA 1QASA 1J7QA 1M63B 4P2YB 2H61A 2OS8B 1JFJA 4I5NB 1Y6WA 4GPLB 1UHHA 5HYDA 2I94A 1JWDA 1K8UA 2CXJA 5K89A 3D0YB 2SASA 1WDCC 2CTNA 2KSPA 1FF1A 4A4CA 2R2IA 3EK4A 4M2OA 1B9AA 3NSOA 2F2OA 4DIRA 1S5GY 3DF0A 3RM1A 2O5GA 3IQQA 4NDBA 1KK7Z 3CZTX 3LK0A 3VRRA 3I5IB 2CCMA 4ORCB 1NSHA 4PCWA 4HRHA 1GQMA 1TTXA 1KK8B 1B7TY 3KEVA 3JVTB 3ZWHA 1F71A 1GGZA 1V1GA 3SG6A 1SKTA 4PHJA 3BYAA 1ZUZA 1M39A 1BU3A 3TZ1A 1A03A 2ZFDA 2WCEA 3IQOA 2LANA 2KI6C 1C7WA 2GGZA 4M2PA 1SBJA 4PALA 2PALA 3QRXA 2F2PA 3ICBA 1PVAA 1PULA 2E30A 2EGDA 2NZ0A 4MVFA 4CLNA 2K0JA 4I5JA 4ZCUA 3I5FC 1DJIA 1MWNA 1SCVA 2K7BA 2KFFA 1LKJA 3VROA 1B1GA 4XJKA 2BCAA 2LUCA 5HKYA 1QJTA 1Q80A 1PALA 2KNEA 2KYCA 1TNXA 4BY5A 1L2OB 1VRKA 1XFUO 1ZMZA 4HREE 2ZN9A 2F3ZA 2F3YA 1DGUA 2KFGA 2HQWA 1CFCA 2F8PA 1OMVA 2M97A 2I7AA 4CIDA 4PE1A 3EK7A 2KQYA 2M0RA 2VRGA 5B8IB 2GV5A 3DF0B 4MBEA 4YGEB 1JF0A 1NX0A 1DJGA 1IQ3A 3LCPC 1MF8B 1KK8C 1TNPA 3EVRA 1MR8A 5I2LA 1IJ6A 2KGBC 2HPSA 1G4YR 1YR5A 2ZNEA 2JXLA 1KSMA 1CM1A 1XK4C 1KSOA 3I5HC 3JTDC 2KAVA 2Y1NA 1ZOTB 4QJ5B 1PSRA 2KQ6A 1K9UA 3CTNA 3OX5A 4PHMA 5DKNA 1WRLA 3NSLA 2TN4A 1K90D 4CPVA 1DTLA 1GJYA 1OQPA 1SY9A 4HSZA 1DJZA 4JPZB 3PALA 1BJFA 2PMYA 5CSJA 1PVBA 5AFPA 1OZOA 1PK0D 5AXIA 3SG7A 1B8CA 1SK6D 3I5GB 3D0YA 1QS7A 3D10A 1A29A 1QV1A 3OHMB 2EHBA 3TDUA 1B7TZ 2BKHB 4MN0A 2L51A 1G33A 2KAYA 3OX6A 5I8NA 4ORAB 2LM5A 4GUKA 1SL9A 4AQIA 1LINA 4YGAA 2JWWA 2LAPA 2LVKA 5FYXA 4OVNF 4GFTA 3CR2A 5HLOA 1OE9B 1JUOA 3SIBA 4MZKA 5AEQA 1LA0A 1SL7A 2L50A 2M29A 1TNQA 3KO0A 1DVIA 3PFVA 1QIVA 2RGIA 1NX2A 2Q91A 4PHNA 1J55A 1IG5A 1NP8A 1TCOB 1F54A 2LE9B 2PSRA 1DF0B 2MJWB 4NQGA 2LLSA 1K96A 1XK4A 2KDHA 1A2XA 2WCBA 2M8UA 2QPTA 1KWOB 1Y1XA 3PSRA 1ALVA 1RJVA 2O60A 1A4PA 5DKQA 4D1EA 3OP0A 1AVSA 1UUSA 2AUCA 1J1DA 1AJ4A 1CDMA 1FBVA 1UP5A 1SYMA 3I5FB 1EG3A 5I2QA 3BUMB 3WHUB 4MLWA 4TNCA 4A4BA 2G9BA 3I5GC 1XFYO 1UHIA 3O2PA 3BQ3A 2EC6C 2L4IA 4OCIA 4N1FA 5HLVA 4PE0A 2BBMA 2JULA 1CDNA 2Y4QA 5J3XA 1S36A 3SG3A 4FQOA 3WNXB 1QVIY 1W7IB 2FCEA 4YGBB 4NDCA 3GOFA 3CS1A 4JWQA 1WY9A 4MEWA 2M1KB 2M49B 1NCYA 1YUTA 3FS7A 4MSPA 1NWDA 1UHKA 1KWOC 2SCPA 1H4BA 2PASA 1ALWA 1RK9A 1GGWA 1YUSA 1CNPA 3I5HB 2LV7A 3JTDB 1KQMC 3BUNB 3TDIA 2BL0B 1CLLA 3CR4X 3HX4A 3BUOB 5CSFA 1K9KA 5CSIA 1Y1UA 4BY4A 1ZACA 1NPQA 1OMDA 1RFJA 2M9GA 2LMUA 3O6BA 2WNDA 1CB1A 1F4QA 2FCDA 2L98A 5TNCA 4N5XA 4ICBA 5HKZA 1NCZA 4E68A 4ORBB 1WRZA 2Q4UA 2MBXA 1C7VA 4PDZA 5G08A 2OTGC 3PM8A 1DGVA 5F6TA 2K7DA 2L0PA 2CT9A 1M31A 2JNXA 1RECA 4GBAA 1DT7B 4MZJA 3PLFB 3TS5C 2LVVA 3GK1A 2LVJA 1M45A 1N2DA 2BECA 2L5XB 4UPGA 1H8BA 1NX1A 2LLTA 1NYAA 2QACA 2JQ6A 2BE4A 1DF0A 3EVUA 3NSKA 1S1EA 4WQ2A 2WC8A 2ZRSA 3VRQA 3VRPA 1FI6A 3IF7A 4AOMA 3AKAA 3OB2B 1SNLA 3LLEA 1QLSA 2L2EA 4F0ZB 1K9PA 2BL0C 2G2BA 3F45A 1EL4A 1NUBA 1XFVO 2M7LA 1MHOA 2JNFA 2BCBA 2D8NA 1TOPA 1BMOA 2LCPA 2WORA 2JRFA 1F70A 4MRXA 5AANA 1KQVA 1QX7A 4GGFC 1BOCA 2JTTA 1S5GZ 2JXCA 4M2QA 4PE4A 4QJ3B 1QLKA 1SW8A 2KBMA 1QX2A 1UWOA 1RROA 1YTZC 5DKRA 2NXQA 4HRGA 1DMOA 1QXPA 1BR4B 2EC6B 2LMVA 1FW4A 1XVJA 3FWCA 2A4JA 2JZIA 4NDDA 3LK1A 4GGNA 2MLFC 2MRDA 1CLMA 1KK7Y 2K2FA 2K7OA 1S6CA 1A75B 1KFXS 1AJ5A 2M3WA 1MUXA 1HT9A 2LUXA 2M7NA 2NCOA 1TIZA 1G8IA 3DVMA 2FJUB 2NLNA 3WXAA 5AERA 1RWYA 1IKUA 1SR6C 1RTP1 3DVKA 4DUQA 1XFWO 3O78A 1JF2A 1UHJA 3GK2A 5KTYA 2F33A 2LNKA 1L7ZA 1KQMB 3OB1B 3BOWA 4JQ0D 1IH0A 1ODBA 1KFUS 1XO5A 1OMRA 2ISDA 4OR9B 5CPVA 1LXFC 1TCFA 1JFKA 3CLNA 4R1EA 1CFPA 1IGVA 2CBLA 1HQVA 2E6WA 4I5LB 2LC5A 1CDLA 1SMGA 2JPTA 2WCFA 1YX7A 1BG1A 2ZRTA 2LHIA 4YGDB 4YI8A 1S6JA 4P5OE 4AQJA 1PRWA 2HF5A 3AAKA 3VRNA 3ZNIA 3VGOA 2ZKMX 2MAZA 3FWBA 1DJYA 3SG5A 1IWQA 2AAOA 2OTGB 5KU1A 2I18A 2K8MB 1CKKA 1F55A 1QV0A 1OZSA 1NX3A 1CDPA 2JOJA 1MXEA 2KAXA 1JC2A 1NCXA 4WQ3A 4C0LA 2KHNA 4DS7A 3TS5B 3RLZA
chains in the Genus database with same CATH superfamily
2MA2A 3EKHA 1Y1AA 1SL8A 1NIWA 3CGAA 2AMIA 1LS8A 4OKHA 3SS4A 1OW4A 4L9MA 3OGNA 1YUUA 1OOIX 1WRKA 1J1EA 2WOSA 1EH2A 1OOHA 5I2OA 1S6IA 4USLA 2QEHA 1FI5A 3AKBA 1X02A 2MHHA 3NSIA 1TWOA 2BCXA 3EK8A 1CFFA 2HQ8A 3TUYB 3FIAA 3BOWB 2JC2A 1K2HA 4C0JA 1DJXA 4YI9A 1B4CA 1U5IA 3C1VA 1TNWA 3A8RA 1IRJA 4FTGA 3SIAA 1B8LA 1UURA 4MRYA 1FPWA 3UNWA 2Y5IA 1YURA 3AAJA 2KI4B 4YGCB 1KCYA 1AHRA 3TDZA 3PN7B 1DJHA 5JJGA 2V53A 2CNPA 1MQ1A 1QWVA 1R6PA 2LVIA 1K93D 1QX5B 1R2UA 1S26D 4GAOA 4ZCVA 3SG4A 2L5YA 1EJ3A 1WLMA 3BUXB 3NHTA 3SS3A 2WC5A 5JOLA 2KOTA 1SRAA 2ZNDA 3LL8B 4YBHB 5D7FA 1C3ZA 1A75A 2ZN8A 4Q04A 4WRIA 4ETOA 5HL1A 2COLB 1LA3A 3SJSA 3BFAA 2PVBA 2FJYA 1F4OA 1KFXL 1AK8A 2OS8C 2I2RE 1GM0A 1Y0VH 4PHKA 1DEKA 2K2AA 3D74A 2KGRA 2LP3A 2DOQA 1AP4A 1CLBA 4PE7A 1AUIB 1IQ5A 1W7JB 4JKTA 1YVHA 2K7CA 5IBWA 1SR6B 2KI6D 1XFZO 3FE9A 3KHEA 1TRFA 1EXRA 2BKIB 1ORGA 1WLZA 1QTXA 3TUYC 1PSBA 1BLQA 3B7AA 4YRUA 2K61A 1KFUL 1ZFSA 3HCMA 2WCKA 3PATA 1QATA 2JT0A 1SPYA 3KPXA 2JT3A 4CFRA 1BF5A 1CFDA 3I5IC 5FI7A 3EVVA 1U5IB 3KF9A 3M0WA 1QVIZ 2KI4C 4N1GA 3PN7C 1N0YA 1V1FA 3DVJA 1B8RA 1SCMB 2BBNA 3CYZA 2WCLA 5PALA 3EKJA 3JVTC 4DCKA 1J7RA 1F8HA 5GQQC 2KBIA 5KSZA 3CWGA 2H2KA 1DJWA 3CZ1A 5BPJA 2GGMA 1IJ5A 1J7OA 2NCPA 1UHNA 5D69A 1M46A 3BUWB 1QIWA 1XFXO 2JU0A 1OSAA 1E8AA 2PYQA 2P6BB 1CTRA 1YVLA 1LVCD 2IS9A 1YX8A 4QJ4B 1BT6A 2WCJA 2KPHA 2LHLA 3K21A 2H61C 2JT8A 2OPOA 3H4SE 1CM4A 1B47A 4CFQA 1BODA 2WC6A 3MSEB 2B1UA 4XJKB 1N65A 3NXAA 1MXLC 3SG2A 1S3PA 2HETA 2FOTA 5CSNA 1L2OC 4OV2A 2LLUA 2LP2A 3WHTB 1WDCB 1EG4A 1CMFA 4MZLA 3DVEA 3E3RA 1OOJA 4U8DA 2KFHA 4GGFA 4I5KA 3A4UB 2PRUA 2BE6A 2M1UA 1J7PA 1JSAA 2KYFA 2Y1MA 4GNKB 1SCMC 1JBAA 1CMGA 1K94A 2L4HA 2JTZA 4IL1A 1BR1B 1YRTB 3BXKA 1YRUB 1TN4A 3B6XA 3DYEA 5ER5A 1D1OA 5HKWA 1TUZA 3CR5X 3GK4X 4C0KA 3L4LA 2MLEC 3O4YA 1XYDA 3DD4A 1K95A 5ER4X 2LMTA 1C07A 1XA5A 4XYNA 4DRWA 3N7HA 1OOGA 1QASA 1J7QA 1M63B 4P2YB 3NHIA 2H61A 2OS8B 1JFJA 2QDIA 4OZDA 4I5NB 1Y6WA 4GPLB 1UHHA 5HYDA 2I94A 1JWDA 1K8UA 2CXJA 3CZ2A 5K89A 1XFRA 3PM2A 3D0YB 2SASA 3R1OA 1WDCC 2CTNA 2KSPA 1FF1A 4A4CA 2R2IA 3EK4A 4M2OA 4FQTA 1B9AA 3NSOA 2F2OA 3DY9A 1S5GY 3DF0A 4DIRA 3RZSA 3RM1A 2O5GA 3IQQA 4NDBA 1KK7Z 3CZTX 3LK0A 4IJ7A 3VRRA 3I5IB 2CCMA 4ORCB 1NSHA 2K60A 4PCWA 4HRHA 1GQMA 1TTXA 1KK8B 3CABA 5FI6A 1B7TY 3KEVA 1Z2CB 3JVTB 3ZWHA 1F71A 1GGZA 1V1GA 3SG6A 5DICA 1SKTA 4PHJA 3BYAA 1ZUZA 1M39A 1BU3A 3TZ1A 3R1VA 2P71A 1A03A 4INXA 1C3YA 2ERBA 2ZFDA 2WCEA 2WCHA 3IQOA 2LANA 2KI6C 1C7WA 2GGZA 4M2PA 1SBJA 4PALA 2PALA 3QRXA 2F2PA 3ICBA 1PVAA 1PULA 2E30A 2EGDA 2NZ0A 4MVFA 4CLNA 2K0JA 3S0AA 4I5JA 4ZCUA 3I5FC 1DJIA 1MWNA 1SCVA 2K7BA 2KFFA 1LKJA 2KLEA 3VROA 1B1GA 4XJKA 2BCAA 2LUCA 2P70A 5HKYA 1QJTA 1Q80A 3D77A 1PALA 1DC1A 1DQEA 1SSEB 2KNEA 1TNXA 2KYCA 4BY5A 1L2OB 1VRKA 1XFUO 1ZMZA 4HREE 2ZN9A 2F3ZA 2F3YA 2QEBA 1DGUA 2KFGA 2HQWA 1CFCA 2F8PA 1OMVA 2M97A 2I7AA 4CIDA 4PE1A 3EK7A 2KQYA 2M0RA 3D76A 2VRGA 1Z4HA 5B8IB 2GV5A 3DF0B 4MBEA 4YGEB 1JF0A 1NX0A 3CDNA 1DJGA 1IQ3A 3LCPC 1MF8B 1KK8C 1TNPA 3EVRA 1MR8A 5I2LA 1IJ6A 2KGBC 2HPSA 1G4YR 1YR5A 2ZNEA 2JXLA 1KSMA 1CM1A 1XK4C 1KSOA 3I5HC 3JTDC 2KAVA 2Y1NA 1ZOTB 4QJ5B 1PSRA 2KQ6A 1K9UA 3CTNA 3OX5A 4PHMA 5DKNA 1WRLA 3NSLA 2TN4A 1K90D 3BFHA 4CPVA 1DTLA 4KYNA 1GJYA 1OQPA 1SY9A 2YGUA 3CZ0A 4HSZA 1DJZA 4JPZB 3PALA 1BJFA 1P28A 2PMYA 5CSJA 1PVBA 5AFPA 1OZOA 1PK0D 5AXIA 3UO9A 3SG7A 1B8CA 1SK6D 3I5GB 3D0YA 1QS7A 3D10A 1A29A 1QV1A 3OHMB 2EHBA 3TDUA 1B7TZ 2BKHB 4MN0A 2L51A 1G33A 2KAYA 3OX6A 5I8NA 4ORAB 2LM5A 4GUKA 1T14A 1SL9A 4AQIA 1LINA 4YGAA 2GTEA 2JWWA 2LAPA 2LVKA 5FYXA 4OVNF 4INWA 4GFTA 3CR2A 5HLOA 1OE9B 1JUOA 3SIBA 4MZKA 5AEQA 1LA0A 1SL7A 2L50A 2M29A 1TNQA 3KO0A 1DVIA 3PFVA 1QIVA 2RGIA 1NX2A 2Q91A 4PHNA 1J55A 1IG5A 1NP8A 1TCOB 1F54A 2LE9B 2PSRA 1DF0B 2MJWB 4NQGA 2LLSA 1K96A 1XK4A 2KDHA 1A2XA 2WCBA 2M8UA 2QPTA 1KWOB 1IIOA 1Y1XA 3PSRA 1ALVA 1RJVA 2O60A 1A4PA 5DKQA 4D1EA 3OP0A 1AVSA 1UUSA 2PQLA 3S0EA 2AUCA 1J1DA 1AJ4A 1CDMA 1FBVA 1UP5A 1SYMA 3I5FB 1EG3A 5I2QA 3BUMB 3WHUB 4MLWA 4TNCA 5D3OA 2G9BA 4A4BA 3I5GC 1XFYO 1UHIA 3O2PA 3BQ3A 3S0DA 2EC6C 2L4IA 4OCIA 4N1FA 5HLVA 4PE0A 2BBMA 2JULA 1CDNA 2Y4QA 5EL2A 5J3XA 1S36A 3SG3A 3S0FA 2QEVA 4FQOA 3WNXB 1QVIY 1W7IB 2FCEA 4YGBB 4NDCA 3GOFA 3CS1A 4JWQA 1WY9A 4MEWA 3FE6A 2M1KB 2M49B 1NCYA 1YUTA 3FS7A 4MSPA 1NWDA 1UHKA 1KWOC 2SCPA 1H4BA 2KLDA 1ALWA 1RK9A 2PASA 1GGWA 1YUSA 1CNPA 3I5HB 2LV7A 3JTDB 1KQMC 3BUNB 3TDIA 2BL0B 1CLLA 3CR4X 3HX4A 3BUOB 5CSFA 1K9KA 5CSIA 1Y1UA 4BY4A 1ZACA 1NPQA 1OMDA 3DXLA 1RFJA 2M9GA 1OOFA 2LMUA 2WNDA 3B88A 3O6BA 1CB1A 1F4QA 3PJIA 3D78A 3B87A 2FCDA 2L98A 5TNCA 4N5XA 4ICBA 5HKZA 1NCZA 4E68A 4ORBB 1WRZA 2Q4UA 2MBXA 1C7VA 4PDZA 5G08A 3S0GA 2OTGC 3PM8A 1DGVA 5F6TA 3B86A 2K7DA 2L0PA 2CT9A 2H8VA 1M31A 2JNXA 1RECA 4GBAA 1DT7B 4MZJA 3PLFB 3TS5C 2LVVA 3GK1A 2LVJA 3D73A 1M45A 1N2DA 2BECA 1DELA 2L5XB 4UPGA 1H8BA 2QEOA 1NX1A 2LLTA 1NYAA 2QACA 2JQ6A 2BE4A 1DF0A 3EVUA 3NSKA 1S1EA 4WQ2A 2WC8A 2ZRSA 3VRQA 3VRPA 1W9ZA 1FI6A 3IF7A 4AOMA 3AKAA 3OB2B 1SNLA 3LLEA 1QLSA 2L2EA 4F0ZB 1K9PA 2BL0C 2G2BA 3F45A 1EL4A 1NUBA 1XFVO 2M7LA 1MHOA 2JNFA 2BCBA 2D8NA 1TOPA 1BMOA 2LCPA 2WORA 2JRFA 3O4XA 4PT1A 4MRXA 5AANA 3V2LA 1F70A 1KQVA 1QX7A 4GGFC 1BOCA 2JTTA 1S5GZ 2JXCA 4M2QA 4JD9A 4PE4A 4QJ3B 3DZTA 1QLKA 2BAPA 1SW8A 2KBMA 1QX2A 1UWOA 1RROA 1YTZC 5DKRA 3BJHA 2NXQA 4HRGA 1DMOA 1QXPA 3Q8IA 3S0BA 1BR4B 2EC6B 2LMVA 1FW4A 1XVJA 3FWCA 2A4JA 2JZIA 3OBVA 4NDDA 3LK1A 4GGNA 2MLFC 2MRDA 1CLMA 1KK7Y 2K2FA 2K7OA 1S6CA 1A75B 1KFXS 1AJ5A 3NGVA 2M3WA 1MUXA 1HT9A 2LUXA 2M7NA 2NCOA 1TIZA 3FE8A 1G8IA 3DVMA 2FJUB 2NLNA 3IVTA 3WXAA 5AERA 1RWYA 1IKUA 1TUJA 3L47A 1SR6C 5I94A 1RTP1 3DVKA 4DUQA 1XFWO 3O78A 3R72A 1JF2A 1UHJA 3BFBA 3GK2A 2F33A 2LNKA 3L4AA 1L7ZA 1KQMB 3OB1B 3BOWA 4JQ0D 5KTYA 1IH0A 1ODBA 1KFUS 1XO5A 5FI2A 1OMRA 2ISDA 4OR9B 5CPVA 1LXFC 1TCFA 1JFKA 3CLNA 4R1EA 1CFPA 1IGVA 2CBLA 1HQVA 2E6WA 4I5LB 2LC5A 1CDLA 1SMGA 2JPTA 2WCFA 1YX7A 1BG1A 2ZRTA 2LHIA 4YGDB 4YI8A 1S6JA 3VB1A 4P5OE 4AQJA 1PRWA 2HF5A 3EG5B 3AAKA 2L2CA 3VRNA 3QMEA 3ZNIA 3VGOA 2WCMA 3R1PA 2ZKMX 3SS5A 2MAZA 3FWBA 1DJYA 3SG5A 1IWQA 2AAOA 2BNXA 2OTGB 3D75A 3K1EA 2I18A 2K8MB 5KU1A 1CKKA 1QV0A 1F55A 1OZSA 1NX3A 2JPOA 1CDPA 2JOJA 1MXEA 2KAXA 1JC2A 1NCXA 4WQ3A 4C0LA 4F7FA 2KHNA 4DS7A 3TS5B 3RLZA
chains in the Genus database with same CATH topology
2MA2A 3EKHA 1Y1AA 1SL8A 1NIWA 3CGAA 2AMIA 4OKHA 4L9MA 1YUUA 1WRKA 2WOSA 1J1EA 1EH2A 5I2OA 1S6IA 4USLA 1FI5A 3AKBA 1X02A 2MHHA 3NSIA 2BCXA 3EK8A 1CFFA 2HQ8A 3TUYB 3FIAA 3BOWB 2JC2A 1K2HA 4C0JA 1DJXA 4YI9A 1B4CA 1U5IA 3C1VA 1TNWA 3A8RA 1IRJA 4FTGA 3SIAA 1B8LA 1UURA 4MRYA 1FPWA 2Y5IA 1YURA 3AAJA 2KI4B 4YGCB 1KCYA 1AHRA 3TDZA 3PN7B 1DJHA 5JJGA 2V53A 2CNPA 1MQ1A 1R6PA 2LVIA 1K93D 1QX5B 1R2UA 1S26D 4GAOA 4ZCVA 3SG4A 1EJ3A 1WLMA 3BUXB 5JOLA 2KOTA 1SRAA 2ZNDA 3LL8B 4YBHB 5D7FA 2ZN8A 1A75A 4Q04A 4WRIA 4ETOA 2COLB 1LA3A 3SJSA 2PVBA 1F4OA 1KFXL 1AK8A 2OS8C 2I2RE 1Y0VH 4PHKA 2K2AA 2KGRA 2LP3A 2DOQA 1AP4A 1CLBA 4PE7A 1AUIB 1IQ5A 1W7JB 1YVHA 2K7CA 5IBWA 1SR6B 2KI6D 1XFZO 3KHEA 1TRFA 1EXRA 2BKIB 1WLZA 1QTXA 3TUYC 1PSBA 1BLQA 4YRUA 2K61A 1KFUL 1ZFSA 3HCMA 3PATA 1QATA 2JT0A 1SPYA 3KPXA 2JT3A 4CFRA 1BF5A 1CFDA 3I5IC 3EVVA 1U5IB 3KF9A 3M0WA 1QVIZ 2KI4C 4N1GA 3PN7C 1N0YA 1V1FA 3DVJA 1B8RA 1SCMB 2BBNA 5PALA 1F8HA 3EKJA 3JVTC 4DCKA 1J7RA 5GQQC 2KBIA 5KSZA 3CWGA 2H2KA 1DJWA 5BPJA 2GGMA 1IJ5A 1J7OA 2NCPA 1UHNA 5D69A 1M46A 3BUWB 1QIWA 1XFXO 2JU0A 1OSAA 1E8AA 2P6BB 1CTRA 1YVLA 1LVCD 2IS9A 1YX8A 4QJ4B 1BT6A 2LHLA 3K21A 2H61C 2JT8A 2OPOA 3H4SE 1CM4A 1B47A 4CFQA 1BODA 3MSEB 2B1UA 4XJKB 1N65A 3NXAA 1MXLC 3SG2A 1S3PA 2HETA 2FOTA 5CSNA 1L2OC 4OV2A 2LLUA 2LP2A 3WHTB 1WDCB 1EG4A 1CMFA 4MZLA 3DVEA 3E3RA 1OOJA 4U8DA 2KFHA 4GGFA 4I5KA 3A4UB 2PRUA 2BE6A 2M1UA 1J7PA 1JSAA 2KYFA 2Y1MA 4GNKB 1SCMC 1JBAA 1CMGA 1K94A 2L4HA 2JTZA 4IL1A 1BR1B 1YRTB 3BXKA 1YRUB 1TN4A 5ER5A 1D1OA 5HKWA 3CR5X 3GK4X 4C0KA 3O4YA 2MLEC 1XYDA 3DD4A 1K95A 5ER4X 2LMTA 1C07A 1XA5A 4XYNA 4DRWA 1QASA 1J7QA 1M63B 4P2YB 2H61A 2OS8B 1JFJA 4I5NB 1Y6WA 4GPLB 1UHHA 5HYDA 2I94A 1JWDA 1K8UA 2CXJA 5K89A 3D0YB 2SASA 1WDCC 2CTNA 2KSPA 1FF1A 4A4CA 2R2IA 3EK4A 4M2OA 1B9AA 3NSOA 2F2OA 4DIRA 1S5GY 3DF0A 3RM1A 2O5GA 3IQQA 4NDBA 1KK7Z 3CZTX 3LK0A 3VRRA 3I5IB 2CCMA 4ORCB 1NSHA 4PCWA 4HRHA 1GQMA 1TTXA 1KK8B 1B7TY 3KEVA 3JVTB 3ZWHA 1F71A 1GGZA 1V1GA 3SG6A 1SKTA 4PHJA 3BYAA 1ZUZA 1M39A 1BU3A 3TZ1A 1A03A 2ZFDA 2WCEA 3IQOA 2LANA 2KI6C 1C7WA 2GGZA 4M2PA 1SBJA 4PALA 2PALA 3QRXA 2F2PA 3ICBA 1PVAA 1PULA 2E30A 2EGDA 2NZ0A 4MVFA 4CLNA 2K0JA 4I5JA 4ZCUA 3I5FC 1DJIA 1MWNA 1SCVA 2K7BA 2KFFA 1LKJA 3VROA 1B1GA 4XJKA 2BCAA 2LUCA 5HKYA 1QJTA 1Q80A 1PALA 2KNEA 2KYCA 1TNXA 4BY5A 1L2OB 1VRKA 1XFUO 1ZMZA 4HREE 2ZN9A 2F3ZA 2F3YA 1DGUA 2KFGA 2HQWA 1CFCA 2F8PA 1OMVA 2M97A 2I7AA 4CIDA 4PE1A 3EK7A 2KQYA 2M0RA 2VRGA 5B8IB 2GV5A 3DF0B 4MBEA 4YGEB 1JF0A 1NX0A 1DJGA 1IQ3A 3LCPC 1MF8B 1KK8C 1TNPA 3EVRA 1MR8A 5I2LA 1IJ6A 2KGBC 2HPSA 1G4YR 1YR5A 2ZNEA 2JXLA 1KSMA 1CM1A 1XK4C 1KSOA 3I5HC 3JTDC 2KAVA 2Y1NA 1ZOTB 4QJ5B 1PSRA 2KQ6A 1K9UA 3CTNA 3OX5A 4PHMA 5DKNA 1WRLA 3NSLA 2TN4A 1K90D 4CPVA 1DTLA 1GJYA 1OQPA 1SY9A 4HSZA 1DJZA 4JPZB 3PALA 1BJFA 2PMYA 5CSJA 1PVBA 5AFPA 1OZOA 1PK0D 5AXIA 3SG7A 1B8CA 1SK6D 3I5GB 3D0YA 1QS7A 3D10A 1A29A 1QV1A 3OHMB 2EHBA 3TDUA 1B7TZ 2BKHB 4MN0A 2L51A 1G33A 2KAYA 3OX6A 5I8NA 4ORAB 2LM5A 4GUKA 1SL9A 4AQIA 1LINA 4YGAA 2JWWA 2LAPA 2LVKA 5FYXA 4OVNF 4GFTA 3CR2A 5HLOA 1OE9B 1JUOA 3SIBA 4MZKA 5AEQA 1LA0A 1SL7A 2L50A 2M29A 1TNQA 3KO0A 1DVIA 3PFVA 1QIVA 2RGIA 1NX2A 2Q91A 4PHNA 1J55A 1IG5A 1NP8A 1TCOB 1F54A 2LE9B 2PSRA 1DF0B 2MJWB 4NQGA 2LLSA 1K96A 1XK4A 2KDHA 1A2XA 2WCBA 2M8UA 2QPTA 1KWOB 1Y1XA 3PSRA 1ALVA 1RJVA 2O60A 1A4PA 5DKQA 4D1EA 3OP0A 1AVSA 1UUSA 2AUCA 1J1DA 1AJ4A 1CDMA 1FBVA 1UP5A 1SYMA 3I5FB 1EG3A 5I2QA 3BUMB 3WHUB 4MLWA 4TNCA 4A4BA 2G9BA 3I5GC 1XFYO 1UHIA 3O2PA 3BQ3A 2EC6C 2L4IA 4OCIA 4N1FA 5HLVA 4PE0A 2BBMA 2JULA 1CDNA 2Y4QA 5J3XA 1S36A 3SG3A 4FQOA 3WNXB 1QVIY 1W7IB 2FCEA 4YGBB 4NDCA 3GOFA 3CS1A 4JWQA 1WY9A 4MEWA 2M1KB 2M49B 1NCYA 1YUTA 3FS7A 4MSPA 1NWDA 1UHKA 1KWOC 2SCPA 1H4BA 2PASA 1ALWA 1RK9A 1GGWA 1YUSA 1CNPA 3I5HB 2LV7A 3JTDB 1KQMC 3BUNB 3TDIA 2BL0B 1CLLA 3CR4X 3HX4A 3BUOB 5CSFA 1K9KA 5CSIA 1Y1UA 4BY4A 1ZACA 1NPQA 1OMDA 1RFJA 2M9GA 2LMUA 3O6BA 2WNDA 1CB1A 1F4QA 2FCDA 2L98A 5TNCA 4N5XA 4ICBA 5HKZA 1NCZA 4E68A 4ORBB 1WRZA 2Q4UA 2MBXA 1C7VA 4PDZA 5G08A 2OTGC 3PM8A 1DGVA 5F6TA 2K7DA 2L0PA 2CT9A 1M31A 2JNXA 1RECA 4GBAA 1DT7B 4MZJA 3PLFB 3TS5C 2LVVA 3GK1A 2LVJA 1M45A 1N2DA 2BECA 2L5XB 4UPGA 1H8BA 1NX1A 2LLTA 1NYAA 2QACA 2JQ6A 2BE4A 1DF0A 3EVUA 3NSKA 1S1EA 4WQ2A 2WC8A 2ZRSA 3VRQA 3VRPA 1FI6A 3IF7A 4AOMA 3AKAA 3OB2B 1SNLA 3LLEA 1QLSA 2L2EA 4F0ZB 1K9PA 2BL0C 2G2BA 3F45A 1EL4A 1NUBA 1XFVO 2M7LA 1MHOA 2JNFA 2BCBA 2D8NA 1TOPA 1BMOA 2LCPA 2WORA 2JRFA 1F70A 4MRXA 5AANA 1KQVA 1QX7A 4GGFC 1BOCA 2JTTA 1S5GZ 2JXCA 4M2QA 4PE4A 4QJ3B 1QLKA 1SW8A 2KBMA 1QX2A 1UWOA 1RROA 1YTZC 5DKRA 2NXQA 4HRGA 1DMOA 1QXPA 1BR4B 2EC6B 2LMVA 1FW4A 1XVJA 3FWCA 2A4JA 2JZIA 4NDDA 3LK1A 4GGNA 2MLFC 2MRDA 1CLMA 1KK7Y 2K2FA 2K7OA 1S6CA 1A75B 1KFXS 1AJ5A 2M3WA 1MUXA 1HT9A 2LUXA 2M7NA 2NCOA 1TIZA 1G8IA 3DVMA 2FJUB 2NLNA 3WXAA 5AERA 1RWYA 1IKUA 1SR6C 1RTP1 3DVKA 4DUQA 1XFWO 3O78A 1JF2A 1UHJA 3GK2A 5KTYA 2F33A 2LNKA 1L7ZA 1KQMB 3OB1B 3BOWA 4JQ0D 1IH0A 1ODBA 1KFUS 1XO5A 1OMRA 2ISDA 4OR9B 5CPVA 1LXFC 1TCFA 1JFKA 3CLNA 4R1EA 1CFPA 1IGVA 2CBLA 1HQVA 2E6WA 4I5LB 2LC5A 1CDLA 1SMGA 2JPTA 2WCFA 1YX7A 1BG1A 2ZRTA 2LHIA 4YGDB 4YI8A 1S6JA 4P5OE 4AQJA 1PRWA 2HF5A 3AAKA 3VRNA 3ZNIA 3VGOA 2ZKMX 2MAZA 3FWBA 1DJYA 3SG5A 1IWQA 2AAOA 2OTGB 5KU1A 2I18A 2K8MB 1CKKA 1F55A 1QV0A 1OZSA 1NX3A 1CDPA 2JOJA 1MXEA 2KAXA 1JC2A 1NCXA 4WQ3A 4C0LA 2KHNA 4DS7A 3TS5B 3RLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA2 A;  3EKH A;  1Y1A A;  1SL8 A;  1NIW A;  3CGA A;  2AMI A;  4OKH A;  4L9M A;  1YUU A;  1WRK A;  2WOS A;  1J1E A;  1EH2 A;  5I2O A;  1S6I A;  4USL A;  1FI5 A;  3AKB A;  1X02 A;  2MHH A;  3NSI A;  2BCX A;  3EK8 A;  1CFF A;  2HQ8 A;  3TUY B;  3FIA A;  3BOW B;  2JC2 A;  1K2H A;  4C0J A;  1DJX A;  4YI9 A;  1B4C A;  1U5I A;  3C1V A;  1TNW A;  3A8R A;  1IRJ A;  4FTG A;  3SIA A;  1B8L A;  1UUR A;  4MRY A;  1FPW A;  2Y5I A;  1YUR A;  3AAJ A;  2KI4 B;  4YGC B;  1KCY A;  1AHR A;  3TDZ A;  3PN7 B;  1DJH A;  5JJG A;  2V53 A;  2CNP A;  1MQ1 A;  1R6P A;  2LVI A;  1K93 D;  1QX5 B;  1R2U A;  1S26 D;  4GAO A;  4ZCV A;  3SG4 A;  1EJ3 A;  1WLM A;  3BUX B;  5JOL A;  2KOT A;  1SRA A;  2ZND A;  3LL8 B;  4YBH B;  5D7F A;  2ZN8 A;  1A75 A;  4Q04 A;  4WRI A;  4ETO A;  2COL B;  1LA3 A;  3SJS A;  2PVB A;  1F4O A;  1KFX L;  1AK8 A;  2OS8 C;  2I2R E;  1Y0V H;  4PHK A;  2K2A A;  2KGR A;  2LP3 A;  2DOQ A;  1AP4 A;  1CLB A;  4PE7 A;  1AUI B;  1IQ5 A;  1W7J B;  1YVH A;  2K7C A;  5IBW A;  1SR6 B;  2KI6 D;  1XFZ O;  3KHE A;  1TRF A;  1EXR A;  2BKI B;  1WLZ A;  1QTX A;  3TUY C;  1PSB A;  1BLQ A;  4YRU A;  2K61 A;  1KFU L;  1ZFS A;  3HCM A;  3PAT A;  1QAT A;  2JT0 A;  1SPY A;  3KPX A;  2JT3 A;  4CFR A;  1BF5 A;  1CFD A;  3I5I C;  3EVV A;  1U5I B;  3KF9 A;  3M0W A;  1QVI Z;  2KI4 C;  4N1G A;  3PN7 C;  1N0Y A;  1V1F A;  3DVJ A;  1B8R A;  1SCM B;  2BBN A;  5PAL A;  1F8H A;  3EKJ A;  3JVT C;  4DCK A;  1J7R A;  5GQQ C;  2KBI A;  5KSZ A;  3CWG A;  2H2K A;  1DJW A;  5BPJ A;  2GGM A;  1IJ5 A;  1J7O A;  2NCP A;  1UHN A;  5D69 A;  1M46 A;  3BUW B;  1QIW A;  1XFX O;  2JU0 A;  1OSA A;  1E8A A;  2P6B B;  1CTR A;  1YVL A;  1LVC D;  2IS9 A;  1YX8 A;  4QJ4 B;  1BT6 A;  2LHL A;  3K21 A;  2H61 C;  2JT8 A;  2OPO A;  3H4S E;  1CM4 A;  1B47 A;  4CFQ A;  1BOD A;  3MSE B;  2B1U A;  4XJK B;  1N65 A;  3NXA A;  1MXL C;  3SG2 A;  1S3P A;  2HET A;  2FOT A;  5CSN A;  1L2O C;  4OV2 A;  2LLU A;  2LP2 A;  3WHT B;  1WDC B;  1EG4 A;  1CMF A;  4MZL A;  3DVE A;  3E3R A;  1OOJ A;  4U8D A;  2KFH A;  4GGF A;  4I5K A;  3A4U B;  2PRU A;  2BE6 A;  2M1U A;  1J7P A;  1JSA A;  2KYF A;  2Y1M A;  4GNK B;  1SCM C;  1JBA A;  1CMG A;  1K94 A;  2L4H A;  2JTZ A;  4IL1 A;  1BR1 B;  1YRT B;  3BXK A;  1YRU B;  1TN4 A;  5ER5 A;  1D1O A;  5HKW A;  3CR5 X;  3GK4 X;  4C0K A;  3O4Y A;  2MLE C;  1XYD A;  3DD4 A;  1K95 A;  5ER4 X;  2LMT A;  1C07 A;  1XA5 A;  4XYN A;  4DRW A;  1QAS A;  1J7Q A;  1M63 B;  4P2Y B;  2H61 A;  2OS8 B;  1JFJ A;  4I5N B;  1Y6W A;  4GPL B;  1UHH A;  5HYD A;  2I94 A;  1JWD A;  1K8U A;  2CXJ A;  5K89 A;  3D0Y B;  2SAS A;  1WDC C;  2CTN A;  2KSP A;  1FF1 A;  4A4C A;  2R2I A;  3EK4 A;  4M2O A;  1B9A A;  3NSO A;  2F2O A;  4DIR A;  1S5G Y;  3DF0 A;  3RM1 A;  2O5G A;  3IQQ A;  4NDB A;  1KK7 Z;  3CZT X;  3LK0 A;  3VRR A;  3I5I B;  2CCM A;  4ORC B;  1NSH A;  4PCW A;  4HRH A;  1GQM A;  1TTX A;  1KK8 B;  1B7T Y;  3KEV A;  3JVT B;  3ZWH A;  1F71 A;  1GGZ A;  1V1G A;  3SG6 A;  1SKT A;  4PHJ A;  3BYA A;  1ZUZ A;  1M39 A;  1BU3 A;  3TZ1 A;  1A03 A;  2ZFD A;  2WCE A;  3IQO A;  2LAN A;  2KI6 C;  1C7W A;  2GGZ A;  4M2P A;  1SBJ A;  4PAL A;  2PAL A;  3QRX A;  2F2P A;  3ICB A;  1PVA A;  1PUL A;  2E30 A;  2EGD A;  2NZ0 A;  4MVF A;  4CLN A;  2K0J A;  4I5J A;  4ZCU A;  3I5F C;  1DJI A;  1MWN A;  1SCV A;  2K7B A;  2KFF A;  1LKJ A;  3VRO A;  1B1G A;  4XJK A;  2BCA A;  2LUC A;  5HKY A;  1QJT A;  1Q80 A;  1PAL A;  2KNE A;  2KYC A;  1TNX A;  4BY5 A;  1L2O B;  1VRK A;  1XFU O;  1ZMZ A;  4HRE E;  2ZN9 A;  2F3Z A;  2F3Y A;  1DGU A;  2KFG A;  2HQW A;  1CFC A;  2F8P A;  1OMV A;  2M97 A;  2I7A A;  4CID A;  4PE1 A;  3EK7 A;  2KQY A;  2M0R A;  2VRG A;  5B8I B;  2GV5 A;  3DF0 B;  4MBE A;  4YGE B;  1JF0 A;  1NX0 A;  1DJG A;  1IQ3 A;  3LCP C;  1MF8 B;  1KK8 C;  1TNP A;  3EVR A;  1MR8 A;  5I2L A;  1IJ6 A;  2KGB C;  2HPS A;  1G4Y R;  1YR5 A;  2ZNE A;  2JXL A;  1KSM A;  1CM1 A;  1XK4 C;  1KSO A;  3I5H C;  3JTD C;  2KAV A;  2Y1N A;  1ZOT B;  4QJ5 B;  1PSR A;  2KQ6 A;  1K9U A;  3CTN A;  3OX5 A;  4PHM A;  5DKN A;  1WRL A;  3NSL A;  2TN4 A;  1K90 D;  4CPV A;  1DTL A;  1GJY A;  1OQP A;  1SY9 A;  4HSZ A;  1DJZ A;  4JPZ B;  3PAL A;  1BJF A;  2PMY A;  5CSJ A;  1PVB A;  5AFP A;  1OZO A;  1PK0 D;  5AXI A;  3SG7 A;  1B8C A;  1SK6 D;  3I5G B;  3D0Y A;  1QS7 A;  3D10 A;  1A29 A;  1QV1 A;  3OHM B;  2EHB A;  3TDU A;  1B7T Z;  2BKH B;  4MN0 A;  2L51 A;  1G33 A;  2KAY A;  3OX6 A;  5I8N A;  4ORA B;  2LM5 A;  4GUK A;  1SL9 A;  4AQI A;  1LIN A;  4YGA A;  2JWW A;  2LAP A;  2LVK A;  5FYX A;  4OVN F;  4GFT A;  3CR2 A;  5HLO A;  1OE9 B;  1JUO A;  3SIB A;  4MZK A;  5AEQ A;  1LA0 A;  1SL7 A;  2L50 A;  2M29 A;  1TNQ A;  3KO0 A;  1DVI A;  3PFV A;  1QIV A;  2RGI A;  1NX2 A;  2Q91 A;  4PHN A;  1J55 A;  1IG5 A;  1NP8 A;  1TCO B;  1F54 A;  2LE9 B;  2PSR A;  1DF0 B;  2MJW B;  4NQG A;  2LLS A;  1K96 A;  1XK4 A;  2KDH A;  1A2X A;  2WCB A;  2M8U A;  2QPT A;  1KWO B;  1Y1X A;  3PSR A;  1ALV A;  1RJV A;  2O60 A;  1A4P A;  5DKQ A;  4D1E A;  3OP0 A;  1AVS A;  1UUS A;  2AUC A;  1J1D A;  1AJ4 A;  1CDM A;  1FBV A;  1UP5 A;  1SYM A;  3I5F B;  1EG3 A;  5I2Q A;  3BUM B;  3WHU B;  4MLW A;  4TNC A;  4A4B A;  2G9B A;  3I5G C;  1XFY O;  1UHI A;  3O2P A;  3BQ3 A;  2EC6 C;  2L4I A;  4OCI A;  4N1F A;  5HLV A;  4PE0 A;  2BBM A;  2JUL A;  1CDN A;  2Y4Q A;  5J3X A;  1S36 A;  3SG3 A;  4FQO A;  3WNX B;  1QVI Y;  1W7I B;  2FCE A;  4YGB B;  4NDC A;  3GOF A;  3CS1 A;  4JWQ A;  1WY9 A;  4MEW A;  2M1K B;  2M49 B;  1NCY A;  1YUT A;  3FS7 A;  4MSP A;  1NWD A;  1UHK A;  1KWO C;  2SCP A;  1H4B A;  2PAS A;  1ALW A;  1RK9 A;  1GGW A;  1YUS A;  1CNP A;  3I5H B;  2LV7 A;  3JTD B;  1KQM C;  3BUN B;  3TDI A;  2BL0 B;  1CLL A;  3CR4 X;  3HX4 A;  3BUO B;  5CSF A;  1K9K A;  5CSI A;  1Y1U A;  4BY4 A;  1ZAC A;  1NPQ A;  1OMD A;  1RFJ A;  2M9G A;  2LMU A;  3O6B A;  2WND A;  1CB1 A;  1F4Q A;  2FCD A;  2L98 A;  5TNC A;  4N5X A;  4ICB A;  5HKZ A;  1NCZ A;  4E68 A;  4ORB B;  1WRZ A;  2Q4U A;  2MBX A;  1C7V A;  4PDZ A;  5G08 A;  2OTG C;  3PM8 A;  1DGV A;  5F6T A;  2K7D A;  2L0P A;  2CT9 A;  1M31 A;  2JNX A;  1REC A;  4GBA A;  1DT7 B;  4MZJ A;  3PLF B;  3TS5 C;  2LVV A;  3GK1 A;  2LVJ A;  1M45 A;  1N2D A;  2BEC A;  2L5X B;  4UPG A;  1H8B A;  1NX1 A;  2LLT A;  1NYA A;  2QAC A;  2JQ6 A;  2BE4 A;  1DF0 A;  3EVU A;  3NSK A;  1S1E A;  4WQ2 A;  2WC8 A;  2ZRS A;  3VRQ A;  3VRP A;  1FI6 A;  3IF7 A;  4AOM A;  3AKA A;  3OB2 B;  1SNL A;  3LLE A;  1QLS A;  2L2E A;  4F0Z B;  1K9P A;  2BL0 C;  2G2B A;  3F45 A;  1EL4 A;  1NUB A;  1XFV O;  2M7L A;  1MHO A;  2JNF A;  2BCB A;  2D8N A;  1TOP A;  1BMO A;  2LCP A;  2WOR A;  2JRF A;  1F70 A;  4MRX A;  5AAN A;  1KQV A;  1QX7 A;  4GGF C;  1BOC A;  2JTT A;  1S5G Z;  2JXC A;  4M2Q A;  4PE4 A;  4QJ3 B;  1QLK A;  1SW8 A;  2KBM A;  1QX2 A;  1UWO A;  1RRO A;  1YTZ C;  5DKR A;  2NXQ A;  4HRG A;  1DMO A;  1QXP A;  1BR4 B;  2EC6 B;  2LMV A;  1FW4 A;  1XVJ A;  3FWC A;  2A4J A;  2JZI A;  4NDD A;  3LK1 A;  4GGN A;  2MLF C;  2MRD A;  1CLM A;  1KK7 Y;  2K2F A;  2K7O A;  1S6C A;  1A75 B;  1KFX S;  1AJ5 A;  2M3W A;  1MUX A;  1HT9 A;  2LUX A;  2M7N A;  2NCO A;  1TIZ A;  1G8I A;  3DVM A;  2FJU B;  2NLN A;  3WXA A;  5AER A;  1RWY A;  1IKU A;  1SR6 C;  1RTP 1;  3DVK A;  4DUQ A;  1XFW O;  3O78 A;  1JF2 A;  1UHJ A;  3GK2 A;  5KTY A;  2F33 A;  2LNK A;  1L7Z A;  1KQM B;  3OB1 B;  3BOW A;  4JQ0 D;  1IH0 A;  1ODB A;  1KFU S;  1XO5 A;  1OMR A;  2ISD A;  4OR9 B;  5CPV A;  1LXF C;  1TCF A;  1JFK A;  3CLN A;  4R1E A;  1CFP A;  1IGV A;  2CBL A;  1HQV A;  2E6W A;  4I5L B;  2LC5 A;  1CDL A;  1SMG A;  2JPT A;  2WCF A;  1YX7 A;  1BG1 A;  2ZRT A;  2LHI A;  4YGD B;  4YI8 A;  1S6J A;  4P5O E;  4AQJ A;  1PRW A;  2HF5 A;  3AAK A;  3VRN A;  3ZNI A;  3VGO A;  2ZKM X;  2MAZ A;  3FWB A;  1DJY A;  3SG5 A;  1IWQ A;  2AAO A;  2OTG B;  5KU1 A;  2I18 A;  2K8M B;  1CKK A;  1F55 A;  1QV0 A;  1OZS A;  1NX3 A;  1CDP A;  2JOJ A;  1MXE A;  2KAX A;  1JC2 A;  1NCX A;  4WQ3 A;  4C0L A;  2KHN A;  4DS7 A;  3TS5 B;  3RLZ A; 
#chains in the Genus database with same CATH topology
 2MA2 A;  3EKH A;  1Y1A A;  1SL8 A;  1NIW A;  3CGA A;  2AMI A;  1LS8 A;  4OKH A;  3SS4 A;  1OW4 A;  4L9M A;  3OGN A;  1YUU A;  1OOI X;  1WRK A;  1J1E A;  2WOS A;  1EH2 A;  1OOH A;  5I2O A;  1S6I A;  4USL A;  2QEH A;  1FI5 A;  3AKB A;  1X02 A;  2MHH A;  3NSI A;  1TWO A;  2BCX A;  3EK8 A;  1CFF A;  2HQ8 A;  3TUY B;  3FIA A;  3BOW B;  2JC2 A;  1K2H A;  4C0J A;  1DJX A;  4YI9 A;  1B4C A;  1U5I A;  3C1V A;  1TNW A;  3A8R A;  1IRJ A;  4FTG A;  3SIA A;  1B8L A;  1UUR A;  4MRY A;  1FPW A;  3UNW A;  2Y5I A;  1YUR A;  3AAJ A;  2KI4 B;  4YGC B;  1KCY A;  1AHR A;  3TDZ A;  3PN7 B;  1DJH A;  5JJG A;  2V53 A;  2CNP A;  1MQ1 A;  1QWV A;  1R6P A;  2LVI A;  1K93 D;  1QX5 B;  1R2U A;  1S26 D;  4GAO A;  4ZCV A;  3SG4 A;  2L5Y A;  1EJ3 A;  1WLM A;  3BUX B;  3NHT A;  3SS3 A;  2WC5 A;  5JOL A;  2KOT A;  1SRA A;  2ZND A;  3LL8 B;  4YBH B;  5D7F A;  1C3Z A;  1A75 A;  2ZN8 A;  4Q04 A;  4WRI A;  4ETO A;  5HL1 A;  2COL B;  1LA3 A;  3SJS A;  3BFA A;  2PVB A;  2FJY A;  1F4O A;  1KFX L;  1AK8 A;  2OS8 C;  2I2R E;  1GM0 A;  1Y0V H;  4PHK A;  1DEK A;  2K2A A;  3D74 A;  2KGR A;  2LP3 A;  2DOQ A;  1AP4 A;  1CLB A;  4PE7 A;  1AUI B;  1IQ5 A;  1W7J B;  4JKT A;  1YVH A;  2K7C A;  5IBW A;  1SR6 B;  2KI6 D;  1XFZ O;  3FE9 A;  3KHE A;  1TRF A;  1EXR A;  2BKI B;  1ORG A;  1WLZ A;  1QTX A;  3TUY C;  1PSB A;  1BLQ A;  3B7A A;  4YRU A;  2K61 A;  1KFU L;  1ZFS A;  3HCM A;  2WCK A;  3PAT A;  1QAT A;  2JT0 A;  1SPY A;  3KPX A;  2JT3 A;  4CFR A;  1BF5 A;  1CFD A;  3I5I C;  5FI7 A;  3EVV A;  1U5I B;  3KF9 A;  3M0W A;  1QVI Z;  2KI4 C;  4N1G A;  3PN7 C;  1N0Y A;  1V1F A;  3DVJ A;  1B8R A;  1SCM B;  2BBN A;  3CYZ A;  2WCL A;  5PAL A;  3EKJ A;  3JVT C;  4DCK A;  1J7R A;  1F8H A;  5GQQ C;  2KBI A;  5KSZ A;  3CWG A;  2H2K A;  1DJW A;  3CZ1 A;  5BPJ A;  2GGM A;  1IJ5 A;  1J7O A;  2NCP A;  1UHN A;  5D69 A;  1M46 A;  3BUW B;  1QIW A;  1XFX O;  2JU0 A;  1OSA A;  1E8A A;  2PYQ A;  2P6B B;  1CTR A;  1YVL A;  1LVC D;  2IS9 A;  1YX8 A;  4QJ4 B;  1BT6 A;  2WCJ A;  2KPH A;  2LHL A;  3K21 A;  2H61 C;  2JT8 A;  2OPO A;  3H4S E;  1CM4 A;  1B47 A;  4CFQ A;  1BOD A;  2WC6 A;  3MSE B;  2B1U A;  4XJK B;  1N65 A;  3NXA A;  1MXL C;  3SG2 A;  1S3P A;  2HET A;  2FOT A;  5CSN A;  1L2O C;  4OV2 A;  2LLU A;  2LP2 A;  3WHT B;  1WDC B;  1EG4 A;  1CMF A;  4MZL A;  3DVE A;  3E3R A;  1OOJ A;  4U8D A;  2KFH A;  4GGF A;  4I5K A;  3A4U B;  2PRU A;  2BE6 A;  2M1U A;  1J7P A;  1JSA A;  2KYF A;  2Y1M A;  4GNK B;  1SCM C;  1JBA A;  1CMG A;  1K94 A;  2L4H A;  2JTZ A;  4IL1 A;  1BR1 B;  1YRT B;  3BXK A;  1YRU B;  1TN4 A;  3B6X A;  3DYE A;  5ER5 A;  1D1O A;  5HKW A;  1TUZ A;  3CR5 X;  3GK4 X;  4C0K A;  3L4L A;  2MLE C;  3O4Y A;  1XYD A;  3DD4 A;  1K95 A;  5ER4 X;  2LMT A;  1C07 A;  1XA5 A;  4XYN A;  4DRW A;  3N7H A;  1OOG A;  1QAS A;  1J7Q A;  1M63 B;  4P2Y B;  3NHI A;  2H61 A;  2OS8 B;  1JFJ A;  2QDI A;  4OZD A;  4I5N B;  1Y6W A;  4GPL B;  1UHH A;  5HYD A;  2I94 A;  1JWD A;  1K8U A;  2CXJ A;  3CZ2 A;  5K89 A;  1XFR A;  3PM2 A;  3D0Y B;  2SAS A;  3R1O A;  1WDC C;  2CTN A;  2KSP A;  1FF1 A;  4A4C A;  2R2I A;  3EK4 A;  4M2O A;  4FQT A;  1B9A A;  3NSO A;  2F2O A;  3DY9 A;  1S5G Y;  3DF0 A;  4DIR A;  3RZS A;  3RM1 A;  2O5G A;  3IQQ A;  4NDB A;  1KK7 Z;  3CZT X;  3LK0 A;  4IJ7 A;  3VRR A;  3I5I B;  2CCM A;  4ORC B;  1NSH A;  2K60 A;  4PCW A;  4HRH A;  1GQM A;  1TTX A;  1KK8 B;  3CAB A;  5FI6 A;  1B7T Y;  3KEV A;  1Z2C B;  3JVT B;  3ZWH A;  1F71 A;  1GGZ A;  1V1G A;  3SG6 A;  5DIC A;  1SKT A;  4PHJ A;  3BYA A;  1ZUZ A;  1M39 A;  1BU3 A;  3TZ1 A;  3R1V A;  2P71 A;  1A03 A;  4INX A;  1C3Y A;  2ERB A;  2ZFD A;  2WCE A;  2WCH A;  3IQO A;  2LAN A;  2KI6 C;  1C7W A;  2GGZ A;  4M2P A;  1SBJ A;  4PAL A;  2PAL A;  3QRX A;  2F2P A;  3ICB A;  1PVA A;  1PUL A;  2E30 A;  2EGD A;  2NZ0 A;  4MVF A;  4CLN A;  2K0J A;  3S0A A;  4I5J A;  4ZCU A;  3I5F C;  1DJI A;  1MWN A;  1SCV A;  2K7B A;  2KFF A;  1LKJ A;  2KLE A;  3VRO A;  1B1G A;  4XJK A;  2BCA A;  2LUC A;  2P70 A;  5HKY A;  1QJT A;  1Q80 A;  3D77 A;  1PAL A;  1DC1 A;  1DQE A;  1SSE B;  2KNE A;  1TNX A;  2KYC A;  4BY5 A;  1L2O B;  1VRK A;  1XFU O;  1ZMZ A;  4HRE E;  2ZN9 A;  2F3Z A;  2F3Y A;  2QEB A;  1DGU A;  2KFG A;  2HQW A;  1CFC A;  2F8P A;  1OMV A;  2M97 A;  2I7A A;  4CID A;  4PE1 A;  3EK7 A;  2KQY A;  2M0R A;  3D76 A;  2VRG A;  1Z4H A;  5B8I B;  2GV5 A;  3DF0 B;  4MBE A;  4YGE B;  1JF0 A;  1NX0 A;  3CDN A;  1DJG A;  1IQ3 A;  3LCP C;  1MF8 B;  1KK8 C;  1TNP A;  3EVR A;  1MR8 A;  5I2L A;  1IJ6 A;  2KGB C;  2HPS A;  1G4Y R;  1YR5 A;  2ZNE A;  2JXL A;  1KSM A;  1CM1 A;  1XK4 C;  1KSO A;  3I5H C;  3JTD C;  2KAV A;  2Y1N A;  1ZOT B;  4QJ5 B;  1PSR A;  2KQ6 A;  1K9U A;  3CTN A;  3OX5 A;  4PHM A;  5DKN A;  1WRL A;  3NSL A;  2TN4 A;  1K90 D;  3BFH A;  4CPV A;  1DTL A;  4KYN A;  1GJY A;  1OQP A;  1SY9 A;  2YGU A;  3CZ0 A;  4HSZ A;  1DJZ A;  4JPZ B;  3PAL A;  1BJF A;  1P28 A;  2PMY A;  5CSJ A;  1PVB A;  5AFP A;  1OZO A;  1PK0 D;  5AXI A;  3UO9 A;  3SG7 A;  1B8C A;  1SK6 D;  3I5G B;  3D0Y A;  1QS7 A;  3D10 A;  1A29 A;  1QV1 A;  3OHM B;  2EHB A;  3TDU A;  1B7T Z;  2BKH B;  4MN0 A;  2L51 A;  1G33 A;  2KAY A;  3OX6 A;  5I8N A;  4ORA B;  2LM5 A;  4GUK A;  1T14 A;  1SL9 A;  4AQI A;  1LIN A;  4YGA A;  2GTE A;  2JWW A;  2LAP A;  2LVK A;  5FYX A;  4OVN F;  4INW A;  4GFT A;  3CR2 A;  5HLO A;  1OE9 B;  1JUO A;  3SIB A;  4MZK A;  5AEQ A;  1LA0 A;  1SL7 A;  2L50 A;  2M29 A;  1TNQ A;  3KO0 A;  1DVI A;  3PFV A;  1QIV A;  2RGI A;  1NX2 A;  2Q91 A;  4PHN A;  1J55 A;  1IG5 A;  1NP8 A;  1TCO B;  1F54 A;  2LE9 B;  2PSR A;  1DF0 B;  2MJW B;  4NQG A;  2LLS A;  1K96 A;  1XK4 A;  2KDH A;  1A2X A;  2WCB A;  2M8U A;  2QPT A;  1KWO B;  1IIO A;  1Y1X A;  3PSR A;  1ALV A;  1RJV A;  2O60 A;  1A4P A;  5DKQ A;  4D1E A;  3OP0 A;  1AVS A;  1UUS A;  2PQL A;  3S0E A;  2AUC A;  1J1D A;  1AJ4 A;  1CDM A;  1FBV A;  1UP5 A;  1SYM A;  3I5F B;  1EG3 A;  5I2Q A;  3BUM B;  3WHU B;  4MLW A;  4TNC A;  5D3O A;  2G9B A;  4A4B A;  3I5G C;  1XFY O;  1UHI A;  3O2P A;  3BQ3 A;  3S0D A;  2EC6 C;  2L4I A;  4OCI A;  4N1F A;  5HLV A;  4PE0 A;  2BBM A;  2JUL A;  1CDN A;  2Y4Q A;  5EL2 A;  5J3X A;  1S36 A;  3SG3 A;  3S0F A;  2QEV A;  4FQO A;  3WNX B;  1QVI Y;  1W7I B;  2FCE A;  4YGB B;  4NDC A;  3GOF A;  3CS1 A;  4JWQ A;  1WY9 A;  4MEW A;  3FE6 A;  2M1K B;  2M49 B;  1NCY A;  1YUT A;  3FS7 A;  4MSP A;  1NWD A;  1UHK A;  1KWO C;  2SCP A;  1H4B A;  2KLD A;  1ALW A;  1RK9 A;  2PAS A;  1GGW A;  1YUS A;  1CNP A;  3I5H B;  2LV7 A;  3JTD B;  1KQM C;  3BUN B;  3TDI A;  2BL0 B;  1CLL A;  3CR4 X;  3HX4 A;  3BUO B;  5CSF A;  1K9K A;  5CSI A;  1Y1U A;  4BY4 A;  1ZAC A;  1NPQ A;  1OMD A;  3DXL A;  1RFJ A;  2M9G A;  1OOF A;  2LMU A;  2WND A;  3B88 A;  3O6B A;  1CB1 A;  1F4Q A;  3PJI A;  3D78 A;  3B87 A;  2FCD A;  2L98 A;  5TNC A;  4N5X A;  4ICB A;  5HKZ A;  1NCZ A;  4E68 A;  4ORB B;  1WRZ A;  2Q4U A;  2MBX A;  1C7V A;  4PDZ A;  5G08 A;  3S0G A;  2OTG C;  3PM8 A;  1DGV A;  5F6T A;  3B86 A;  2K7D A;  2L0P A;  2CT9 A;  2H8V A;  1M31 A;  2JNX A;  1REC A;  4GBA A;  1DT7 B;  4MZJ A;  3PLF B;  3TS5 C;  2LVV A;  3GK1 A;  2LVJ A;  3D73 A;  1M45 A;  1N2D A;  2BEC A;  1DEL A;  2L5X B;  4UPG A;  1H8B A;  2QEO A;  1NX1 A;  2LLT A;  1NYA A;  2QAC A;  2JQ6 A;  2BE4 A;  1DF0 A;  3EVU A;  3NSK A;  1S1E A;  4WQ2 A;  2WC8 A;  2ZRS A;  3VRQ A;  3VRP A;  1W9Z A;  1FI6 A;  3IF7 A;  4AOM A;  3AKA A;  3OB2 B;  1SNL A;  3LLE A;  1QLS A;  2L2E A;  4F0Z B;  1K9P A;  2BL0 C;  2G2B A;  3F45 A;  1EL4 A;  1NUB A;  1XFV O;  2M7L A;  1MHO A;  2JNF A;  2BCB A;  2D8N A;  1TOP A;  1BMO A;  2LCP A;  2WOR A;  2JRF A;  3O4X A;  4PT1 A;  4MRX A;  5AAN A;  3V2L A;  1F70 A;  1KQV A;  1QX7 A;  4GGF C;  1BOC A;  2JTT A;  1S5G Z;  2JXC A;  4M2Q A;  4JD9 A;  4PE4 A;  4QJ3 B;  3DZT A;  1QLK A;  2BAP A;  1SW8 A;  2KBM A;  1QX2 A;  1UWO A;  1RRO A;  1YTZ C;  5DKR A;  3BJH A;  2NXQ A;  4HRG A;  1DMO A;  1QXP A;  3Q8I A;  3S0B A;  1BR4 B;  2EC6 B;  2LMV A;  1FW4 A;  1XVJ A;  3FWC A;  2A4J A;  2JZI A;  3OBV A;  4NDD A;  3LK1 A;  4GGN A;  2MLF C;  2MRD A;  1CLM A;  1KK7 Y;  2K2F A;  2K7O A;  1S6C A;  1A75 B;  1KFX S;  1AJ5 A;  3NGV A;  2M3W A;  1MUX A;  1HT9 A;  2LUX A;  2M7N A;  2NCO A;  1TIZ A;  3FE8 A;  1G8I A;  3DVM A;  2FJU B;  2NLN A;  3IVT A;  3WXA A;  5AER A;  1RWY A;  1IKU A;  1TUJ A;  3L47 A;  1SR6 C;  5I94 A;  1RTP 1;  3DVK A;  4DUQ A;  1XFW O;  3O78 A;  3R72 A;  1JF2 A;  1UHJ A;  3BFB A;  3GK2 A;  2F33 A;  2LNK A;  3L4A A;  1L7Z A;  1KQM B;  3OB1 B;  3BOW A;  4JQ0 D;  5KTY A;  1IH0 A;  1ODB A;  1KFU S;  1XO5 A;  5FI2 A;  1OMR A;  2ISD A;  4OR9 B;  5CPV A;  1LXF C;  1TCF A;  1JFK A;  3CLN A;  4R1E A;  1CFP A;  1IGV A;  2CBL A;  1HQV A;  2E6W A;  4I5L B;  2LC5 A;  1CDL A;  1SMG A;  2JPT A;  2WCF A;  1YX7 A;  1BG1 A;  2ZRT A;  2LHI A;  4YGD B;  4YI8 A;  1S6J A;  3VB1 A;  4P5O E;  4AQJ A;  1PRW A;  2HF5 A;  3EG5 B;  3AAK A;  2L2C A;  3VRN A;  3QME A;  3ZNI A;  3VGO A;  2WCM A;  3R1P A;  2ZKM X;  3SS5 A;  2MAZ A;  3FWB A;  1DJY A;  3SG5 A;  1IWQ A;  2AAO A;  2BNX A;  2OTG B;  3D75 A;  3K1E A;  2I18 A;  2K8M B;  5KU1 A;  1CKK A;  1QV0 A;  1F55 A;  1OZS A;  1NX3 A;  2JPO A;  1CDP A;  2JOJ A;  1MXE A;  2KAX A;  1JC2 A;  1NCX A;  4WQ3 A;  4C0L A;  4F7F A;  2KHN A;  4DS7 A;  3TS5 B;  3RLZ A; 
#chains in the Genus database with same CATH homology
 2MA2 A;  3EKH A;  1Y1A A;  1SL8 A;  1NIW A;  3CGA A;  2AMI A;  4OKH A;  4L9M A;  1YUU A;  1WRK A;  2WOS A;  1J1E A;  1EH2 A;  5I2O A;  1S6I A;  4USL A;  1FI5 A;  3AKB A;  1X02 A;  2MHH A;  3NSI A;  2BCX A;  3EK8 A;  1CFF A;  2HQ8 A;  3TUY B;  3FIA A;  3BOW B;  2JC2 A;  1K2H A;  4C0J A;  1DJX A;  4YI9 A;  1B4C A;  1U5I A;  3C1V A;  1TNW A;  3A8R A;  1IRJ A;  4FTG A;  3SIA A;  1B8L A;  1UUR A;  4MRY A;  1FPW A;  2Y5I A;  1YUR A;  3AAJ A;  2KI4 B;  4YGC B;  1KCY A;  1AHR A;  3TDZ A;  3PN7 B;  1DJH A;  5JJG A;  2V53 A;  2CNP A;  1MQ1 A;  1R6P A;  2LVI A;  1K93 D;  1QX5 B;  1R2U A;  1S26 D;  4GAO A;  4ZCV A;  3SG4 A;  1EJ3 A;  1WLM A;  3BUX B;  5JOL A;  2KOT A;  1SRA A;  2ZND A;  3LL8 B;  4YBH B;  5D7F A;  2ZN8 A;  1A75 A;  4Q04 A;  4WRI A;  4ETO A;  2COL B;  1LA3 A;  3SJS A;  2PVB A;  1F4O A;  1KFX L;  1AK8 A;  2OS8 C;  2I2R E;  1Y0V H;  4PHK A;  2K2A A;  2KGR A;  2LP3 A;  2DOQ A;  1AP4 A;  1CLB A;  4PE7 A;  1AUI B;  1IQ5 A;  1W7J B;  1YVH A;  2K7C A;  5IBW A;  1SR6 B;  2KI6 D;  1XFZ O;  3KHE A;  1TRF A;  1EXR A;  2BKI B;  1WLZ A;  1QTX A;  3TUY C;  1PSB A;  1BLQ A;  4YRU A;  2K61 A;  1KFU L;  1ZFS A;  3HCM A;  3PAT A;  1QAT A;  2JT0 A;  1SPY A;  3KPX A;  2JT3 A;  4CFR A;  1BF5 A;  1CFD A;  3I5I C;  3EVV A;  1U5I B;  3KF9 A;  3M0W A;  1QVI Z;  2KI4 C;  4N1G A;  3PN7 C;  1N0Y A;  1V1F A;  3DVJ A;  1B8R A;  1SCM B;  2BBN A;  5PAL A;  1F8H A;  3EKJ A;  3JVT C;  4DCK A;  1J7R A;  5GQQ C;  2KBI A;  5KSZ A;  3CWG A;  2H2K A;  1DJW A;  5BPJ A;  2GGM A;  1IJ5 A;  1J7O A;  2NCP A;  1UHN A;  5D69 A;  1M46 A;  3BUW B;  1QIW A;  1XFX O;  2JU0 A;  1OSA A;  1E8A A;  2P6B B;  1CTR A;  1YVL A;  1LVC D;  2IS9 A;  1YX8 A;  4QJ4 B;  1BT6 A;  2LHL A;  3K21 A;  2H61 C;  2JT8 A;  2OPO A;  3H4S E;  1CM4 A;  1B47 A;  4CFQ A;  1BOD A;  3MSE B;  2B1U A;  4XJK B;  1N65 A;  3NXA A;  1MXL C;  3SG2 A;  1S3P A;  2HET A;  2FOT A;  5CSN A;  1L2O C;  4OV2 A;  2LLU A;  2LP2 A;  3WHT B;  1WDC B;  1EG4 A;  1CMF A;  4MZL A;  3DVE A;  3E3R A;  1OOJ A;  4U8D A;  2KFH A;  4GGF A;  4I5K A;  3A4U B;  2PRU A;  2BE6 A;  2M1U A;  1J7P A;  1JSA A;  2KYF A;  2Y1M A;  4GNK B;  1SCM C;  1JBA A;  1CMG A;  1K94 A;  2L4H A;  2JTZ A;  4IL1 A;  1BR1 B;  1YRT B;  3BXK A;  1YRU B;  1TN4 A;  5ER5 A;  1D1O A;  5HKW A;  3CR5 X;  3GK4 X;  4C0K A;  3O4Y A;  2MLE C;  1XYD A;  3DD4 A;  1K95 A;  5ER4 X;  2LMT A;  1C07 A;  1XA5 A;  4XYN A;  4DRW A;  1QAS A;  1J7Q A;  1M63 B;  4P2Y B;  2H61 A;  2OS8 B;  1JFJ A;  4I5N B;  1Y6W A;  4GPL B;  1UHH A;  5HYD A;  2I94 A;  1JWD A;  1K8U A;  2CXJ A;  5K89 A;  3D0Y B;  2SAS A;  1WDC C;  2CTN A;  2KSP A;  1FF1 A;  4A4C A;  2R2I A;  3EK4 A;  4M2O A;  1B9A A;  3NSO A;  2F2O A;  4DIR A;  1S5G Y;  3DF0 A;  3RM1 A;  2O5G A;  3IQQ A;  4NDB A;  1KK7 Z;  3CZT X;  3LK0 A;  3VRR A;  3I5I B;  2CCM A;  4ORC B;  1NSH A;  4PCW A;  4HRH A;  1GQM A;  1TTX A;  1KK8 B;  1B7T Y;  3KEV A;  3JVT B;  3ZWH A;  1F71 A;  1GGZ A;  1V1G A;  3SG6 A;  1SKT A;  4PHJ A;  3BYA A;  1ZUZ A;  1M39 A;  1BU3 A;  3TZ1 A;  1A03 A;  2ZFD A;  2WCE A;  3IQO A;  2LAN A;  2KI6 C;  1C7W A;  2GGZ A;  4M2P A;  1SBJ A;  4PAL A;  2PAL A;  3QRX A;  2F2P A;  3ICB A;  1PVA A;  1PUL A;  2E30 A;  2EGD A;  2NZ0 A;  4MVF A;  4CLN A;  2K0J A;  4I5J A;  4ZCU A;  3I5F C;  1DJI A;  1MWN A;  1SCV A;  2K7B A;  2KFF A;  1LKJ A;  3VRO A;  1B1G A;  4XJK A;  2BCA A;  2LUC A;  5HKY A;  1QJT A;  1Q80 A;  1PAL A;  2KNE A;  2KYC A;  1TNX A;  4BY5 A;  1L2O B;  1VRK A;  1XFU O;  1ZMZ A;  4HRE E;  2ZN9 A;  2F3Z A;  2F3Y A;  1DGU A;  2KFG A;  2HQW A;  1CFC A;  2F8P A;  1OMV A;  2M97 A;  2I7A A;  4CID A;  4PE1 A;  3EK7 A;  2KQY A;  2M0R A;  2VRG A;  5B8I B;  2GV5 A;  3DF0 B;  4MBE A;  4YGE B;  1JF0 A;  1NX0 A;  1DJG A;  1IQ3 A;  3LCP C;  1MF8 B;  1KK8 C;  1TNP A;  3EVR A;  1MR8 A;  5I2L A;  1IJ6 A;  2KGB C;  2HPS A;  1G4Y R;  1YR5 A;  2ZNE A;  2JXL A;  1KSM A;  1CM1 A;  1XK4 C;  1KSO A;  3I5H C;  3JTD C;  2KAV A;  2Y1N A;  1ZOT B;  4QJ5 B;  1PSR A;  2KQ6 A;  1K9U A;  3CTN A;  3OX5 A;  4PHM A;  5DKN A;  1WRL A;  3NSL A;  2TN4 A;  1K90 D;  4CPV A;  1DTL A;  1GJY A;  1OQP A;  1SY9 A;  4HSZ A;  1DJZ A;  4JPZ B;  3PAL A;  1BJF A;  2PMY A;  5CSJ A;  1PVB A;  5AFP A;  1OZO A;  1PK0 D;  5AXI A;  3SG7 A;  1B8C A;  1SK6 D;  3I5G B;  3D0Y A;  1QS7 A;  3D10 A;  1A29 A;  1QV1 A;  3OHM B;  2EHB A;  3TDU A;  1B7T Z;  2BKH B;  4MN0 A;  2L51 A;  1G33 A;  2KAY A;  3OX6 A;  5I8N A;  4ORA B;  2LM5 A;  4GUK A;  1SL9 A;  4AQI A;  1LIN A;  4YGA A;  2JWW A;  2LAP A;  2LVK A;  5FYX A;  4OVN F;  4GFT A;  3CR2 A;  5HLO A;  1OE9 B;  1JUO A;  3SIB A;  4MZK A;  5AEQ A;  1LA0 A;  1SL7 A;  2L50 A;  2M29 A;  1TNQ A;  3KO0 A;  1DVI A;  3PFV A;  1QIV A;  2RGI A;  1NX2 A;  2Q91 A;  4PHN A;  1J55 A;  1IG5 A;  1NP8 A;  1TCO B;  1F54 A;  2LE9 B;  2PSR A;  1DF0 B;  2MJW B;  4NQG A;  2LLS A;  1K96 A;  1XK4 A;  2KDH A;  1A2X A;  2WCB A;  2M8U A;  2QPT A;  1KWO B;  1Y1X A;  3PSR A;  1ALV A;  1RJV A;  2O60 A;  1A4P A;  5DKQ A;  4D1E A;  3OP0 A;  1AVS A;  1UUS A;  2AUC A;  1J1D A;  1AJ4 A;  1CDM A;  1FBV A;  1UP5 A;  1SYM A;  3I5F B;  1EG3 A;  5I2Q A;  3BUM B;  3WHU B;  4MLW A;  4TNC A;  4A4B A;  2G9B A;  3I5G C;  1XFY O;  1UHI A;  3O2P A;  3BQ3 A;  2EC6 C;  2L4I A;  4OCI A;  4N1F A;  5HLV A;  4PE0 A;  2BBM A;  2JUL A;  1CDN A;  2Y4Q A;  5J3X A;  1S36 A;  3SG3 A;  4FQO A;  3WNX B;  1QVI Y;  1W7I B;  2FCE A;  4YGB B;  4NDC A;  3GOF A;  3CS1 A;  4JWQ A;  1WY9 A;  4MEW A;  2M1K B;  2M49 B;  1NCY A;  1YUT A;  3FS7 A;  4MSP A;  1NWD A;  1UHK A;  1KWO C;  2SCP A;  1H4B A;  2PAS A;  1ALW A;  1RK9 A;  1GGW A;  1YUS A;  1CNP A;  3I5H B;  2LV7 A;  3JTD B;  1KQM C;  3BUN B;  3TDI A;  2BL0 B;  1CLL A;  3CR4 X;  3HX4 A;  3BUO B;  5CSF A;  1K9K A;  5CSI A;  1Y1U A;  4BY4 A;  1ZAC A;  1NPQ A;  1OMD A;  1RFJ A;  2M9G A;  2LMU A;  3O6B A;  2WND A;  1CB1 A;  1F4Q A;  2FCD A;  2L98 A;  5TNC A;  4N5X A;  4ICB A;  5HKZ A;  1NCZ A;  4E68 A;  4ORB B;  1WRZ A;  2Q4U A;  2MBX A;  1C7V A;  4PDZ A;  5G08 A;  2OTG C;  3PM8 A;  1DGV A;  5F6T A;  2K7D A;  2L0P A;  2CT9 A;  1M31 A;  2JNX A;  1REC A;  4GBA A;  1DT7 B;  4MZJ A;  3PLF B;  3TS5 C;  2LVV A;  3GK1 A;  2LVJ A;  1M45 A;  1N2D A;  2BEC A;  2L5X B;  4UPG A;  1H8B A;  1NX1 A;  2LLT A;  1NYA A;  2QAC A;  2JQ6 A;  2BE4 A;  1DF0 A;  3EVU A;  3NSK A;  1S1E A;  4WQ2 A;  2WC8 A;  2ZRS A;  3VRQ A;  3VRP A;  1FI6 A;  3IF7 A;  4AOM A;  3AKA A;  3OB2 B;  1SNL A;  3LLE A;  1QLS A;  2L2E A;  4F0Z B;  1K9P A;  2BL0 C;  2G2B A;  3F45 A;  1EL4 A;  1NUB A;  1XFV O;  2M7L A;  1MHO A;  2JNF A;  2BCB A;  2D8N A;  1TOP A;  1BMO A;  2LCP A;  2WOR A;  2JRF A;  1F70 A;  4MRX A;  5AAN A;  1KQV A;  1QX7 A;  4GGF C;  1BOC A;  2JTT A;  1S5G Z;  2JXC A;  4M2Q A;  4PE4 A;  4QJ3 B;  1QLK A;  1SW8 A;  2KBM A;  1QX2 A;  1UWO A;  1RRO A;  1YTZ C;  5DKR A;  2NXQ A;  4HRG A;  1DMO A;  1QXP A;  1BR4 B;  2EC6 B;  2LMV A;  1FW4 A;  1XVJ A;  3FWC A;  2A4J A;  2JZI A;  4NDD A;  3LK1 A;  4GGN A;  2MLF C;  2MRD A;  1CLM A;  1KK7 Y;  2K2F A;  2K7O A;  1S6C A;  1A75 B;  1KFX S;  1AJ5 A;  2M3W A;  1MUX A;  1HT9 A;  2LUX A;  2M7N A;  2NCO A;  1TIZ A;  1G8I A;  3DVM A;  2FJU B;  2NLN A;  3WXA A;  5AER A;  1RWY A;  1IKU A;  1SR6 C;  1RTP 1;  3DVK A;  4DUQ A;  1XFW O;  3O78 A;  1JF2 A;  1UHJ A;  3GK2 A;  5KTY A;  2F33 A;  2LNK A;  1L7Z A;  1KQM B;  3OB1 B;  3BOW A;  4JQ0 D;  1IH0 A;  1ODB A;  1KFU S;  1XO5 A;  1OMR A;  2ISD A;  4OR9 B;  5CPV A;  1LXF C;  1TCF A;  1JFK A;  3CLN A;  4R1E A;  1CFP A;  1IGV A;  2CBL A;  1HQV A;  2E6W A;  4I5L B;  2LC5 A;  1CDL A;  1SMG A;  2JPT A;  2WCF A;  1YX7 A;  1BG1 A;  2ZRT A;  2LHI A;  4YGD B;  4YI8 A;  1S6J A;  4P5O E;  4AQJ A;  1PRW A;  2HF5 A;  3AAK A;  3VRN A;  3ZNI A;  3VGO A;  2ZKM X;  2MAZ A;  3FWB A;  1DJY A;  3SG5 A;  1IWQ A;  2AAO A;  2OTG B;  5KU1 A;  2I18 A;  2K8M B;  1CKK A;  1F55 A;  1QV0 A;  1OZS A;  1NX3 A;  1CDP A;  2JOJ A;  1MXE A;  2KAX A;  1JC2 A;  1NCX A;  4WQ3 A;  4C0L A;  2KHN A;  4DS7 A;  3TS5 B;  3RLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...