1B4CA

Solution structure of rat apo-s100b using dipolar couplings
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords PROTEIN (S-100 PROTEIN, BETA CHAIN)
publication title The use of dipolar couplings for determining the solution structure of rat apo-S100B(betabeta).
pubmed rcsb
source organism Rattus norvegicus
total genus 24
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1b4cA00
2GGZA 2I94A 4MRXA 3BUWB 2EC6C 1SCMC 3I5IC 3K21A 1ZACA 3OHMB 1IG5A 1JUOA 1CFCA 2MAZA 2KI4C 4ICBA 1R6PA 1HQVA 2OS8B 2WC8A 4I5NB 1S6IA 1SL8A 4HREE 3DVJA 4MSPA 5AANA 1TRFA 1YRTB 2RGIA 4GGFC 1YUUA 3PM8A 4PCWA 2HQ8A 3VRPA 3O4YA 1BG1A 2F3ZA 1DT7B 1BLQA 1DJYA 3VROA 1NP8A 2KQYA 1TNPA 5G08A 1BJFA 1FPWA 4PHJA 2K2FA 2L51A 1QLSA 1X02A 1WRLA 2LANA 3NSKA 1DJHA 1AK8A 1JSAA 4PE7A 1ODBA 3DF0A 4N5XA 1MF8B 1K2HA 2JQ6A 1YX7A 1KWOB 1Y1AA 5KSZA 3BUOB 1OZOA 1BU3A 3VRQA 1NUBA 3TS5B 1DGVA 1YVLA 1XK4C 1OMRA 4DS7A 2L5XB 3LCPC 2K8MB 1LINA 4WRIA 2MBXA 2NZ0A 2LVKA 4WQ3A 4OCIA 1OQPA 1K93D 1S36A 3CR4X 4CLNA 1WRKA 2E30A 2K7DA 2KSPA 3AAKA 3QRXA 3WHTB 1FI6A 2SCPA 1QASA 4DCKA 3CR2A 3SJSA 1M46A 2AUCA 4MZLA 2BBMA 2JXLA 2A4JA 4ZCUA 1EG4A 2FCEA 3OX5A 3FWBA 3O6BA 1JC2A 3E3RA 3RLZA 3IQOA 4JPZB 3SIAA 4OKHA 2M1KB 2DOQA 2PMYA 5GQQC 2CTNA 1S3PA 4CFRA 1QATA 2BECA 3EKHA 1SL9A 1CTRA 1KQVA 1G4YR 1B8CA 4C0KA 4I5LB 1KK8C 1GGWA 3SG3A 3EK4A 3VGOA 1M63B 1RJVA 4ORCB 1IQ5A 1NCZA 1F70A 1XFZO 2JZIA 1BR1B 2KFFA 3LK1A 4GPLB 4N1FA 2L2EA 1KFXL 1WLMA 2LMUA 3OX6A 1LVCD 2LUCA 2FCDA 3TDZA 2KYFA 2LMTA 1DF0B 2R2IA 2K7BA 1PRWA 1SY9A 1QIWA 1DTLA 1CKKA 3NSLA 4PHKA 1KFUL 1S1EA 4YBHB 3I5FC 1S5GY 3PN7C 3MSEB 2MRDA 3CLNA 5HLOA 2OTGC 2AMIA 1OMDA 1OE9B 1LA3A 2Q91A 3NSIA 3KPXA 2JOJA 1OOJA 2M0RA 1PK0D 1XFVO 5CSNA 2PVBA 4MBEA 4A4CA 1KFUS 1UP5A 4HRGA 1JWDA 1XO5A 3AKAA 1NWDA 2L50A 3BOWA 3O2PA 1MHOA 1BT6A 5K89A 2BCXA 1AUIB 3ZNIA 1XYDA 2LM5A 2M7LA 2O5GA 1B1GA 4QJ3B 1QX5B 1CNPA 5DKRA 2JRFA 4NQGA 5HKZA 1IH0A 4PDZA 1IRJA 2Y4QA 1SK6D 4MVFA 5HYDA 3OB2B 3I5HC 1K9KA 2MHHA 2NXQA 1UURA 2Y1MA 2HETA 1QTXA 2LMVA 3OB1B 2LLTA 1GQMA 3BXKA 5F6TA 2ZRSA 1L2OC 3SG2A 3DVEA 3HX4A 1NX2A 1F4QA 1YURA 3D10A 3WHUB 1CB1A 1M31A 4U8DA 1CDLA 1DF0A 1XFWO 4I5KA 2KGBC 4F0ZB 1JFJA 3JVTC 5HLVA 1UHHA 2O60A 4JWQA 2JNFA 1UUSA 2M9GA 1SBJA 5BPJA 4E68A 1EJ3A 1KSOA 2L4HA 1SR6C 2JT8A 4I5JA 3BUMB 1RWYA 2LP2A 3ICBA 5CSIA 2LHLA 2K61A 1TOPA 1QJTA 3PALA 5TNCA 1BOCA 3A4UB 1B8LA 3TZ1A 1IGVA 3GOFA 3I5FB 2F33A 3PN7B 2F2PA 5I2LA 4DRWA 5PALA 1OMVA 3IQQA 2KAYA 3KF9A 1WDCB 2WNDA 1NYAA 2JWWA 1AJ4A 4GFTA 2NCOA 1PVBA 2AAOA 3GK1A 1RFJA 4HRHA 5AERA 1WY9A 1NPQA 2I2RE 2SASA 1C7VA 3AAJA 3EVVA 1PALA 3I5GB 4OR9B 3LL8B 4AOMA 2BE6A 2Y5IA 2ZN9A 4GAOA 4CFQA 1DJXA 3JTDC 1EH2A 4ORAB 2MJWB 1UHNA 2LVIA 1FBVA 5KU1A 5DKNA 1UHIA 2FOTA 3KEVA 3KO0A 1KQMC 2JXCA 3TUYC 3D0YB 2E6WA 1IWQA 4GNKB 4NDCA 4YGBB 1F8HA 2WCEA 1XVJA 4P5OE 2PRUA 4M2OA 1J55A 2EC6B 1LA0A 1SCMB 3A8RA 2CCMA 3BUXB 3I5IB 4PALA 3CZTX 2JC2A 1UHKA 1A4PA 1NCYA 2JT0A 1N0YA 1TNWA 2KNEA 1YR5A 4M2PA 4MEWA 1KSMA 2KI4B 1XFUO 1SRAA 1J7OA 1SL7A 2CT9A 3JVTB 4QJ5B 1N2DA 1ZMZA 4C0LA 3BQ3A 1V1GA 1JF0A 1ALVA 1DJGA 4GGNA 1ALWA 1MWNA 4P2YB 1CLBA 1S6JA 2F3YA 1BODA 2VRGA 4M2QA 1E8AA 1K9PA 1PVAA 1Y6WA 2JTTA 4A4BA 4FTGA 1SR6B 2KFGA 1DGUA 4OVNF 4XJKB 1LKJA 1IQ3A 1CFPA 3WXAA 2I7AA 1Y0VH 2H2KA 2WOSA 1K95A 2V53A 5FYXA 1DVIA 4ZCVA 4OV2A 1DJZA 1OZSA 1SPYA 2F8PA 3SG6A 1GJYA 2K2AA 5HKWA 1S5GZ 1A75B 2LNKA 3PATA 1IKUA 1JF2A 4USLA 3EKJA 1KFXS 1TTXA 1FF1A 3TDUA 3FWCA 3DD4A 3PFVA 2ZNDA 1B7TZ 1B7TY 2BKHB 1K8UA 1TNXA 1AP4A 1N65A 1NSHA 2KQ6A 2B1UA 3DVMA 1BR4B 3ZWHA 1GGZA 2CNPA 1AVSA 3CS1A 1MUXA 3GK4X 3KHEA 2F2OA 2K0JA 3D0YA 1NCXA 1QV0A 2I18A 2LVJA 1JBAA 2K7OA 3EK8A 2NCPA 2WCBA 1EL4A 3OP0A 4BY5A 4YGAA 1W7IB 1MXEA 1TCFA 3M0WA 1PSBA 1A29A 1R2UA 2FJUB 1CDNA 3WNXB 2HF5A 3TDIA 2M97A 2BBNA 1KCYA 3F45A 3TS5C 1DJWA 2KI6C 1SW8A 3CGAA 2MLEC 4GGFA 1QVIZ 1QVIY 1IJ5A 2QACA 3DVKA 2WORA 2HQWA 4YI8A 1L7ZA 1U5IB 1KK8B 1SNLA 1RK9A 1RROA 2LV7A 1JFKA 5ER5A 4PE4A 1W7JB 1Y1XA 4GBAA 1CM4A 2BE4A 2KBMA 3NXAA 2M29A 1TIZA 3VRRA 4PHNA 1HT9A 1CMFA 2OPOA 1C7WA 1CFDA 1F4OA 1KK7Y 1A75A 1NX1A 1CMGA 1DMOA 4ORBB 2COLB 1XA5A 5HKYA 4MZJA 3SG5A 4D1EA 1XK4A 2M3WA 2LAPA 4YI9A 1UWOA 1WLZA 3PSRA 1H8BA 1K90D 1SCVA 1K9UA 5I2QA 2OTGB 4QJ4B 4JQ0D 3CR5X 1D1OA 1NIWA 4WQ2A 4R1EA 2ZN8A 5D69A 2M7NA 4AQIA 4PE1A 1V1FA 3BYAA 3NSOA 1J1DA 5CSJA 1SMGA 1YX8A 2LCPA 4CPVA 2BL0C 2EGDA 3IF7A 2KDHA 1F71A 1MQ1A 1IJ6A 2WCFA 1FW4A 3BUNB 1ZFSA 1Y1UA 2PSRA 2ZKMX 1H4BA 5ER4X 1YUSA 2H61A 2NLNA 1S6CA 1A2XA 1F55A 2JTZA 3LLEA 2IS9A 1TCOB 4NDDA 2EHBA 4YRUA 2JPTA 1U5IA 2JULA 2Y1NA 4PHMA 2P6BB 1A03A 1YVHA 2BCAA 3LK0A 1M39A 2KBIA 3I5HB 5AFPA 1QIVA 3AKBA 4NDBA 2JT3A 1CLMA 1QXPA 1SYMA 1SKTA 2MLFC 4XYNA 1L2OB 1K94A 1J7RA 5CSFA 1EXRA 1QX2A 4YGDB 2ISDA 2JU0A 1B4CA 4MN0A 3SIBA 4DUQA 4L9MA 5KTYA 1YRUB 4YGCB 1Q80A 2JNXA 1MXLC 2BKIB 4Q04A 2LVVA 4MZKA 1G8IA 1NX3A 1YTZC 2ZFDA 1NX0A 5I2OA 1QX7A 3FIAA 2KYCA 3EVUA 1F54A 4HSZA 4GUKA 3BOWB 1YUTA 4UPGA 4ETOA 5I8NA 2LLSA 1DJIA 1XFYO 2KAVA 2LHIA 1OSAA 5JJGA 2GV5A 2QPTA 2H61C 2LE9B 2KI6D 2LC5A 1PSRA 3VRNA 4C0JA 1ZUZA 3GK2A 4IL1A 4DIRA 1CDMA 4AQJA 1LXFC 2M1UA 1AJ5A 1RECA 3RM1A 1AHRA 1J1EA 4FQOA 2OS8C 5DKQA 1CM1A 3SG4A 1TNQA 2TN4A 4MLWA 3H4SE 1RTP1 2BL0B 4BY4A 2MA2A 4N1GA 1XFXO 2CXJA 1C07A 2KOTA 1MR8A 5JOLA 1UHJA 1EG3A 3JTDB 1BF5A 2L4IA 2LP3A 2ZNEA 3PLFB 5D7FA 2L98A 2LLUA 1PULA 3CTNA 1ZOTB 1KQMB 2M8UA 3TUYB 1WDCC 2PALA 3CWGA 1M45A 1KWOC 1QLKA 1B47A 1VRKA 2Q4UA 1J7QA 2HPSA 2ZRTA 3FS7A 1CDPA 5AXIA 1CLLA 2KHNA 1CFFA 4PE0A 4TNCA 2L0PA 3DF0B 3EK7A 1J7PA 2G2BA 3EVRA 3I5GC 4CIDA 1TN4A 4XJKA 1QS7A 5B8IB 2KGRA 1FI5A 2GGMA 2D8NA 3C1VA 5IBWA 4YGEB 3SG7A 1BMOA 1B9AA 1QV1A 2K7CA 2LUXA 2M49B 5CPVA 1KK7Z 4MRYA 5J3XA 2BCBA 1S26D 5AEQA 3HCMA 1G33A 2PASA 2KAXA 3O78A 2G9BA 2CBLA 1K96A 2KFHA 1WRZA 1B8RA
chains in the Genus database with same CATH superfamily
2GGZA 3NHTA 2I94A 4MRXA 3BUWB 2BNXA 1SCMC 2EC6C 3I5IC 1ZACA 3K21A 3N7HA 3OHMB 1IG5A 1JUOA 1CFCA 2MAZA 2KI4C 4ICBA 1R6PA 1HQVA 2OS8B 2WC8A 4I5NB 1S6IA 4PT1A 3OBVA 3S0EA 3DXLA 1SL8A 1Z4HA 3DVJA 4HREE 5FI2A 3D74A 4MSPA 5AANA 1TRFA 1YRTB 2RGIA 4GGFC 1YUUA 3PM8A 4FQTA 2HQ8A 4PCWA 3VRPA 3O4YA 1BG1A 2F3ZA 4JKTA 1DT7B 1BLQA 1DJYA 3VROA 1NP8A 2KQYA 1TNPA 5G08A 1BJFA 1FPWA 4PHJA 2K2FA 2L51A 1QLSA 1X02A 3B88A 1WRLA 2LANA 3NSKA 1DJHA 1AK8A 1JSAA 4PE7A 1ODBA 3DF0A 4N5XA 1MF8B 1K2HA 2JQ6A 4OZDA 1YX7A 1KWOB 1Y1AA 5KSZA 3BUOB 1OZOA 1BU3A 3VRQA 1NUBA 3TS5B 1DGVA 2WCMA 1YVLA 1XK4C 1OMRA 4DS7A 2L5XB 3LCPC 2K8MB 1LINA 4WRIA 2MBXA 2NZ0A 3BFHA 1OOFA 2LVKA 4WQ3A 4OCIA 1OQPA 1K93D 1S36A 3CR4X 3OGNA 1WRKA 4CLNA 2E30A 2K7DA 2KSPA 3AAKA 3QRXA 3WHTB 1FI6A 2SCPA 1QASA 4DCKA 3CR2A 3SJSA 1M46A 2AUCA 3CZ0A 3NGVA 2WCKA 2BBMA 2JXLA 4MZLA 2A4JA 3B7AA 1EG4A 2FCEA 4ZCUA 3OX5A 3FWBA 3O6BA 1JC2A 3E3RA 3RLZA 1TUZA 3IQOA 4JPZB 3SIAA 4OKHA 2M1KB 2DOQA 2PMYA 3Q8IA 5GQQC 2CTNA 1S3PA 4CFRA 1QATA 2BECA 3EKHA 1SL9A 1CTRA 1KQVA 5HL1A 3CZ1A 1G4YR 1B8CA 2KLDA 4C0KA 4I5LB 1KK8C 1GGWA 3SG3A 3EK4A 2WCHA 1M63B 3VGOA 1RJVA 4ORCB 1IQ5A 1NCZA 1F70A 1XFZO 2JZIA 1BR1B 2KFFA 3LK1A 4GPLB 4N1FA 2L2EA 1KFXL 1WLMA 2LMUA 3OX6A 1LVCD 2LUCA 2FCDA 3TDZA 2KYFA 2LMTA 1DF0B 2R2IA 2K7BA 3D75A 1PRWA 1SY9A 1QIWA 1DTLA 1CKKA 3NSLA 2L5YA 4PHKA 3RZSA 1KFUL 1S1EA 4YBHB 3I5FC 1S5GY 5FI7A 3PN7C 3BFAA 3MSEB 2MRDA 3CLNA 5HLOA 2OTGC 2AMIA 1OMDA 1OE9B 2WC6A 1LA3A 2Q91A 3NSIA 3KPXA 2JOJA 2YGUA 3R72A 1OOJA 2M0RA 1PK0D 1XFVO 5CSNA 2GTEA 2PVBA 4MBEA 4A4CA 1KFUS 1UP5A 4HRGA 1JWDA 1XO5A 3AKAA 1NWDA 2L50A 2FJYA 3BOWA 1MHOA 1BT6A 3O2PA 5K89A 2BCXA 1AUIB 3ZNIA 1XYDA 2LM5A 2M7LA 2O5GA 1B1GA 4QJ3B 1QX5B 1CNPA 2L2CA 5DKRA 2JRFA 4NQGA 5HKZA 1IH0A 4PDZA 1IRJA 1DC1A 2Y4QA 1SK6D 3DZTA 4MVFA 5HYDA 3OB2B 3I5HC 1K9KA 2MHHA 2NXQA 1UURA 1C3ZA 2HETA 1QTXA 2LMVA 2Y1MA 3OB1B 3L4LA 2LLTA 1GQMA 3BXKA 5F6TA 2ZRSA 1L2OC 3SG2A 3DVEA 3HX4A 1NX2A 1F4QA 1YURA 3D10A 3WHUB 1CB1A 1M31A 4U8DA 1CDLA 1DF0A 1XFWO 4I5KA 2KGBC 3PJIA 4F0ZB 1JFJA 3JVTC 5HLVA 3V2LA 1UHHA 2O60A 4JWQA 2JNFA 5EL2A 1UUSA 2M9GA 1SBJA 5BPJA 4E68A 1EJ3A 1KSOA 2L4HA 2JPOA 1SR6C 2JT8A 4I5JA 3BUMB 1RWYA 2LP2A 3ICBA 5CSIA 2LHLA 2K61A 1TOPA 1QJTA 3PALA 5TNCA 1BOCA 3A4UB 1B8LA 1ORGA 3TZ1A 1IGVA 3GOFA 3I5FB 2F33A 3PN7B 2F2PA 5I2LA 2QEOA 4DRWA 5PALA 1OMVA 3IQQA 2KAYA 3KF9A 1WDCB 2WNDA 1NYAA 2JWWA 1AJ4A 3CYZA 2WCJA 4GFTA 2NCOA 1PVBA 2AAOA 3GK1A 1RFJA 4HRHA 5AERA 1WY9A 1NPQA 2I2RE 2QEBA 2SASA 1C7VA 3AAJA 2PYQA 1TUJA 3EVVA 1PALA 3I5GB 4OR9B 3LL8B 4AOMA 2BE6A 2Y5IA 3O4XA 2ZN9A 4GAOA 4CFQA 1DJXA 3JTDC 1EH2A 4ORAB 2MJWB 1UHNA 2LVIA 1FBVA 5KU1A 5DKNA 1UHIA 1IIOA 2FOTA 3KEVA 3KO0A 1KQMC 1OW4A 2JXCA 3TUYC 3D0YB 3D78A 2E6WA 1IWQA 1OOHA 4GNKB 4NDCA 4YGBB 1F8HA 2WCEA 1XVJA 4P5OE 2PRUA 4M2OA 1J55A 2EC6B 1LA0A 1SCMB 3A8RA 2CCMA 3BUXB 3I5IB 4PALA 5D3OA 3CZTX 2JC2A 1UHKA 1A4PA 1NCYA 2JT0A 1N0YA 1TNWA 2KNEA 1YR5A 3R1OA 4M2PA 1KSMA 1P28A 1XFUO 1SRAA 2KI4B 1J7OA 1SL7A 2CT9A 3JVTB 4QJ5B 1N2DA 1ZMZA 4C0LA 3BQ3A 1V1GA 1JF0A 1ALVA 1DJGA 4GGNA 1ALWA 1MWNA 3B6XA 4P2YB 1CLBA 1S6JA 2F3YA 1BODA 2VRGA 4M2QA 1E8AA 1K9PA 1PVAA 1Y6WA 2JTTA 3CDNA 4A4BA 4FTGA 4KYNA 1SR6B 2KFGA 1DGUA 4OVNF 4XJKB 1OOGA 1LKJA 1IQ3A 1CFPA 3WXAA 2I7AA 1Y0VH 2H2KA 2WOSA 1K95A 2V53A 5FYXA 1DVIA 3S0FA 4ZCVA 4OV2A 1DJZA 1OZSA 1SPYA 2F8PA 3SG6A 1GJYA 2K2AA 3D77A 5HKWA 1S5GZ 1A75B 2LNKA 3S0BA 3PATA 1IKUA 1JF2A 1XFRA 4USLA 3EKJA 3FE6A 1KFXS 1TTXA 1FF1A 5FI6A 2P70A 3TDUA 3FWCA 3DD4A 1T14A 3PFVA 2ZNDA 1B7TZ 1B7TY 2WC5A 2BKHB 1K8UA 1TNXA 1AP4A 1N65A 1NSHA 2KQ6A 2B1UA 3DVMA 3S0GA 1BR4B 3ZWHA 3SS4A 1GGZA 2CNPA 1AVSA 3CS1A 1MUXA 3GK4X 3KHEA 2F2OA 2K0JA 3D0YA 1NCXA 1DEKA 1QV0A 2I18A 2LVJA 2K7OA 3EK8A 1JBAA 2NCPA 3R1PA 2WCBA 1EL4A 3OP0A 3S0AA 4BY5A 3B87A 4YGAA 1W7IB 1MXEA 1TCFA 3M0WA 1PSBA 1A29A 1R2UA 2FJUB 1CDNA 3WNXB 2HF5A 3TDIA 2M97A 2BBNA 1KCYA 3F45A 1OOIX 1DJWA 3TS5C 2KI6C 1SW8A 3CGAA 2MLEC 4GGFA 1QVIZ 1QVIY 1IJ5A 2QACA 3DVKA 2WORA 2HQWA 4YI8A 1L7ZA 1U5IB 2BAPA 1KK8B 1SNLA 1RK9A 1RROA 1DQEA 2LV7A 1JFKA 5ER5A 4PE4A 1W7JB 1Y1XA 4GBAA 3L47A 1CM4A 2BE4A 3K1EA 5I94A 2KBMA 3NXAA 2M29A 1TIZA 1W9ZA 3VRRA 4PHNA 1HT9A 1CMFA 2OPOA 1C7WA 1CFDA 1F4OA 1KK7Y 1A75A 1NX1A 3QMEA 1CMGA 1DMOA 4ORBB 2COLB 1XA5A 5HKYA 4MZJA 3SS5A 3SG5A 4D1EA 1XK4A 2QEVA 2M3WA 2LAPA 4YI9A 1UWOA 1WLZA 3D76A 3PSRA 1H8BA 1K90D 1SCVA 1K9UA 5I2QA 2OTGB 4QJ4B 3R1VA 4JQ0D 3CR5X 1D1OA 1NIWA 4WQ2A 4R1EA 2ZN8A 5D69A 1DELA 2M7NA 4PE1A 4AQIA 1V1FA 3BYAA 3NSOA 1J1DA 4INWA 5CSJA 1SSEB 1SMGA 1YX8A 2LCPA 4CPVA 2BL0C 2EGDA 3IF7A 2KDHA 3NHIA 2KPHA 1F71A 1MQ1A 1IJ6A 2WCFA 1FW4A 3BUNB 1ZFSA 1TWOA 1Y1UA 2PSRA 2ZKMX 1H4BA 5ER4X 3SS3A 3D73A 1YUSA 2P71A 2H61A 2NLNA 1S6CA 1A2XA 1LS8A 2JTZA 2QEHA 3LLEA 1F55A 2IS9A 1TCOB 4NDDA 2EHBA 3DY9A 4YRUA 2JPTA 1U5IA 2JULA 2Y1NA 4PHMA 2P6BB 1A03A 1YVHA 2BCAA 4IJ7A 2ERBA 1M39A 2KBIA 3BFBA 3I5HB 1QIVA 3AKBA 3LK0A 4NDBA 3S0DA 2JT3A 1CLMA 1QXPA 1SYMA 1SKTA 2MLFC 4XYNA 1L2OB 1K94A 1J7RA 5CSFA 1EXRA 1QX2A 4YGDB 3CZ2A 2ISDA 4F7FA 1QWVA 2JU0A 1B4CA 4MN0A 3SIBA 4DUQA 4L9MA 5KTYA 3UO9A 1YRUB 4YGCB 1Q80A 2JNXA 1MXLC 2BKIB 2KLEA 4Q04A 2LVVA 4MZKA 1G8IA 1NX3A 1YTZC 2ZFDA 1NX0A 5I2OA 1QX7A 3FIAA 2H8VA 2KYCA 3EVUA 1F54A 4HSZA 4GUKA 3BOWB 1YUTA 4UPGA 4ETOA 5I8NA 2LLSA 1DJIA 1XFYO 2K60A 2KAVA 2LHIA 1OSAA 2PQLA 5JJGA 2GV5A 2QPTA 2H61C 2LE9B 3UNWA 2KI6D 2LC5A 1PSRA 3VRNA 4C0JA 1ZUZA 3GK2A 4IL1A 4DIRA 1CDMA 1GM0A 4AQJA 1LXFC 2M1UA 1AJ5A 1RECA 3RM1A 1AHRA 3FE8A 1J1EA 4FQOA 3CABA 2OS8C 5DKQA 1CM1A 3SG4A 1TNQA 2TN4A 4MLWA 4JD9A 3H4SE 1RTP1 2BL0B 4BY4A 2MA2A 3EG5B 4N1GA 1XFXO 2CXJA 1C07A 2KOTA 3DYEA 1MR8A 5JOLA 1UHJA 1EG3A 3JTDB 1BF5A 3FE9A 5DICA 2L4IA 2LP3A 2ZNEA 3PLFB 5D7FA 2L98A 2LLUA 1PULA 2WCLA 3CTNA 1ZOTB 1KQMB 2M8UA 3TUYB 1WDCC 2PALA 3CWGA 3PM2A 1M45A 1KWOC 1QLKA 1B47A 1VRKA 2Q4UA 1J7QA 2HPSA 2ZRTA 3FS7A 1CDPA 5AXIA 5AFPA 4INXA 1CLLA 2KHNA 3IVTA 1CFFA 4PE0A 4TNCA 3VB1A 2L0PA 3DF0B 3EK7A 1J7PA 2G2BA 3EVRA 3I5GC 4CIDA 1TN4A 4XJKA 1QS7A 1Z2CB 4MEWA 5B8IB 2KGRA 1FI5A 2GGMA 2D8NA 3C1VA 5IBWA 4YGEB 3SG7A 1C3YA 3L4AA 1BMOA 1B9AA 1QV1A 2K7CA 2LUXA 2M49B 5CPVA 1KK7Z 4MRYA 5J3XA 1S26D 2BCBA 3B86A 3HCMA 5AEQA 1G33A 2PASA 2KAXA 3O78A 2G9BA 2CBLA 1K96A 2KFHA 1WRZA 3BJHA 1B8RA 2QDIA
chains in the Genus database with same CATH topology
2GGZA 2I94A 4MRXA 3BUWB 2EC6C 1SCMC 3I5IC 3K21A 1ZACA 3OHMB 1IG5A 1JUOA 1CFCA 2MAZA 2KI4C 4ICBA 1R6PA 1HQVA 2OS8B 2WC8A 4I5NB 1S6IA 1SL8A 4HREE 3DVJA 4MSPA 5AANA 1TRFA 1YRTB 2RGIA 4GGFC 1YUUA 3PM8A 4PCWA 2HQ8A 3VRPA 3O4YA 1BG1A 2F3ZA 1DT7B 1BLQA 1DJYA 3VROA 1NP8A 2KQYA 1TNPA 5G08A 1BJFA 1FPWA 4PHJA 2K2FA 2L51A 1QLSA 1X02A 1WRLA 2LANA 3NSKA 1DJHA 1AK8A 1JSAA 4PE7A 1ODBA 3DF0A 4N5XA 1MF8B 1K2HA 2JQ6A 1YX7A 1KWOB 1Y1AA 5KSZA 3BUOB 1OZOA 1BU3A 3VRQA 1NUBA 3TS5B 1DGVA 1YVLA 1XK4C 1OMRA 4DS7A 2L5XB 3LCPC 2K8MB 1LINA 4WRIA 2MBXA 2NZ0A 2LVKA 4WQ3A 4OCIA 1OQPA 1K93D 1S36A 3CR4X 4CLNA 1WRKA 2E30A 2K7DA 2KSPA 3AAKA 3QRXA 3WHTB 1FI6A 2SCPA 1QASA 4DCKA 3CR2A 3SJSA 1M46A 2AUCA 4MZLA 2BBMA 2JXLA 2A4JA 4ZCUA 1EG4A 2FCEA 3OX5A 3FWBA 3O6BA 1JC2A 3E3RA 3RLZA 3IQOA 4JPZB 3SIAA 4OKHA 2M1KB 2DOQA 2PMYA 5GQQC 2CTNA 1S3PA 4CFRA 1QATA 2BECA 3EKHA 1SL9A 1CTRA 1KQVA 1G4YR 1B8CA 4C0KA 4I5LB 1KK8C 1GGWA 3SG3A 3EK4A 3VGOA 1M63B 1RJVA 4ORCB 1IQ5A 1NCZA 1F70A 1XFZO 2JZIA 1BR1B 2KFFA 3LK1A 4GPLB 4N1FA 2L2EA 1KFXL 1WLMA 2LMUA 3OX6A 1LVCD 2LUCA 2FCDA 3TDZA 2KYFA 2LMTA 1DF0B 2R2IA 2K7BA 1PRWA 1SY9A 1QIWA 1DTLA 1CKKA 3NSLA 4PHKA 1KFUL 1S1EA 4YBHB 3I5FC 1S5GY 3PN7C 3MSEB 2MRDA 3CLNA 5HLOA 2OTGC 2AMIA 1OMDA 1OE9B 1LA3A 2Q91A 3NSIA 3KPXA 2JOJA 1OOJA 2M0RA 1PK0D 1XFVO 5CSNA 2PVBA 4MBEA 4A4CA 1KFUS 1UP5A 4HRGA 1JWDA 1XO5A 3AKAA 1NWDA 2L50A 3BOWA 3O2PA 1MHOA 1BT6A 5K89A 2BCXA 1AUIB 3ZNIA 1XYDA 2LM5A 2M7LA 2O5GA 1B1GA 4QJ3B 1QX5B 1CNPA 5DKRA 2JRFA 4NQGA 5HKZA 1IH0A 4PDZA 1IRJA 2Y4QA 1SK6D 4MVFA 5HYDA 3OB2B 3I5HC 1K9KA 2MHHA 2NXQA 1UURA 2Y1MA 2HETA 1QTXA 2LMVA 3OB1B 2LLTA 1GQMA 3BXKA 5F6TA 2ZRSA 1L2OC 3SG2A 3DVEA 3HX4A 1NX2A 1F4QA 1YURA 3D10A 3WHUB 1CB1A 1M31A 4U8DA 1CDLA 1DF0A 1XFWO 4I5KA 2KGBC 4F0ZB 1JFJA 3JVTC 5HLVA 1UHHA 2O60A 4JWQA 2JNFA 1UUSA 2M9GA 1SBJA 5BPJA 4E68A 1EJ3A 1KSOA 2L4HA 1SR6C 2JT8A 4I5JA 3BUMB 1RWYA 2LP2A 3ICBA 5CSIA 2LHLA 2K61A 1TOPA 1QJTA 3PALA 5TNCA 1BOCA 3A4UB 1B8LA 3TZ1A 1IGVA 3GOFA 3I5FB 2F33A 3PN7B 2F2PA 5I2LA 4DRWA 5PALA 1OMVA 3IQQA 2KAYA 3KF9A 1WDCB 2WNDA 1NYAA 2JWWA 1AJ4A 4GFTA 2NCOA 1PVBA 2AAOA 3GK1A 1RFJA 4HRHA 5AERA 1WY9A 1NPQA 2I2RE 2SASA 1C7VA 3AAJA 3EVVA 1PALA 3I5GB 4OR9B 3LL8B 4AOMA 2BE6A 2Y5IA 2ZN9A 4GAOA 4CFQA 1DJXA 3JTDC 1EH2A 4ORAB 2MJWB 1UHNA 2LVIA 1FBVA 5KU1A 5DKNA 1UHIA 2FOTA 3KEVA 3KO0A 1KQMC 2JXCA 3TUYC 3D0YB 2E6WA 1IWQA 4GNKB 4NDCA 4YGBB 1F8HA 2WCEA 1XVJA 4P5OE 2PRUA 4M2OA 1J55A 2EC6B 1LA0A 1SCMB 3A8RA 2CCMA 3BUXB 3I5IB 4PALA 3CZTX 2JC2A 1UHKA 1A4PA 1NCYA 2JT0A 1N0YA 1TNWA 2KNEA 1YR5A 4M2PA 4MEWA 1KSMA 2KI4B 1XFUO 1SRAA 1J7OA 1SL7A 2CT9A 3JVTB 4QJ5B 1N2DA 1ZMZA 4C0LA 3BQ3A 1V1GA 1JF0A 1ALVA 1DJGA 4GGNA 1ALWA 1MWNA 4P2YB 1CLBA 1S6JA 2F3YA 1BODA 2VRGA 4M2QA 1E8AA 1K9PA 1PVAA 1Y6WA 2JTTA 4A4BA 4FTGA 1SR6B 2KFGA 1DGUA 4OVNF 4XJKB 1LKJA 1IQ3A 1CFPA 3WXAA 2I7AA 1Y0VH 2H2KA 2WOSA 1K95A 2V53A 5FYXA 1DVIA 4ZCVA 4OV2A 1DJZA 1OZSA 1SPYA 2F8PA 3SG6A 1GJYA 2K2AA 5HKWA 1S5GZ 1A75B 2LNKA 3PATA 1IKUA 1JF2A 4USLA 3EKJA 1KFXS 1TTXA 1FF1A 3TDUA 3FWCA 3DD4A 3PFVA 2ZNDA 1B7TZ 1B7TY 2BKHB 1K8UA 1TNXA 1AP4A 1N65A 1NSHA 2KQ6A 2B1UA 3DVMA 1BR4B 3ZWHA 1GGZA 2CNPA 1AVSA 3CS1A 1MUXA 3GK4X 3KHEA 2F2OA 2K0JA 3D0YA 1NCXA 1QV0A 2I18A 2LVJA 1JBAA 2K7OA 3EK8A 2NCPA 2WCBA 1EL4A 3OP0A 4BY5A 4YGAA 1W7IB 1MXEA 1TCFA 3M0WA 1PSBA 1A29A 1R2UA 2FJUB 1CDNA 3WNXB 2HF5A 3TDIA 2M97A 2BBNA 1KCYA 3F45A 3TS5C 1DJWA 2KI6C 1SW8A 3CGAA 2MLEC 4GGFA 1QVIZ 1QVIY 1IJ5A 2QACA 3DVKA 2WORA 2HQWA 4YI8A 1L7ZA 1U5IB 1KK8B 1SNLA 1RK9A 1RROA 2LV7A 1JFKA 5ER5A 4PE4A 1W7JB 1Y1XA 4GBAA 1CM4A 2BE4A 2KBMA 3NXAA 2M29A 1TIZA 3VRRA 4PHNA 1HT9A 1CMFA 2OPOA 1C7WA 1CFDA 1F4OA 1KK7Y 1A75A 1NX1A 1CMGA 1DMOA 4ORBB 2COLB 1XA5A 5HKYA 4MZJA 3SG5A 4D1EA 1XK4A 2M3WA 2LAPA 4YI9A 1UWOA 1WLZA 3PSRA 1H8BA 1K90D 1SCVA 1K9UA 5I2QA 2OTGB 4QJ4B 4JQ0D 3CR5X 1D1OA 1NIWA 4WQ2A 4R1EA 2ZN8A 5D69A 2M7NA 4AQIA 4PE1A 1V1FA 3BYAA 3NSOA 1J1DA 5CSJA 1SMGA 1YX8A 2LCPA 4CPVA 2BL0C 2EGDA 3IF7A 2KDHA 1F71A 1MQ1A 1IJ6A 2WCFA 1FW4A 3BUNB 1ZFSA 1Y1UA 2PSRA 2ZKMX 1H4BA 5ER4X 1YUSA 2H61A 2NLNA 1S6CA 1A2XA 1F55A 2JTZA 3LLEA 2IS9A 1TCOB 4NDDA 2EHBA 4YRUA 2JPTA 1U5IA 2JULA 2Y1NA 4PHMA 2P6BB 1A03A 1YVHA 2BCAA 3LK0A 1M39A 2KBIA 3I5HB 5AFPA 1QIVA 3AKBA 4NDBA 2JT3A 1CLMA 1QXPA 1SYMA 1SKTA 2MLFC 4XYNA 1L2OB 1K94A 1J7RA 5CSFA 1EXRA 1QX2A 4YGDB 2ISDA 2JU0A 1B4CA 4MN0A 3SIBA 4DUQA 4L9MA 5KTYA 1YRUB 4YGCB 1Q80A 2JNXA 1MXLC 2BKIB 4Q04A 2LVVA 4MZKA 1G8IA 1NX3A 1YTZC 2ZFDA 1NX0A 5I2OA 1QX7A 3FIAA 2KYCA 3EVUA 1F54A 4HSZA 4GUKA 3BOWB 1YUTA 4UPGA 4ETOA 5I8NA 2LLSA 1DJIA 1XFYO 2KAVA 2LHIA 1OSAA 5JJGA 2GV5A 2QPTA 2H61C 2LE9B 2KI6D 2LC5A 1PSRA 3VRNA 4C0JA 1ZUZA 3GK2A 4IL1A 4DIRA 1CDMA 4AQJA 1LXFC 2M1UA 1AJ5A 1RECA 3RM1A 1AHRA 1J1EA 4FQOA 2OS8C 5DKQA 1CM1A 3SG4A 1TNQA 2TN4A 4MLWA 3H4SE 1RTP1 2BL0B 4BY4A 2MA2A 4N1GA 1XFXO 2CXJA 1C07A 2KOTA 1MR8A 5JOLA 1UHJA 1EG3A 3JTDB 1BF5A 2L4IA 2LP3A 2ZNEA 3PLFB 5D7FA 2L98A 2LLUA 1PULA 3CTNA 1ZOTB 1KQMB 2M8UA 3TUYB 1WDCC 2PALA 3CWGA 1M45A 1KWOC 1QLKA 1B47A 1VRKA 2Q4UA 1J7QA 2HPSA 2ZRTA 3FS7A 1CDPA 5AXIA 1CLLA 2KHNA 1CFFA 4PE0A 4TNCA 2L0PA 3DF0B 3EK7A 1J7PA 2G2BA 3EVRA 3I5GC 4CIDA 1TN4A 4XJKA 1QS7A 5B8IB 2KGRA 1FI5A 2GGMA 2D8NA 3C1VA 5IBWA 4YGEB 3SG7A 1BMOA 1B9AA 1QV1A 2K7CA 2LUXA 2M49B 5CPVA 1KK7Z 4MRYA 5J3XA 2BCBA 1S26D 5AEQA 3HCMA 1G33A 2PASA 2KAXA 3O78A 2G9BA 2CBLA 1K96A 2KFHA 1WRZA 1B8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGZ A;  2I94 A;  4MRX A;  3BUW B;  2EC6 C;  1SCM C;  3I5I C;  3K21 A;  1ZAC A;  3OHM B;  1IG5 A;  1JUO A;  1CFC A;  2MAZ A;  2KI4 C;  4ICB A;  1R6P A;  1HQV A;  2OS8 B;  2WC8 A;  4I5N B;  1S6I A;  1SL8 A;  4HRE E;  3DVJ A;  4MSP A;  5AAN A;  1TRF A;  1YRT B;  2RGI A;  4GGF C;  1YUU A;  3PM8 A;  4PCW A;  2HQ8 A;  3VRP A;  3O4Y A;  1BG1 A;  2F3Z A;  1DT7 B;  1BLQ A;  1DJY A;  3VRO A;  1NP8 A;  2KQY A;  1TNP A;  5G08 A;  1BJF A;  1FPW A;  4PHJ A;  2K2F A;  2L51 A;  1QLS A;  1X02 A;  1WRL A;  2LAN A;  3NSK A;  1DJH A;  1AK8 A;  1JSA A;  4PE7 A;  1ODB A;  3DF0 A;  4N5X A;  1MF8 B;  1K2H A;  2JQ6 A;  1YX7 A;  1KWO B;  1Y1A A;  5KSZ A;  3BUO B;  1OZO A;  1BU3 A;  3VRQ A;  1NUB A;  3TS5 B;  1DGV A;  1YVL A;  1XK4 C;  1OMR A;  4DS7 A;  2L5X B;  3LCP C;  2K8M B;  1LIN A;  4WRI A;  2MBX A;  2NZ0 A;  2LVK A;  4WQ3 A;  4OCI A;  1OQP A;  1K93 D;  1S36 A;  3CR4 X;  4CLN A;  1WRK A;  2E30 A;  2K7D A;  2KSP A;  3AAK A;  3QRX A;  3WHT B;  1FI6 A;  2SCP A;  1QAS A;  4DCK A;  3CR2 A;  3SJS A;  1M46 A;  2AUC A;  4MZL A;  2BBM A;  2JXL A;  2A4J A;  4ZCU A;  1EG4 A;  2FCE A;  3OX5 A;  3FWB A;  3O6B A;  1JC2 A;  3E3R A;  3RLZ A;  3IQO A;  4JPZ B;  3SIA A;  4OKH A;  2M1K B;  2DOQ A;  2PMY A;  5GQQ C;  2CTN A;  1S3P A;  4CFR A;  1QAT A;  2BEC A;  3EKH A;  1SL9 A;  1CTR A;  1KQV A;  1G4Y R;  1B8C A;  4C0K A;  4I5L B;  1KK8 C;  1GGW A;  3SG3 A;  3EK4 A;  3VGO A;  1M63 B;  1RJV A;  4ORC B;  1IQ5 A;  1NCZ A;  1F70 A;  1XFZ O;  2JZI A;  1BR1 B;  2KFF A;  3LK1 A;  4GPL B;  4N1F A;  2L2E A;  1KFX L;  1WLM A;  2LMU A;  3OX6 A;  1LVC D;  2LUC A;  2FCD A;  3TDZ A;  2KYF A;  2LMT A;  1DF0 B;  2R2I A;  2K7B A;  1PRW A;  1SY9 A;  1QIW A;  1DTL A;  1CKK A;  3NSL A;  4PHK A;  1KFU L;  1S1E A;  4YBH B;  3I5F C;  1S5G Y;  3PN7 C;  3MSE B;  2MRD A;  3CLN A;  5HLO A;  2OTG C;  2AMI A;  1OMD A;  1OE9 B;  1LA3 A;  2Q91 A;  3NSI A;  3KPX A;  2JOJ A;  1OOJ A;  2M0R A;  1PK0 D;  1XFV O;  5CSN A;  2PVB A;  4MBE A;  4A4C A;  1KFU S;  1UP5 A;  4HRG A;  1JWD A;  1XO5 A;  3AKA A;  1NWD A;  2L50 A;  3BOW A;  3O2P A;  1MHO A;  1BT6 A;  5K89 A;  2BCX A;  1AUI B;  3ZNI A;  1XYD A;  2LM5 A;  2M7L A;  2O5G A;  1B1G A;  4QJ3 B;  1QX5 B;  1CNP A;  5DKR A;  2JRF A;  4NQG A;  5HKZ A;  1IH0 A;  4PDZ A;  1IRJ A;  2Y4Q A;  1SK6 D;  4MVF A;  5HYD A;  3OB2 B;  3I5H C;  1K9K A;  2MHH A;  2NXQ A;  1UUR A;  2Y1M A;  2HET A;  1QTX A;  2LMV A;  3OB1 B;  2LLT A;  1GQM A;  3BXK A;  5F6T A;  2ZRS A;  1L2O C;  3SG2 A;  3DVE A;  3HX4 A;  1NX2 A;  1F4Q A;  1YUR A;  3D10 A;  3WHU B;  1CB1 A;  1M31 A;  4U8D A;  1CDL A;  1DF0 A;  1XFW O;  4I5K A;  2KGB C;  4F0Z B;  1JFJ A;  3JVT C;  5HLV A;  1UHH A;  2O60 A;  4JWQ A;  2JNF A;  1UUS A;  2M9G A;  1SBJ A;  5BPJ A;  4E68 A;  1EJ3 A;  1KSO A;  2L4H A;  1SR6 C;  2JT8 A;  4I5J A;  3BUM B;  1RWY A;  2LP2 A;  3ICB A;  5CSI A;  2LHL A;  2K61 A;  1TOP A;  1QJT A;  3PAL A;  5TNC A;  1BOC A;  3A4U B;  1B8L A;  3TZ1 A;  1IGV A;  3GOF A;  3I5F B;  2F33 A;  3PN7 B;  2F2P A;  5I2L A;  4DRW A;  5PAL A;  1OMV A;  3IQQ A;  2KAY A;  3KF9 A;  1WDC B;  2WND A;  1NYA A;  2JWW A;  1AJ4 A;  4GFT A;  2NCO A;  1PVB A;  2AAO A;  3GK1 A;  1RFJ A;  4HRH A;  5AER A;  1WY9 A;  1NPQ A;  2I2R E;  2SAS A;  1C7V A;  3AAJ A;  3EVV A;  1PAL A;  3I5G B;  4OR9 B;  3LL8 B;  4AOM A;  2BE6 A;  2Y5I A;  2ZN9 A;  4GAO A;  4CFQ A;  1DJX A;  3JTD C;  1EH2 A;  4ORA B;  2MJW B;  1UHN A;  2LVI A;  1FBV A;  5KU1 A;  5DKN A;  1UHI A;  2FOT A;  3KEV A;  3KO0 A;  1KQM C;  2JXC A;  3TUY C;  3D0Y B;  2E6W A;  1IWQ A;  4GNK B;  4NDC A;  4YGB B;  1F8H A;  2WCE A;  1XVJ A;  4P5O E;  2PRU A;  4M2O A;  1J55 A;  2EC6 B;  1LA0 A;  1SCM B;  3A8R A;  2CCM A;  3BUX B;  3I5I B;  4PAL A;  3CZT X;  2JC2 A;  1UHK A;  1A4P A;  1NCY A;  2JT0 A;  1N0Y A;  1TNW A;  2KNE A;  1YR5 A;  4M2P A;  4MEW A;  1KSM A;  2KI4 B;  1XFU O;  1SRA A;  1J7O A;  1SL7 A;  2CT9 A;  3JVT B;  4QJ5 B;  1N2D A;  1ZMZ A;  4C0L A;  3BQ3 A;  1V1G A;  1JF0 A;  1ALV A;  1DJG A;  4GGN A;  1ALW A;  1MWN A;  4P2Y B;  1CLB A;  1S6J A;  2F3Y A;  1BOD A;  2VRG A;  4M2Q A;  1E8A A;  1K9P A;  1PVA A;  1Y6W A;  2JTT A;  4A4B A;  4FTG A;  1SR6 B;  2KFG A;  1DGU A;  4OVN F;  4XJK B;  1LKJ A;  1IQ3 A;  1CFP A;  3WXA A;  2I7A A;  1Y0V H;  2H2K A;  2WOS A;  1K95 A;  2V53 A;  5FYX A;  1DVI A;  4ZCV A;  4OV2 A;  1DJZ A;  1OZS A;  1SPY A;  2F8P A;  3SG6 A;  1GJY A;  2K2A A;  5HKW A;  1S5G Z;  1A75 B;  2LNK A;  3PAT A;  1IKU A;  1JF2 A;  4USL A;  3EKJ A;  1KFX S;  1TTX A;  1FF1 A;  3TDU A;  3FWC A;  3DD4 A;  3PFV A;  2ZND A;  1B7T Z;  1B7T Y;  2BKH B;  1K8U A;  1TNX A;  1AP4 A;  1N65 A;  1NSH A;  2KQ6 A;  2B1U A;  3DVM A;  1BR4 B;  3ZWH A;  1GGZ A;  2CNP A;  1AVS A;  3CS1 A;  1MUX A;  3GK4 X;  3KHE A;  2F2O A;  2K0J A;  3D0Y A;  1NCX A;  1QV0 A;  2I18 A;  2LVJ A;  1JBA A;  2K7O A;  3EK8 A;  2NCP A;  2WCB A;  1EL4 A;  3OP0 A;  4BY5 A;  4YGA A;  1W7I B;  1MXE A;  1TCF A;  3M0W A;  1PSB A;  1A29 A;  1R2U A;  2FJU B;  1CDN A;  3WNX B;  2HF5 A;  3TDI A;  2M97 A;  2BBN A;  1KCY A;  3F45 A;  3TS5 C;  1DJW A;  2KI6 C;  1SW8 A;  3CGA A;  2MLE C;  4GGF A;  1QVI Z;  1QVI Y;  1IJ5 A;  2QAC A;  3DVK A;  2WOR A;  2HQW A;  4YI8 A;  1L7Z A;  1U5I B;  1KK8 B;  1SNL A;  1RK9 A;  1RRO A;  2LV7 A;  1JFK A;  5ER5 A;  4PE4 A;  1W7J B;  1Y1X A;  4GBA A;  1CM4 A;  2BE4 A;  2KBM A;  3NXA A;  2M29 A;  1TIZ A;  3VRR A;  4PHN A;  1HT9 A;  1CMF A;  2OPO A;  1C7W A;  1CFD A;  1F4O A;  1KK7 Y;  1A75 A;  1NX1 A;  1CMG A;  1DMO A;  4ORB B;  2COL B;  1XA5 A;  5HKY A;  4MZJ A;  3SG5 A;  4D1E A;  1XK4 A;  2M3W A;  2LAP A;  4YI9 A;  1UWO A;  1WLZ A;  3PSR A;  1H8B A;  1K90 D;  1SCV A;  1K9U A;  5I2Q A;  2OTG B;  4QJ4 B;  4JQ0 D;  3CR5 X;  1D1O A;  1NIW A;  4WQ2 A;  4R1E A;  2ZN8 A;  5D69 A;  2M7N A;  4AQI A;  4PE1 A;  1V1F A;  3BYA A;  3NSO A;  1J1D A;  5CSJ A;  1SMG A;  1YX8 A;  2LCP A;  4CPV A;  2BL0 C;  2EGD A;  3IF7 A;  2KDH A;  1F71 A;  1MQ1 A;  1IJ6 A;  2WCF A;  1FW4 A;  3BUN B;  1ZFS A;  1Y1U A;  2PSR A;  2ZKM X;  1H4B A;  5ER4 X;  1YUS A;  2H61 A;  2NLN A;  1S6C A;  1A2X A;  1F55 A;  2JTZ A;  3LLE A;  2IS9 A;  1TCO B;  4NDD A;  2EHB A;  4YRU A;  2JPT A;  1U5I A;  2JUL A;  2Y1N A;  4PHM A;  2P6B B;  1A03 A;  1YVH A;  2BCA A;  3LK0 A;  1M39 A;  2KBI A;  3I5H B;  5AFP A;  1QIV A;  3AKB A;  4NDB A;  2JT3 A;  1CLM A;  1QXP A;  1SYM A;  1SKT A;  2MLF C;  4XYN A;  1L2O B;  1K94 A;  1J7R A;  5CSF A;  1EXR A;  1QX2 A;  4YGD B;  2ISD A;  2JU0 A;  1B4C A;  4MN0 A;  3SIB A;  4DUQ A;  4L9M A;  5KTY A;  1YRU B;  4YGC B;  1Q80 A;  2JNX A;  1MXL C;  2BKI B;  4Q04 A;  2LVV A;  4MZK A;  1G8I A;  1NX3 A;  1YTZ C;  2ZFD A;  1NX0 A;  5I2O A;  1QX7 A;  3FIA A;  2KYC A;  3EVU A;  1F54 A;  4HSZ A;  4GUK A;  3BOW B;  1YUT A;  4UPG A;  4ETO A;  5I8N A;  2LLS A;  1DJI A;  1XFY O;  2KAV A;  2LHI A;  1OSA A;  5JJG A;  2GV5 A;  2QPT A;  2H61 C;  2LE9 B;  2KI6 D;  2LC5 A;  1PSR A;  3VRN A;  4C0J A;  1ZUZ A;  3GK2 A;  4IL1 A;  4DIR A;  1CDM A;  4AQJ A;  1LXF C;  2M1U A;  1AJ5 A;  1REC A;  3RM1 A;  1AHR A;  1J1E A;  4FQO A;  2OS8 C;  5DKQ A;  1CM1 A;  3SG4 A;  1TNQ A;  2TN4 A;  4MLW A;  3H4S E;  1RTP 1;  2BL0 B;  4BY4 A;  2MA2 A;  4N1G A;  1XFX O;  2CXJ A;  1C07 A;  2KOT A;  1MR8 A;  5JOL A;  1UHJ A;  1EG3 A;  3JTD B;  1BF5 A;  2L4I A;  2LP3 A;  2ZNE A;  3PLF B;  5D7F A;  2L98 A;  2LLU A;  1PUL A;  3CTN A;  1ZOT B;  1KQM B;  2M8U A;  3TUY B;  1WDC C;  2PAL A;  3CWG A;  1M45 A;  1KWO C;  1QLK A;  1B47 A;  1VRK A;  2Q4U A;  1J7Q A;  2HPS A;  2ZRT A;  3FS7 A;  1CDP A;  5AXI A;  1CLL A;  2KHN A;  1CFF A;  4PE0 A;  4TNC A;  2L0P A;  3DF0 B;  3EK7 A;  1J7P A;  2G2B A;  3EVR A;  3I5G C;  4CID A;  1TN4 A;  4XJK A;  1QS7 A;  5B8I B;  2KGR A;  1FI5 A;  2GGM A;  2D8N A;  3C1V A;  5IBW A;  4YGE B;  3SG7 A;  1BMO A;  1B9A A;  1QV1 A;  2K7C A;  2LUX A;  2M49 B;  5CPV A;  1KK7 Z;  4MRY A;  5J3X A;  2BCB A;  1S26 D;  5AEQ A;  3HCM A;  1G33 A;  2PAS A;  2KAX A;  3O78 A;  2G9B A;  2CBL A;  1K96 A;  2KFH A;  1WRZ A;  1B8R A; 
#chains in the Genus database with same CATH topology
 2GGZ A;  3NHT A;  2I94 A;  4MRX A;  3BUW B;  2BNX A;  1SCM C;  2EC6 C;  3I5I C;  1ZAC A;  3K21 A;  3N7H A;  3OHM B;  1IG5 A;  1JUO A;  1CFC A;  2MAZ A;  2KI4 C;  4ICB A;  1R6P A;  1HQV A;  2OS8 B;  2WC8 A;  4I5N B;  1S6I A;  4PT1 A;  3OBV A;  3S0E A;  3DXL A;  1SL8 A;  1Z4H A;  3DVJ A;  4HRE E;  5FI2 A;  3D74 A;  4MSP A;  5AAN A;  1TRF A;  1YRT B;  2RGI A;  4GGF C;  1YUU A;  3PM8 A;  4FQT A;  2HQ8 A;  4PCW A;  3VRP A;  3O4Y A;  1BG1 A;  2F3Z A;  4JKT A;  1DT7 B;  1BLQ A;  1DJY A;  3VRO A;  1NP8 A;  2KQY A;  1TNP A;  5G08 A;  1BJF A;  1FPW A;  4PHJ A;  2K2F A;  2L51 A;  1QLS A;  1X02 A;  3B88 A;  1WRL A;  2LAN A;  3NSK A;  1DJH A;  1AK8 A;  1JSA A;  4PE7 A;  1ODB A;  3DF0 A;  4N5X A;  1MF8 B;  1K2H A;  2JQ6 A;  4OZD A;  1YX7 A;  1KWO B;  1Y1A A;  5KSZ A;  3BUO B;  1OZO A;  1BU3 A;  3VRQ A;  1NUB A;  3TS5 B;  1DGV A;  2WCM A;  1YVL A;  1XK4 C;  1OMR A;  4DS7 A;  2L5X B;  3LCP C;  2K8M B;  1LIN A;  4WRI A;  2MBX A;  2NZ0 A;  3BFH A;  1OOF A;  2LVK A;  4WQ3 A;  4OCI A;  1OQP A;  1K93 D;  1S36 A;  3CR4 X;  3OGN A;  1WRK A;  4CLN A;  2E30 A;  2K7D A;  2KSP A;  3AAK A;  3QRX A;  3WHT B;  1FI6 A;  2SCP A;  1QAS A;  4DCK A;  3CR2 A;  3SJS A;  1M46 A;  2AUC A;  3CZ0 A;  3NGV A;  2WCK A;  2BBM A;  2JXL A;  4MZL A;  2A4J A;  3B7A A;  1EG4 A;  2FCE A;  4ZCU A;  3OX5 A;  3FWB A;  3O6B A;  1JC2 A;  3E3R A;  3RLZ A;  1TUZ A;  3IQO A;  4JPZ B;  3SIA A;  4OKH A;  2M1K B;  2DOQ A;  2PMY A;  3Q8I A;  5GQQ C;  2CTN A;  1S3P A;  4CFR A;  1QAT A;  2BEC A;  3EKH A;  1SL9 A;  1CTR A;  1KQV A;  5HL1 A;  3CZ1 A;  1G4Y R;  1B8C A;  2KLD A;  4C0K A;  4I5L B;  1KK8 C;  1GGW A;  3SG3 A;  3EK4 A;  2WCH A;  1M63 B;  3VGO A;  1RJV A;  4ORC B;  1IQ5 A;  1NCZ A;  1F70 A;  1XFZ O;  2JZI A;  1BR1 B;  2KFF A;  3LK1 A;  4GPL B;  4N1F A;  2L2E A;  1KFX L;  1WLM A;  2LMU A;  3OX6 A;  1LVC D;  2LUC A;  2FCD A;  3TDZ A;  2KYF A;  2LMT A;  1DF0 B;  2R2I A;  2K7B A;  3D75 A;  1PRW A;  1SY9 A;  1QIW A;  1DTL A;  1CKK A;  3NSL A;  2L5Y A;  4PHK A;  3RZS A;  1KFU L;  1S1E A;  4YBH B;  3I5F C;  1S5G Y;  5FI7 A;  3PN7 C;  3BFA A;  3MSE B;  2MRD A;  3CLN A;  5HLO A;  2OTG C;  2AMI A;  1OMD A;  1OE9 B;  2WC6 A;  1LA3 A;  2Q91 A;  3NSI A;  3KPX A;  2JOJ A;  2YGU A;  3R72 A;  1OOJ A;  2M0R A;  1PK0 D;  1XFV O;  5CSN A;  2GTE A;  2PVB A;  4MBE A;  4A4C A;  1KFU S;  1UP5 A;  4HRG A;  1JWD A;  1XO5 A;  3AKA A;  1NWD A;  2L50 A;  2FJY A;  3BOW A;  1MHO A;  1BT6 A;  3O2P A;  5K89 A;  2BCX A;  1AUI B;  3ZNI A;  1XYD A;  2LM5 A;  2M7L A;  2O5G A;  1B1G A;  4QJ3 B;  1QX5 B;  1CNP A;  2L2C A;  5DKR A;  2JRF A;  4NQG A;  5HKZ A;  1IH0 A;  4PDZ A;  1IRJ A;  1DC1 A;  2Y4Q A;  1SK6 D;  3DZT A;  4MVF A;  5HYD A;  3OB2 B;  3I5H C;  1K9K A;  2MHH A;  2NXQ A;  1UUR A;  1C3Z A;  2HET A;  1QTX A;  2LMV A;  2Y1M A;  3OB1 B;  3L4L A;  2LLT A;  1GQM A;  3BXK A;  5F6T A;  2ZRS A;  1L2O C;  3SG2 A;  3DVE A;  3HX4 A;  1NX2 A;  1F4Q A;  1YUR A;  3D10 A;  3WHU B;  1CB1 A;  1M31 A;  4U8D A;  1CDL A;  1DF0 A;  1XFW O;  4I5K A;  2KGB C;  3PJI A;  4F0Z B;  1JFJ A;  3JVT C;  5HLV A;  3V2L A;  1UHH A;  2O60 A;  4JWQ A;  2JNF A;  5EL2 A;  1UUS A;  2M9G A;  1SBJ A;  5BPJ A;  4E68 A;  1EJ3 A;  1KSO A;  2L4H A;  2JPO A;  1SR6 C;  2JT8 A;  4I5J A;  3BUM B;  1RWY A;  2LP2 A;  3ICB A;  5CSI A;  2LHL A;  2K61 A;  1TOP A;  1QJT A;  3PAL A;  5TNC A;  1BOC A;  3A4U B;  1B8L A;  1ORG A;  3TZ1 A;  1IGV A;  3GOF A;  3I5F B;  2F33 A;  3PN7 B;  2F2P A;  5I2L A;  2QEO A;  4DRW A;  5PAL A;  1OMV A;  3IQQ A;  2KAY A;  3KF9 A;  1WDC B;  2WND A;  1NYA A;  2JWW A;  1AJ4 A;  3CYZ A;  2WCJ A;  4GFT A;  2NCO A;  1PVB A;  2AAO A;  3GK1 A;  1RFJ A;  4HRH A;  5AER A;  1WY9 A;  1NPQ A;  2I2R E;  2QEB A;  2SAS A;  1C7V A;  3AAJ A;  2PYQ A;  1TUJ A;  3EVV A;  1PAL A;  3I5G B;  4OR9 B;  3LL8 B;  4AOM A;  2BE6 A;  2Y5I A;  3O4X A;  2ZN9 A;  4GAO A;  4CFQ A;  1DJX A;  3JTD C;  1EH2 A;  4ORA B;  2MJW B;  1UHN A;  2LVI A;  1FBV A;  5KU1 A;  5DKN A;  1UHI A;  1IIO A;  2FOT A;  3KEV A;  3KO0 A;  1KQM C;  1OW4 A;  2JXC A;  3TUY C;  3D0Y B;  3D78 A;  2E6W A;  1IWQ A;  1OOH A;  4GNK B;  4NDC A;  4YGB B;  1F8H A;  2WCE A;  1XVJ A;  4P5O E;  2PRU A;  4M2O A;  1J55 A;  2EC6 B;  1LA0 A;  1SCM B;  3A8R A;  2CCM A;  3BUX B;  3I5I B;  4PAL A;  5D3O A;  3CZT X;  2JC2 A;  1UHK A;  1A4P A;  1NCY A;  2JT0 A;  1N0Y A;  1TNW A;  2KNE A;  1YR5 A;  3R1O A;  4M2P A;  1KSM A;  1P28 A;  1XFU O;  1SRA A;  2KI4 B;  1J7O A;  1SL7 A;  2CT9 A;  3JVT B;  4QJ5 B;  1N2D A;  1ZMZ A;  4C0L A;  3BQ3 A;  1V1G A;  1JF0 A;  1ALV A;  1DJG A;  4GGN A;  1ALW A;  1MWN A;  3B6X A;  4P2Y B;  1CLB A;  1S6J A;  2F3Y A;  1BOD A;  2VRG A;  4M2Q A;  1E8A A;  1K9P A;  1PVA A;  1Y6W A;  2JTT A;  3CDN A;  4A4B A;  4FTG A;  4KYN A;  1SR6 B;  2KFG A;  1DGU A;  4OVN F;  4XJK B;  1OOG A;  1LKJ A;  1IQ3 A;  1CFP A;  3WXA A;  2I7A A;  1Y0V H;  2H2K A;  2WOS A;  1K95 A;  2V53 A;  5FYX A;  1DVI A;  3S0F A;  4ZCV A;  4OV2 A;  1DJZ A;  1OZS A;  1SPY A;  2F8P A;  3SG6 A;  1GJY A;  2K2A A;  3D77 A;  5HKW A;  1S5G Z;  1A75 B;  2LNK A;  3S0B A;  3PAT A;  1IKU A;  1JF2 A;  1XFR A;  4USL A;  3EKJ A;  3FE6 A;  1KFX S;  1TTX A;  1FF1 A;  5FI6 A;  2P70 A;  3TDU A;  3FWC A;  3DD4 A;  1T14 A;  3PFV A;  2ZND A;  1B7T Z;  1B7T Y;  2WC5 A;  2BKH B;  1K8U A;  1TNX A;  1AP4 A;  1N65 A;  1NSH A;  2KQ6 A;  2B1U A;  3DVM A;  3S0G A;  1BR4 B;  3ZWH A;  3SS4 A;  1GGZ A;  2CNP A;  1AVS A;  3CS1 A;  1MUX A;  3GK4 X;  3KHE A;  2F2O A;  2K0J A;  3D0Y A;  1NCX A;  1DEK A;  1QV0 A;  2I18 A;  2LVJ A;  2K7O A;  3EK8 A;  1JBA A;  2NCP A;  3R1P A;  2WCB A;  1EL4 A;  3OP0 A;  3S0A A;  4BY5 A;  3B87 A;  4YGA A;  1W7I B;  1MXE A;  1TCF A;  3M0W A;  1PSB A;  1A29 A;  1R2U A;  2FJU B;  1CDN A;  3WNX B;  2HF5 A;  3TDI A;  2M97 A;  2BBN A;  1KCY A;  3F45 A;  1OOI X;  1DJW A;  3TS5 C;  2KI6 C;  1SW8 A;  3CGA A;  2MLE C;  4GGF A;  1QVI Z;  1QVI Y;  1IJ5 A;  2QAC A;  3DVK A;  2WOR A;  2HQW A;  4YI8 A;  1L7Z A;  1U5I B;  2BAP A;  1KK8 B;  1SNL A;  1RK9 A;  1RRO A;  1DQE A;  2LV7 A;  1JFK A;  5ER5 A;  4PE4 A;  1W7J B;  1Y1X A;  4GBA A;  3L47 A;  1CM4 A;  2BE4 A;  3K1E A;  5I94 A;  2KBM A;  3NXA A;  2M29 A;  1TIZ A;  1W9Z A;  3VRR A;  4PHN A;  1HT9 A;  1CMF A;  2OPO A;  1C7W A;  1CFD A;  1F4O A;  1KK7 Y;  1A75 A;  1NX1 A;  3QME A;  1CMG A;  1DMO A;  4ORB B;  2COL B;  1XA5 A;  5HKY A;  4MZJ A;  3SS5 A;  3SG5 A;  4D1E A;  1XK4 A;  2QEV A;  2M3W A;  2LAP A;  4YI9 A;  1UWO A;  1WLZ A;  3D76 A;  3PSR A;  1H8B A;  1K90 D;  1SCV A;  1K9U A;  5I2Q A;  2OTG B;  4QJ4 B;  3R1V A;  4JQ0 D;  3CR5 X;  1D1O A;  1NIW A;  4WQ2 A;  4R1E A;  2ZN8 A;  5D69 A;  1DEL A;  2M7N A;  4PE1 A;  4AQI A;  1V1F A;  3BYA A;  3NSO A;  1J1D A;  4INW A;  5CSJ A;  1SSE B;  1SMG A;  1YX8 A;  2LCP A;  4CPV A;  2BL0 C;  2EGD A;  3IF7 A;  2KDH A;  3NHI A;  2KPH A;  1F71 A;  1MQ1 A;  1IJ6 A;  2WCF A;  1FW4 A;  3BUN B;  1ZFS A;  1TWO A;  1Y1U A;  2PSR A;  2ZKM X;  1H4B A;  5ER4 X;  3SS3 A;  3D73 A;  1YUS A;  2P71 A;  2H61 A;  2NLN A;  1S6C A;  1A2X A;  1LS8 A;  2JTZ A;  2QEH A;  3LLE A;  1F55 A;  2IS9 A;  1TCO B;  4NDD A;  2EHB A;  3DY9 A;  4YRU A;  2JPT A;  1U5I A;  2JUL A;  2Y1N A;  4PHM A;  2P6B B;  1A03 A;  1YVH A;  2BCA A;  4IJ7 A;  2ERB A;  1M39 A;  2KBI A;  3BFB A;  3I5H B;  1QIV A;  3AKB A;  3LK0 A;  4NDB A;  3S0D A;  2JT3 A;  1CLM A;  1QXP A;  1SYM A;  1SKT A;  2MLF C;  4XYN A;  1L2O B;  1K94 A;  1J7R A;  5CSF A;  1EXR A;  1QX2 A;  4YGD B;  3CZ2 A;  2ISD A;  4F7F A;  1QWV A;  2JU0 A;  1B4C A;  4MN0 A;  3SIB A;  4DUQ A;  4L9M A;  5KTY A;  3UO9 A;  1YRU B;  4YGC B;  1Q80 A;  2JNX A;  1MXL C;  2BKI B;  2KLE A;  4Q04 A;  2LVV A;  4MZK A;  1G8I A;  1NX3 A;  1YTZ C;  2ZFD A;  1NX0 A;  5I2O A;  1QX7 A;  3FIA A;  2H8V A;  2KYC A;  3EVU A;  1F54 A;  4HSZ A;  4GUK A;  3BOW B;  1YUT A;  4UPG A;  4ETO A;  5I8N A;  2LLS A;  1DJI A;  1XFY O;  2K60 A;  2KAV A;  2LHI A;  1OSA A;  2PQL A;  5JJG A;  2GV5 A;  2QPT A;  2H61 C;  2LE9 B;  3UNW A;  2KI6 D;  2LC5 A;  1PSR A;  3VRN A;  4C0J A;  1ZUZ A;  3GK2 A;  4IL1 A;  4DIR A;  1CDM A;  1GM0 A;  4AQJ A;  1LXF C;  2M1U A;  1AJ5 A;  1REC A;  3RM1 A;  1AHR A;  3FE8 A;  1J1E A;  4FQO A;  3CAB A;  2OS8 C;  5DKQ A;  1CM1 A;  3SG4 A;  1TNQ A;  2TN4 A;  4MLW A;  4JD9 A;  3H4S E;  1RTP 1;  2BL0 B;  4BY4 A;  2MA2 A;  3EG5 B;  4N1G A;  1XFX O;  2CXJ A;  1C07 A;  2KOT A;  3DYE A;  1MR8 A;  5JOL A;  1UHJ A;  1EG3 A;  3JTD B;  1BF5 A;  3FE9 A;  5DIC A;  2L4I A;  2LP3 A;  2ZNE A;  3PLF B;  5D7F A;  2L98 A;  2LLU A;  1PUL A;  2WCL A;  3CTN A;  1ZOT B;  1KQM B;  2M8U A;  3TUY B;  1WDC C;  2PAL A;  3CWG A;  3PM2 A;  1M45 A;  1KWO C;  1QLK A;  1B47 A;  1VRK A;  2Q4U A;  1J7Q A;  2HPS A;  2ZRT A;  3FS7 A;  1CDP A;  5AXI A;  5AFP A;  4INX A;  1CLL A;  2KHN A;  3IVT A;  1CFF A;  4PE0 A;  4TNC A;  3VB1 A;  2L0P A;  3DF0 B;  3EK7 A;  1J7P A;  2G2B A;  3EVR A;  3I5G C;  4CID A;  1TN4 A;  4XJK A;  1QS7 A;  1Z2C B;  4MEW A;  5B8I B;  2KGR A;  1FI5 A;  2GGM A;  2D8N A;  3C1V A;  5IBW A;  4YGE B;  3SG7 A;  1C3Y A;  3L4A A;  1BMO A;  1B9A A;  1QV1 A;  2K7C A;  2LUX A;  2M49 B;  5CPV A;  1KK7 Z;  4MRY A;  5J3X A;  1S26 D;  2BCB A;  3B86 A;  3HCM A;  5AEQ A;  1G33 A;  2PAS A;  2KAX A;  3O78 A;  2G9B A;  2CBL A;  1K96 A;  2KFH A;  1WRZ A;  3BJH A;  1B8R A;  2QDI A; 
#chains in the Genus database with same CATH homology
 2GGZ A;  2I94 A;  4MRX A;  3BUW B;  2EC6 C;  1SCM C;  3I5I C;  3K21 A;  1ZAC A;  3OHM B;  1IG5 A;  1JUO A;  1CFC A;  2MAZ A;  2KI4 C;  4ICB A;  1R6P A;  1HQV A;  2OS8 B;  2WC8 A;  4I5N B;  1S6I A;  1SL8 A;  4HRE E;  3DVJ A;  4MSP A;  5AAN A;  1TRF A;  1YRT B;  2RGI A;  4GGF C;  1YUU A;  3PM8 A;  4PCW A;  2HQ8 A;  3VRP A;  3O4Y A;  1BG1 A;  2F3Z A;  1DT7 B;  1BLQ A;  1DJY A;  3VRO A;  1NP8 A;  2KQY A;  1TNP A;  5G08 A;  1BJF A;  1FPW A;  4PHJ A;  2K2F A;  2L51 A;  1QLS A;  1X02 A;  1WRL A;  2LAN A;  3NSK A;  1DJH A;  1AK8 A;  1JSA A;  4PE7 A;  1ODB A;  3DF0 A;  4N5X A;  1MF8 B;  1K2H A;  2JQ6 A;  1YX7 A;  1KWO B;  1Y1A A;  5KSZ A;  3BUO B;  1OZO A;  1BU3 A;  3VRQ A;  1NUB A;  3TS5 B;  1DGV A;  1YVL A;  1XK4 C;  1OMR A;  4DS7 A;  2L5X B;  3LCP C;  2K8M B;  1LIN A;  4WRI A;  2MBX A;  2NZ0 A;  2LVK A;  4WQ3 A;  4OCI A;  1OQP A;  1K93 D;  1S36 A;  3CR4 X;  4CLN A;  1WRK A;  2E30 A;  2K7D A;  2KSP A;  3AAK A;  3QRX A;  3WHT B;  1FI6 A;  2SCP A;  1QAS A;  4DCK A;  3CR2 A;  3SJS A;  1M46 A;  2AUC A;  4MZL A;  2BBM A;  2JXL A;  2A4J A;  4ZCU A;  1EG4 A;  2FCE A;  3OX5 A;  3FWB A;  3O6B A;  1JC2 A;  3E3R A;  3RLZ A;  3IQO A;  4JPZ B;  3SIA A;  4OKH A;  2M1K B;  2DOQ A;  2PMY A;  5GQQ C;  2CTN A;  1S3P A;  4CFR A;  1QAT A;  2BEC A;  3EKH A;  1SL9 A;  1CTR A;  1KQV A;  1G4Y R;  1B8C A;  4C0K A;  4I5L B;  1KK8 C;  1GGW A;  3SG3 A;  3EK4 A;  3VGO A;  1M63 B;  1RJV A;  4ORC B;  1IQ5 A;  1NCZ A;  1F70 A;  1XFZ O;  2JZI A;  1BR1 B;  2KFF A;  3LK1 A;  4GPL B;  4N1F A;  2L2E A;  1KFX L;  1WLM A;  2LMU A;  3OX6 A;  1LVC D;  2LUC A;  2FCD A;  3TDZ A;  2KYF A;  2LMT A;  1DF0 B;  2R2I A;  2K7B A;  1PRW A;  1SY9 A;  1QIW A;  1DTL A;  1CKK A;  3NSL A;  4PHK A;  1KFU L;  1S1E A;  4YBH B;  3I5F C;  1S5G Y;  3PN7 C;  3MSE B;  2MRD A;  3CLN A;  5HLO A;  2OTG C;  2AMI A;  1OMD A;  1OE9 B;  1LA3 A;  2Q91 A;  3NSI A;  3KPX A;  2JOJ A;  1OOJ A;  2M0R A;  1PK0 D;  1XFV O;  5CSN A;  2PVB A;  4MBE A;  4A4C A;  1KFU S;  1UP5 A;  4HRG A;  1JWD A;  1XO5 A;  3AKA A;  1NWD A;  2L50 A;  3BOW A;  3O2P A;  1MHO A;  1BT6 A;  5K89 A;  2BCX A;  1AUI B;  3ZNI A;  1XYD A;  2LM5 A;  2M7L A;  2O5G A;  1B1G A;  4QJ3 B;  1QX5 B;  1CNP A;  5DKR A;  2JRF A;  4NQG A;  5HKZ A;  1IH0 A;  4PDZ A;  1IRJ A;  2Y4Q A;  1SK6 D;  4MVF A;  5HYD A;  3OB2 B;  3I5H C;  1K9K A;  2MHH A;  2NXQ A;  1UUR A;  2Y1M A;  2HET A;  1QTX A;  2LMV A;  3OB1 B;  2LLT A;  1GQM A;  3BXK A;  5F6T A;  2ZRS A;  1L2O C;  3SG2 A;  3DVE A;  3HX4 A;  1NX2 A;  1F4Q A;  1YUR A;  3D10 A;  3WHU B;  1CB1 A;  1M31 A;  4U8D A;  1CDL A;  1DF0 A;  1XFW O;  4I5K A;  2KGB C;  4F0Z B;  1JFJ A;  3JVT C;  5HLV A;  1UHH A;  2O60 A;  4JWQ A;  2JNF A;  1UUS A;  2M9G A;  1SBJ A;  5BPJ A;  4E68 A;  1EJ3 A;  1KSO A;  2L4H A;  1SR6 C;  2JT8 A;  4I5J A;  3BUM B;  1RWY A;  2LP2 A;  3ICB A;  5CSI A;  2LHL A;  2K61 A;  1TOP A;  1QJT A;  3PAL A;  5TNC A;  1BOC A;  3A4U B;  1B8L A;  3TZ1 A;  1IGV A;  3GOF A;  3I5F B;  2F33 A;  3PN7 B;  2F2P A;  5I2L A;  4DRW A;  5PAL A;  1OMV A;  3IQQ A;  2KAY A;  3KF9 A;  1WDC B;  2WND A;  1NYA A;  2JWW A;  1AJ4 A;  4GFT A;  2NCO A;  1PVB A;  2AAO A;  3GK1 A;  1RFJ A;  4HRH A;  5AER A;  1WY9 A;  1NPQ A;  2I2R E;  2SAS A;  1C7V A;  3AAJ A;  3EVV A;  1PAL A;  3I5G B;  4OR9 B;  3LL8 B;  4AOM A;  2BE6 A;  2Y5I A;  2ZN9 A;  4GAO A;  4CFQ A;  1DJX A;  3JTD C;  1EH2 A;  4ORA B;  2MJW B;  1UHN A;  2LVI A;  1FBV A;  5KU1 A;  5DKN A;  1UHI A;  2FOT A;  3KEV A;  3KO0 A;  1KQM C;  2JXC A;  3TUY C;  3D0Y B;  2E6W A;  1IWQ A;  4GNK B;  4NDC A;  4YGB B;  1F8H A;  2WCE A;  1XVJ A;  4P5O E;  2PRU A;  4M2O A;  1J55 A;  2EC6 B;  1LA0 A;  1SCM B;  3A8R A;  2CCM A;  3BUX B;  3I5I B;  4PAL A;  3CZT X;  2JC2 A;  1UHK A;  1A4P A;  1NCY A;  2JT0 A;  1N0Y A;  1TNW A;  2KNE A;  1YR5 A;  4M2P A;  4MEW A;  1KSM A;  2KI4 B;  1XFU O;  1SRA A;  1J7O A;  1SL7 A;  2CT9 A;  3JVT B;  4QJ5 B;  1N2D A;  1ZMZ A;  4C0L A;  3BQ3 A;  1V1G A;  1JF0 A;  1ALV A;  1DJG A;  4GGN A;  1ALW A;  1MWN A;  4P2Y B;  1CLB A;  1S6J A;  2F3Y A;  1BOD A;  2VRG A;  4M2Q A;  1E8A A;  1K9P A;  1PVA A;  1Y6W A;  2JTT A;  4A4B A;  4FTG A;  1SR6 B;  2KFG A;  1DGU A;  4OVN F;  4XJK B;  1LKJ A;  1IQ3 A;  1CFP A;  3WXA A;  2I7A A;  1Y0V H;  2H2K A;  2WOS A;  1K95 A;  2V53 A;  5FYX A;  1DVI A;  4ZCV A;  4OV2 A;  1DJZ A;  1OZS A;  1SPY A;  2F8P A;  3SG6 A;  1GJY A;  2K2A A;  5HKW A;  1S5G Z;  1A75 B;  2LNK A;  3PAT A;  1IKU A;  1JF2 A;  4USL A;  3EKJ A;  1KFX S;  1TTX A;  1FF1 A;  3TDU A;  3FWC A;  3DD4 A;  3PFV A;  2ZND A;  1B7T Z;  1B7T Y;  2BKH B;  1K8U A;  1TNX A;  1AP4 A;  1N65 A;  1NSH A;  2KQ6 A;  2B1U A;  3DVM A;  1BR4 B;  3ZWH A;  1GGZ A;  2CNP A;  1AVS A;  3CS1 A;  1MUX A;  3GK4 X;  3KHE A;  2F2O A;  2K0J A;  3D0Y A;  1NCX A;  1QV0 A;  2I18 A;  2LVJ A;  1JBA A;  2K7O A;  3EK8 A;  2NCP A;  2WCB A;  1EL4 A;  3OP0 A;  4BY5 A;  4YGA A;  1W7I B;  1MXE A;  1TCF A;  3M0W A;  1PSB A;  1A29 A;  1R2U A;  2FJU B;  1CDN A;  3WNX B;  2HF5 A;  3TDI A;  2M97 A;  2BBN A;  1KCY A;  3F45 A;  3TS5 C;  1DJW A;  2KI6 C;  1SW8 A;  3CGA A;  2MLE C;  4GGF A;  1QVI Z;  1QVI Y;  1IJ5 A;  2QAC A;  3DVK A;  2WOR A;  2HQW A;  4YI8 A;  1L7Z A;  1U5I B;  1KK8 B;  1SNL A;  1RK9 A;  1RRO A;  2LV7 A;  1JFK A;  5ER5 A;  4PE4 A;  1W7J B;  1Y1X A;  4GBA A;  1CM4 A;  2BE4 A;  2KBM A;  3NXA A;  2M29 A;  1TIZ A;  3VRR A;  4PHN A;  1HT9 A;  1CMF A;  2OPO A;  1C7W A;  1CFD A;  1F4O A;  1KK7 Y;  1A75 A;  1NX1 A;  1CMG A;  1DMO A;  4ORB B;  2COL B;  1XA5 A;  5HKY A;  4MZJ A;  3SG5 A;  4D1E A;  1XK4 A;  2M3W A;  2LAP A;  4YI9 A;  1UWO A;  1WLZ A;  3PSR A;  1H8B A;  1K90 D;  1SCV A;  1K9U A;  5I2Q A;  2OTG B;  4QJ4 B;  4JQ0 D;  3CR5 X;  1D1O A;  1NIW A;  4WQ2 A;  4R1E A;  2ZN8 A;  5D69 A;  2M7N A;  4AQI A;  4PE1 A;  1V1F A;  3BYA A;  3NSO A;  1J1D A;  5CSJ A;  1SMG A;  1YX8 A;  2LCP A;  4CPV A;  2BL0 C;  2EGD A;  3IF7 A;  2KDH A;  1F71 A;  1MQ1 A;  1IJ6 A;  2WCF A;  1FW4 A;  3BUN B;  1ZFS A;  1Y1U A;  2PSR A;  2ZKM X;  1H4B A;  5ER4 X;  1YUS A;  2H61 A;  2NLN A;  1S6C A;  1A2X A;  1F55 A;  2JTZ A;  3LLE A;  2IS9 A;  1TCO B;  4NDD A;  2EHB A;  4YRU A;  2JPT A;  1U5I A;  2JUL A;  2Y1N A;  4PHM A;  2P6B B;  1A03 A;  1YVH A;  2BCA A;  3LK0 A;  1M39 A;  2KBI A;  3I5H B;  5AFP A;  1QIV A;  3AKB A;  4NDB A;  2JT3 A;  1CLM A;  1QXP A;  1SYM A;  1SKT A;  2MLF C;  4XYN A;  1L2O B;  1K94 A;  1J7R A;  5CSF A;  1EXR A;  1QX2 A;  4YGD B;  2ISD A;  2JU0 A;  1B4C A;  4MN0 A;  3SIB A;  4DUQ A;  4L9M A;  5KTY A;  1YRU B;  4YGC B;  1Q80 A;  2JNX A;  1MXL C;  2BKI B;  4Q04 A;  2LVV A;  4MZK A;  1G8I A;  1NX3 A;  1YTZ C;  2ZFD A;  1NX0 A;  5I2O A;  1QX7 A;  3FIA A;  2KYC A;  3EVU A;  1F54 A;  4HSZ A;  4GUK A;  3BOW B;  1YUT A;  4UPG A;  4ETO A;  5I8N A;  2LLS A;  1DJI A;  1XFY O;  2KAV A;  2LHI A;  1OSA A;  5JJG A;  2GV5 A;  2QPT A;  2H61 C;  2LE9 B;  2KI6 D;  2LC5 A;  1PSR A;  3VRN A;  4C0J A;  1ZUZ A;  3GK2 A;  4IL1 A;  4DIR A;  1CDM A;  4AQJ A;  1LXF C;  2M1U A;  1AJ5 A;  1REC A;  3RM1 A;  1AHR A;  1J1E A;  4FQO A;  2OS8 C;  5DKQ A;  1CM1 A;  3SG4 A;  1TNQ A;  2TN4 A;  4MLW A;  3H4S E;  1RTP 1;  2BL0 B;  4BY4 A;  2MA2 A;  4N1G A;  1XFX O;  2CXJ A;  1C07 A;  2KOT A;  1MR8 A;  5JOL A;  1UHJ A;  1EG3 A;  3JTD B;  1BF5 A;  2L4I A;  2LP3 A;  2ZNE A;  3PLF B;  5D7F A;  2L98 A;  2LLU A;  1PUL A;  3CTN A;  1ZOT B;  1KQM B;  2M8U A;  3TUY B;  1WDC C;  2PAL A;  3CWG A;  1M45 A;  1KWO C;  1QLK A;  1B47 A;  1VRK A;  2Q4U A;  1J7Q A;  2HPS A;  2ZRT A;  3FS7 A;  1CDP A;  5AXI A;  1CLL A;  2KHN A;  1CFF A;  4PE0 A;  4TNC A;  2L0P A;  3DF0 B;  3EK7 A;  1J7P A;  2G2B A;  3EVR A;  3I5G C;  4CID A;  1TN4 A;  4XJK A;  1QS7 A;  5B8I B;  2KGR A;  1FI5 A;  2GGM A;  2D8N A;  3C1V A;  5IBW A;  4YGE B;  3SG7 A;  1BMO A;  1B9A A;  1QV1 A;  2K7C A;  2LUX A;  2M49 B;  5CPV A;  1KK7 Z;  4MRY A;  5J3X A;  2BCB A;  1S26 D;  5AEQ A;  3HCM A;  1G33 A;  2PAS A;  2KAX A;  3O78 A;  2G9B A;  2CBL A;  1K96 A;  2KFH A;  1WRZ A;  1B8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...