1C07A

Structure of the third eps15 homology domain of human eps15
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
TWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (EPIDERMAL GROWTH FACTOR RECEPTOR PATHWAY SUBSTRATE
publication title Solution structure of Eps15's third EH domain reveals coincident Phe-Trp and Asn-Pro-Phe binding sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1999-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c07A00
4MN0A 4D1EA 4GGFC 3JVTB 1XFYO 1CFDA 3MSEB 1QIVA 2GGMA 2R2IA 2LUCA 1XA5A 5ER4X 2L2EA 1RFJA 1IQ3A 1DF0A 2MA2A 2BL0C 2LLTA 3PATA 2KQ6A 3EKJA 2KHNA 3TDIA 1FBVA 1KQMB 4PHMA 1MHOA 2B1UA 4DCKA 1J7RA 1QIWA 2K7OA 2LV7A 1AHRA 1QTXA 2GGZA 3BOWB 1XK4A 1RK9A 1WRZA 1YUUA 4GGNA 2G2BA 4YI9A 1B7TY 1EJ3A 1UUSA 2M49B 1XYDA 1LVCD 1QX5B 2Y4QA 1MF8B 1J7OA 4I5JA 1ALWA 3EVVA 1NX1A 2JTTA 2NXQA 1ODBA 4CLNA 3AAJA 1Y1XA 4L9MA 5AFPA 5D69A 1KFUS 2E30A 3BUNB 3PALA 2JQ6A 4YI8A 2LANA 1SCMB 3D0YA 2KFFA 4HRHA 5AXIA 2JRFA 2NZ0A 1YX8A 1UP5A 4USLA 1M46A 1M45A 2P6BB 5D7FA 4N1GA 5CSIA 2I18A 2NLNA 2KAVA 1DMOA 4XJKB 2ISDA 4R1EA 2KAXA 3PLFB 1U5IA 2BKIB 1K90D 1W7JB 2DOQA 2ZN9A 2WCBA 2PASA 1WRLA 1YURA 2A4JA 2OTGB 4GFTA 2LVKA 2SASA 2L51A 1CLBA 1OMDA 1SR6B 4HRGA 5JJGA 1CTRA 1B8LA 2LC5A 4NDBA 5I2QA 1BF5A 4UPGA 1Y6WA 1J7PA 1RECA 2MBXA 1OMVA 1KSOA 3TS5C 3FWBA 4ORCB 1XK4C 2PRUA 3SIAA 1B8RA 3CGAA 1J1DA 4GPLB 1SMGA 1NCYA 1FI5A 2CNPA 2OS8B 2RGIA 3I5FC 3LK0A 2BCBA 1J1EA 1TN4A 2ZFDA 3BQ3A 4OCIA 1F54A 1KWOC 1PVBA 1Y0VH 1QX7A 3VGOA 1YTZC 1WDCC 2JOJA 1TNWA 3BOWA 3C1VA 4PHKA 3TDUA 1KCYA 1RWYA 3KHEA 1MXLC 2FJUB 1A2XA 2JXLA 4TNCA 4YGCB 2BBMA 3EK8A 4JWQA 3BUXB 3SG5A 3KEVA 1ZMZA 2ZKMX 2LM5A 1K93D 1YUSA 1S5GY 3O4YA 4M2PA 3WHUB 1CM1A 2Q4UA 4ORBB 2JT3A 3JTDB 3I5GB 2M97A 2LVIA 1PVAA 4I5KA 4PE0A 4GNKB 4QJ5B 2WCFA 1MUXA 1OSAA 2L50A 2M1UA 4BY4A 5AEQA 1SW8A 2JU0A 4PCWA 1K8UA 2FCDA 1UURA 2LMTA 4N5XA 1ALVA 2JNFA 2KFGA 4XJKA 5B8IB 1TOPA 1M63B 3TUYB 1CMGA 1KFXS 2LUXA 3ICBA 3WNXB 1NCZA 1FF1A 3ZNIA 1XFWO 4I5LB 1CMFA 1UHNA 2QACA 2COLB 1NYAA 1QXPA 2H61C 1W7IB 2LVVA 1JF2A 3JVTC 5G08A 1IQ5A 3PM8A 1MWNA 1H4BA 2I7AA 4OR9B 5PALA 1HT9A 4HREE 4WQ3A 1RJVA 4YRUA 4YGEB 1V1FA 3BUMB 2MLFC 1BR1B 1DJIA 3M0WA 1V1GA 4FQOA 1QS7A 3HX4A 1JBAA 3VRRA 3O78A 3DVJA 1DJHA 3SG3A 4N1FA 3TZ1A 3WHTB 2TN4A 1SPYA 1AUIB 1S26D 3BUOB 1QV1A 2EC6B 1QASA 3OB1B 1EL4A 1QATA 5HKWA 2H2KA 1YRTB 5AANA 1SL8A 1S3PA 1S6IA 4C0LA 1JC2A 2O5GA 3GK4X 2NCPA 2LMUA 4AQIA 2L4HA 1B9AA 1ZACA 2KYCA 2QPTA 1HQVA 2F2OA 3DVKA 1M39A 1TNPA 4JPZB 4MVFA 5J3XA 1YUTA 1IG5A 2CT9A 1SCMC 1UHIA 4MZJA 1JSAA 4M2OA 1QVIZ 1KFUL 5CSFA 1LXFC 1JUOA 4XYNA 2CTNA 2HETA 4A4BA 1B1GA 1BJFA 1B8CA 2LVJA 3BXKA 3H4SE 1XO5A 1WLMA 1SCVA 1SYMA 2LNKA 4GBAA 1S36A 2PSRA 2HPSA 2KDHA 1BODA 3VRPA 1ZOTB 2WORA 3IF7A 2KI4C 1K95A 5KU1A 3RLZA 1EH2A 1A4PA 4DUQA 1NPQA 2ZNEA 1NIWA 4GAOA 3PN7B 2JULA 5I2LA 1K2HA 2OTGC 1AJ4A 1TCFA 2JPTA 2GV5A 1OMRA 1SR6C 2L0PA 1PSRA 1SBJA 3QRXA 1YRUB 1XFZO 1SY9A 1UHKA 3K21A 5I8NA 2JC2A 3F45A 4ORAB 3NSOA 2LLUA 4PALA 3A8RA 4MZKA 1VRKA 1KSMA 1SRAA 1A75B 2E6WA 2KGRA 3HCMA 1PALA 1B47A 3VRNA 1TNXA 1GGZA 3BYAA 3LLEA 4ICBA 2MRDA 4Q04A 1J7QA 1Y1AA 1CFCA 1BG1A 1F4OA 3VRQA 4AOMA 4CFQA 1N2DA 1FI6A 3OB2B 2HF5A 1BMOA 2HQWA 2LE9B 2OS8C 1XFXO 3CTNA 1AJ5A 3EK7A 1JF0A 1L2OC 2K7CA 2KGBC 2F33A 2KSPA 1UHHA 1B7TZ 2WCEA 3NXAA 2Y1MA 1QX2A 3PSRA 1CNPA 1ZFSA 5HYDA 5DKRA 1AP4A 4YGBB 1YR5A 4YGDB 4PE7A 4U8DA 1JFKA 3NSIA 5K89A 1AK8A 1G8IA 3I5HB 3OX6A 2Y5IA 3DVEA 2KBMA 3TS5B 5KSZA 4GUKA 1CLMA 1TCOB 3AAKA 3IQQA 4NDCA 2LLSA 1NWDA 4MBEA 4MRYA 2K2AA 4GGFA 1D1OA 1JWDA 2F2PA 2CXJA 3JTDC 3I5GC 1OE9B 3CR2A 3KO0A 5HLOA 2SCPA 4MRXA 2K61A 4MEWA 1ZUZA 2BECA 1WLZA 1DGVA 3I5FB 2Q91A 3PFVA 1KWOB 3SG2A 4AQJA 1GJYA 2CBLA 4E68A 2VRGA 1GQMA 3O6BA 4CPVA 3EVUA 1R2UA 4M2QA 1PULA 1IGVA 2K2FA 1CDPA 2JXCA 1KK8C 2M3WA 5FYXA 1KFXL 4OV2A 2FCEA 3EK4A 1F71A 3AKAA 3SG7A 1DJZA 2KFHA 1NUBA 5TNCA 2K0JA 2WC8A 1TTXA 3LK1A 4WQ2A 5DKQA 2G9BA 3SG6A 4PHNA 1IKUA 1H8BA 1TNQA 1MQ1A 2F8PA 1CB1A 1QLKA 3SG4A 4PE4A 4OVNF 1C7VA 3I5IB 1A75A 5HLVA 1XFVO 1KQMC 1SNLA 4WRIA 2JT0A 2JWWA 2MJWB 2EC6C 2EGDA 1IH0A 2L4IA 3DD4A 4MLWA 1OOJA 1F70A 2CCMA 1C07A 1DVIA 1KK7Z 2K8MB 2LP2A 2M29A 2ZNDA 1X02A 1QLSA 2L5XB 1BR4B 1BU3A 1OQPA 2LMVA 5BPJA 1DJXA 5I2OA 1GGWA 1F4QA 1NX3A 2JTZA 4PE1A 3DVMA 4DIRA 2AMIA 1F8HA 3NSKA 1DJYA 3CR4X 2KI6C 1F55A 1NX0A 2BL0B 1MR8A 3IQOA 1WRKA 1K96A 1S5GZ 1XVJA 2KBIA 2LHLA 1NCXA 1S6CA 1CDMA 1K94A 2KNEA 2PMYA 3GK1A 3OX5A 1PSBA 2WOSA 3KF9A 5F6TA 1N65A 5IBWA 1SL7A 3PN7C 1Q80A 3ZWHA 4A4CA 1BLQA 2OPOA 2O60A 3D10A 1RROA 1WY9A 1UWOA 3CS1A 4C0KA 2BCAA 3E3RA 3LL8B 2L98A 2ZRTA 2LAPA 1IJ6A 3WXAA 2LCPA 2NCOA 3DF0B 4C0JA 1R6PA 1YX7A 3EKHA 2BE4A 3CR5X 4CFRA 2BKHB 4QJ3B 2BE6A 1CLLA 2M8UA 1BT6A 1PRWA 4P5OE 3RM1A 1CFPA 3BUWB 1J55A 1OZOA 5GQQC 5HKZA 2FOTA 1FW4A 2ZN8A 3KPXA 3GK2A 2KI4B 2WNDA 4YBHB 1S6JA 2JT8A 2KI6D 2PALA 2I94A 3VROA 2K7BA 2D8NA 1N0YA 4BY5A 2MLEC 1B4CA 1EXRA 5DKNA 2AUCA 2F3ZA 4YGAA 2BBNA 1XFUO 2F3YA 3I5HC 1IRJA 3AKBA 1DF0B 2V53A 2KQYA 1DTLA 1CKKA 2MAZA 2MHHA 1TIZA 2BCXA 4MZLA 1OZSA 1MXEA 4QJ4B 3A4UB 4DS7A 2H61A 3LCPC 4ZCUA 1Y1UA 1LKJA 3EVRA 1IWQA 1NSHA 2LP3A 1LA0A 3SJSA 1DT7B 1DJGA 4CIDA 4DRWA 5HKYA 4OKHA 1L2OB 1EG4A 2I2RE 2JZIA 1CDLA 1KK7Y 1C7WA 1TRFA 1SL9A 2ZRSA 4HSZA 1RTP1 2M7LA 1EG3A 1PK0D 4F0ZB 1WDCB 2Y1NA 2EHBA 1LA3A 3D0YB 4IL1A 2M1KB 3TUYC 3O2PA 4MSPA 1JFJA 1QJTA 1DGUA 1YVHA 1M31A 1CFFA 3TDZA 1QVIY 1G33A 2M7NA 4ETOA 1NX2A 4ZCVA 4NQGA 3CWGA 2LHIA 1UHJA 3FIAA 2PVBA 2M9GA 3GOFA 1K9PA 2HQ8A 5CPVA 1LINA 1U5IB 3DF0A 1L7ZA 4JQ0D 2K7DA 2M0RA 2IS9A 3CZTX 1A03A 1BOCA 3I5IC 1FPWA 4PDZA 4I5NB 1IJ5A 5CSNA 3CLNA 1S1EA 3OP0A 4PHJA 1CDNA 2KYFA 3NSLA 5AERA 3SIBA 1G4YR 4FTGA 1QV0A 3OHMB 1AVSA 2AAOA 3FWCA 5ER5A 1YVLA 2KAYA 5CSJA 1K9KA 2KOTA 1KQVA 1E8AA 1KK8B 1NP8A 5JOLA 5KTYA 1SKTA 1CM4A 3FS7A 1DJWA 1K9UA 1SK6D 2JNXA 4NDDA 1A29A 4P2YB
chains in the Genus database with same CATH superfamily
4MN0A 4D1EA 3S0AA 3BJHA 3JVTB 1XFYO 1CFDA 4GGFC 3MSEB 1QIVA 2GGMA 2R2IA 3NHTA 2LUCA 1Z4HA 3IVTA 1XA5A 5ER4X 2L2EA 1RFJA 1IQ3A 1DF0A 2MA2A 2BL0C 2LLTA 3DYEA 2KQ6A 3EKJA 2BNXA 2KHNA 1FBVA 1KQMB 3PATA 1MHOA 2B1UA 4PHMA 3TDIA 1J7RA 1QIWA 2K7OA 4DCKA 2LV7A 4OZDA 1AHRA 1QTXA 2GGZA 3BOWB 1XK4A 1RK9A 1WRZA 1YUUA 3B86A 4GGNA 4IJ7A 1W9ZA 2G2BA 1B7TY 1EJ3A 1UUSA 2M49B 3D75A 4YI9A 1OOIX 1XYDA 1LVCD 1QX5B 2Y4QA 2BAPA 3B6XA 1MF8B 1J7OA 4I5JA 3CZ0A 1ALWA 3EVVA 1NX1A 2JTTA 2NXQA 1ODBA 4CLNA 3AAJA 1Y1XA 4L9MA 5AFPA 3D74A 5D69A 1KFUS 3B88A 2E30A 3BUNB 3PALA 2JQ6A 3CZ1A 4YI8A 2LANA 1SCMB 3D0YA 2WC6A 3S0DA 2WCKA 2KFFA 4HRHA 5AXIA 2JRFA 2NZ0A 1YX8A 3R72A 1UP5A 4USLA 1M46A 1M45A 2P6BB 3BFHA 3NGVA 5D7FA 3R1OA 4N1GA 1QWVA 2I18A 5CSIA 2NLNA 2KAVA 1DMOA 4XJKB 5D3OA 2ISDA 4R1EA 2KAXA 3PLFB 1U5IA 2BKIB 1K90D 1W7JB 2DOQA 2ZN9A 2WCBA 2PASA 1WRLA 1YURA 2A4JA 2OTGB 4GFTA 2LVKA 2SASA 2L51A 3B7AA 1CLBA 1OMDA 3BFBA 5FI2A 1SR6B 3S0BA 2P71A 3D78A 4HRGA 5JJGA 1CTRA 1B8LA 2LC5A 4NDBA 5I2QA 1BF5A 4UPGA 1Y6WA 1J7PA 1RECA 2MBXA 1OMVA 1KSOA 3S0GA 3TS5C 4FQTA 3FWBA 4ORCB 1XK4C 2PRUA 3SIAA 1XFRA 1B8RA 3CGAA 1J1DA 4GPLB 3N7HA 1SMGA 1NCYA 3D73A 1FI5A 2CNPA 2OS8B 2RGIA 3I5FC 3LK0A 2BCBA 1J1EA 1TN4A 2ZFDA 3BQ3A 4OCIA 1F54A 1KWOC 1PVBA 1Y0VH 1QX7A 3UO9A 3VGOA 1YTZC 1WDCC 2JOJA 1TNWA 3BOWA 3C1VA 4PHKA 3TDUA 1KCYA 1RWYA 3KHEA 1MXLC 2FJUB 3QMEA 1A2XA 2JXLA 4TNCA 4YGCB 2BBMA 3EK8A 4JWQA 3BUXB 5DICA 3SG5A 3KEVA 1ZMZA 1TUZA 2ZKMX 2LM5A 1OW4A 1K93D 1YUSA 3B87A 1S5GY 3O4YA 4M2PA 3WHUB 1CM1A 2Q4UA 4ORBB 2JT3A 3JTDB 3I5GB 2M97A 2LVIA 1PVAA 4I5KA 4PE0A 4GNKB 4QJ5B 2WCFA 1MUXA 1OSAA 2L50A 2M1UA 4BY4A 5AEQA 1SW8A 2JU0A 4PCWA 1K8UA 2FCDA 1UURA 2LMTA 4N5XA 1ALVA 2JNFA 2H8VA 2KFGA 4XJKA 5B8IB 1TOPA 1M63B 3TUYB 1CMGA 1KFXS 2LUXA 3ICBA 3OGNA 3WNXB 1NCZA 1FF1A 3ZNIA 1XFWO 4I5LB 1CMFA 1UHNA 2QACA 2COLB 1NYAA 1QXPA 2H61C 4JKTA 1W7IB 1Z2CB 1JF2A 2LVVA 3JVTC 1IQ5A 3PM8A 5G08A 3RZSA 1MWNA 1H4BA 2I7AA 3EG5B 4OR9B 5PALA 2ERBA 1HT9A 4HREE 4WQ3A 1RJVA 4YRUA 4YGEB 1V1FA 4INXA 3BUMB 2MLFC 1BR1B 1DJIA 3M0WA 1V1GA 4FQOA 1QS7A 3HX4A 3NHIA 2WCLA 1JBAA 3VRRA 3O78A 3DVJA 1DJHA 3SG3A 2KLEA 4N1FA 3TZ1A 3WHTB 2TN4A 1SPYA 1AUIB 1S26D 3BUOB 1QV1A 2EC6B 1QASA 3OB1B 1EL4A 1QATA 5HKWA 2H2KA 1YRTB 5AANA 1SL8A 1S3PA 1S6IA 4C0LA 1JC2A 2O5GA 3GK4X 2NCPA 2LMUA 4AQIA 2L4HA 3S0EA 1B9AA 1ZACA 2KYCA 2QPTA 1HQVA 2F2OA 2YGUA 3DVKA 1M39A 1TNPA 4JPZB 4MVFA 5J3XA 1YUTA 1IG5A 2CT9A 1SCMC 1UHIA 4MZJA 1JSAA 4M2OA 1QVIZ 1KFUL 5CSFA 1GM0A 1LXFC 1JUOA 4XYNA 2CTNA 2HETA 4A4BA 1B1GA 1BJFA 1B8CA 2LVJA 3BXKA 3H4SE 1XO5A 1WLMA 1SCVA 1SYMA 2LNKA 4GBAA 1S36A 2PSRA 2HPSA 2KDHA 1BODA 3VRPA 1ZOTB 2WORA 3IF7A 2KI4C 1K95A 5KU1A 3RLZA 1EH2A 1A4PA 4DUQA 1NPQA 2ZNEA 1NIWA 4GAOA 3PN7B 2JULA 5I2LA 3K1EA 1K2HA 2OTGC 1AJ4A 1TCFA 2JPTA 2GV5A 1OMRA 1SR6C 2L0PA 1PSRA 1SBJA 3QRXA 3PM2A 1YRUB 1IIOA 1XFZO 3SS3A 1SY9A 1UHKA 3K21A 5I8NA 1TUJA 1DEKA 2JC2A 3F45A 4ORAB 5HL1A 2QDIA 3NSOA 2LLUA 4PALA 3A8RA 4MZKA 1VRKA 3DY9A 1KSMA 1SRAA 4JD9A 1A75B 2E6WA 2KGRA 2WCJA 1PALA 1B47A 2QEVA 3HCMA 1TNXA 3PJIA 3VRNA 1GGZA 3BYAA 3LLEA 4ICBA 2MRDA 4Q04A 1J7QA 1Y1AA 1CFCA 3PSRA 1BG1A 1F4OA 3VRQA 4AOMA 4CFQA 1N2DA 3FE9A 1FI6A 3OB2B 2HF5A 1BMOA 2HQWA 2LE9B 2OS8C 1XFXO 3CTNA 1AJ5A 3EK7A 1JF0A 1L2OC 2K7CA 2KGBC 2F33A 2KSPA 1UHHA 1B7TZ 2WCEA 3NXAA 2Y1MA 1QX2A 2K60A 1CNPA 1ZFSA 5HYDA 5DKRA 1AP4A 4YGBB 1YR5A 3BFAA 4YGDB 4PE7A 4U8DA 1JFKA 3NSIA 5K89A 1AK8A 1G8IA 3I5HB 3OX6A 2Y5IA 3DVEA 2KBMA 3TS5B 5KSZA 3FE6A 4GUKA 1P28A 1CLMA 1SSEB 1TCOB 3AAKA 5FI6A 3IQQA 4NDCA 2LLSA 1NWDA 4MBEA 4MRYA 2K2AA 4GGFA 1D1OA 1JWDA 2F2PA 2CXJA 3JTDC 3I5GC 1OE9B 3CR2A 3KO0A 5HLOA 2SCPA 4MRXA 5FI7A 2K61A 1DELA 4MEWA 1ZUZA 2BECA 3L4AA 1WLZA 1DGVA 3I5FB 2Q91A 3PFVA 1KWOB 3SG2A 4AQJA 1GJYA 2CBLA 4E68A 2VRGA 1GQMA 3O6BA 4CPVA 3EVUA 1R2UA 4M2QA 1C3ZA 3S0FA 1PULA 1IGVA 2QEHA 2K2FA 2KLDA 4PT1A 1ORGA 1CDPA 2JXCA 1KK8C 2M3WA 5FYXA 1KFXL 4OV2A 2FCEA 3EK4A 1F71A 3AKAA 3L4LA 3SG7A 1DJZA 2KFHA 1NUBA 5TNCA 2WC5A 2K0JA 2WC8A 1TTXA 3LK1A 4WQ2A 5DKQA 2G9BA 3SG6A 4PHNA 1IKUA 1H8BA 2PQLA 1TNQA 1MQ1A 2F8PA 1CB1A 1QLKA 3SG4A 4PE4A 4OVNF 1C7VA 3I5IB 1A75A 5HLVA 1XFVO 1KQMC 1SNLA 4WRIA 2JT0A 2JWWA 2MJWB 2EC6C 2EGDA 1IH0A 2L4IA 3DD4A 4MLWA 3SS4A 1OOJA 2WCMA 1F70A 2CCMA 1C07A 3CABA 1DVIA 1KK7Z 2K8MB 2LP2A 1OOFA 2M29A 2ZNDA 1X02A 1QLSA 2L5XB 1BR4B 1BU3A 1OQPA 2LMVA 5BPJA 1C3YA 1DJXA 5I2OA 1GGWA 1F4QA 1NX3A 2L2CA 2JTZA 4PE1A 3DVMA 4DIRA 2AMIA 1F8HA 3NSKA 3Q8IA 1DJYA 3CR4X 2KI6C 1F55A 1LS8A 1NX0A 2BL0B 1MR8A 3IQOA 1WRKA 1K96A 1S5GZ 1XVJA 2KBIA 2LHLA 1NCXA 1S6CA 3DXLA 1CDMA 1K94A 2KNEA 2PMYA 3GK1A 3OX5A 1PSBA 2WOSA 3KF9A 5F6TA 1N65A 5IBWA 3R1VA 1SL7A 3PN7C 1Q80A 3CDNA 3ZWHA 4A4CA 1BLQA 2OPOA 2O60A 3D10A 1DQEA 1RROA 5I94A 1WY9A 1UWOA 3CS1A 4C0KA 2BCAA 3E3RA 3LL8B 2L98A 2ZRTA 2LAPA 1IJ6A 3WXAA 2LCPA 2NCOA 5EL2A 3DF0B 4C0JA 1R6PA 1YX7A 3EKHA 2BE4A 3CR5X 4CFRA 2BKHB 3D76A 4QJ3B 2BE6A 1CLLA 3FE8A 2M8UA 1BT6A 3SS5A 1PRWA 4F7FA 4P5OE 3RM1A 1CFPA 3BUWB 1J55A 1OZOA 2P70A 5GQQC 2FOTA 1FW4A 2JPOA 2ZN8A 5HKZA 3KPXA 3GK2A 3VB1A 2KI4B 2WNDA 4YBHB 1S6JA 3UNWA 2JT8A 2KI6D 2PALA 2I94A 3VROA 2K7BA 2GTEA 2D8NA 1N0YA 4BY5A 2MLEC 1B4CA 1EXRA 5DKNA 2AUCA 2WCHA 2F3ZA 3O4XA 4YGAA 2BBNA 3R1PA 1XFUO 4INWA 2F3YA 3I5HC 1IRJA 3AKBA 1OOGA 1DF0B 2V53A 3DZTA 2KQYA 1DTLA 1CKKA 2MAZA 2MHHA 1TIZA 2BCXA 4MZLA 1OZSA 1MXEA 4QJ4B 3A4UB 4DS7A 2H61A 3CYZA 3LCPC 4ZCUA 1Y1UA 1LKJA 3EVRA 1IWQA 3V2LA 1NSHA 2LP3A 1LA0A 1T14A 3SJSA 1DT7B 1DJGA 4KYNA 4CIDA 4DRWA 5HKYA 3L47A 4OKHA 1L2OB 1EG4A 2I2RE 2JZIA 1CDLA 1KK7Y 1C7WA 1OOHA 1TRFA 1SL9A 2ZRSA 4HSZA 1RTP1 2M7LA 1EG3A 1PK0D 4F0ZB 1WDCB 2Y1NA 2EHBA 1LA3A 3D0YB 4IL1A 2M1KB 3TUYC 3O2PA 4MSPA 1JFJA 1QJTA 1DGUA 1YVHA 1M31A 1CFFA 2L5YA 2KPHA 3TDZA 1QVIY 1G33A 2M7NA 4ETOA 1NX2A 1TWOA 4ZCVA 1DC1A 4NQGA 3CWGA 2LHIA 1UHJA 3FIAA 2PVBA 2M9GA 3GOFA 1K9PA 2HQ8A 5CPVA 1LINA 1U5IB 3DF0A 1L7ZA 3OBVA 2K7DA 2M0RA 2IS9A 3CZTX 4JQ0D 1A03A 1BOCA 3I5IC 1FPWA 4PDZA 4I5NB 3D77A 1IJ5A 5CSNA 3CLNA 2QEBA 1S1EA 3OP0A 4PHJA 1CDNA 2KYFA 3NSLA 5AERA 3SIBA 1G4YR 4FTGA 1QV0A 3OHMB 1AVSA 2AAOA 3FWCA 5ER5A 1YVLA 2KAYA 5CSJA 1K9KA 2KOTA 1KQVA 1E8AA 1KK8B 1NP8A 5JOLA 5KTYA 1SKTA 1CM4A 2FJYA 3FS7A 2QEOA 3CZ2A 1DJWA 1K9UA 1SK6D 2JNXA 2PYQA 4NDDA 1A29A 4P2YB
chains in the Genus database with same CATH topology
4MN0A 4D1EA 4GGFC 3JVTB 1XFYO 1CFDA 3MSEB 1QIVA 2GGMA 2R2IA 2LUCA 1XA5A 5ER4X 2L2EA 1RFJA 1IQ3A 1DF0A 2MA2A 2BL0C 2LLTA 3PATA 2KQ6A 3EKJA 2KHNA 3TDIA 1FBVA 1KQMB 4PHMA 1MHOA 2B1UA 4DCKA 1J7RA 1QIWA 2K7OA 2LV7A 1AHRA 1QTXA 2GGZA 3BOWB 1XK4A 1RK9A 1WRZA 1YUUA 4GGNA 2G2BA 4YI9A 1B7TY 1EJ3A 1UUSA 2M49B 1XYDA 1LVCD 1QX5B 2Y4QA 1MF8B 1J7OA 4I5JA 1ALWA 3EVVA 1NX1A 2JTTA 2NXQA 1ODBA 4CLNA 3AAJA 1Y1XA 4L9MA 5AFPA 5D69A 1KFUS 2E30A 3BUNB 3PALA 2JQ6A 4YI8A 2LANA 1SCMB 3D0YA 2KFFA 4HRHA 5AXIA 2JRFA 2NZ0A 1YX8A 1UP5A 4USLA 1M46A 1M45A 2P6BB 5D7FA 4N1GA 5CSIA 2I18A 2NLNA 2KAVA 1DMOA 4XJKB 2ISDA 4R1EA 2KAXA 3PLFB 1U5IA 2BKIB 1K90D 1W7JB 2DOQA 2ZN9A 2WCBA 2PASA 1WRLA 1YURA 2A4JA 2OTGB 4GFTA 2LVKA 2SASA 2L51A 1CLBA 1OMDA 1SR6B 4HRGA 5JJGA 1CTRA 1B8LA 2LC5A 4NDBA 5I2QA 1BF5A 4UPGA 1Y6WA 1J7PA 1RECA 2MBXA 1OMVA 1KSOA 3TS5C 3FWBA 4ORCB 1XK4C 2PRUA 3SIAA 1B8RA 3CGAA 1J1DA 4GPLB 1SMGA 1NCYA 1FI5A 2CNPA 2OS8B 2RGIA 3I5FC 3LK0A 2BCBA 1J1EA 1TN4A 2ZFDA 3BQ3A 4OCIA 1F54A 1KWOC 1PVBA 1Y0VH 1QX7A 3VGOA 1YTZC 1WDCC 2JOJA 1TNWA 3BOWA 3C1VA 4PHKA 3TDUA 1KCYA 1RWYA 3KHEA 1MXLC 2FJUB 1A2XA 2JXLA 4TNCA 4YGCB 2BBMA 3EK8A 4JWQA 3BUXB 3SG5A 3KEVA 1ZMZA 2ZKMX 2LM5A 1K93D 1YUSA 1S5GY 3O4YA 4M2PA 3WHUB 1CM1A 2Q4UA 4ORBB 2JT3A 3JTDB 3I5GB 2M97A 2LVIA 1PVAA 4I5KA 4PE0A 4GNKB 4QJ5B 2WCFA 1MUXA 1OSAA 2L50A 2M1UA 4BY4A 5AEQA 1SW8A 2JU0A 4PCWA 1K8UA 2FCDA 1UURA 2LMTA 4N5XA 1ALVA 2JNFA 2KFGA 4XJKA 5B8IB 1TOPA 1M63B 3TUYB 1CMGA 1KFXS 2LUXA 3ICBA 3WNXB 1NCZA 1FF1A 3ZNIA 1XFWO 4I5LB 1CMFA 1UHNA 2QACA 2COLB 1NYAA 1QXPA 2H61C 1W7IB 2LVVA 1JF2A 3JVTC 5G08A 1IQ5A 3PM8A 1MWNA 1H4BA 2I7AA 4OR9B 5PALA 1HT9A 4HREE 4WQ3A 1RJVA 4YRUA 4YGEB 1V1FA 3BUMB 2MLFC 1BR1B 1DJIA 3M0WA 1V1GA 4FQOA 1QS7A 3HX4A 1JBAA 3VRRA 3O78A 3DVJA 1DJHA 3SG3A 4N1FA 3TZ1A 3WHTB 2TN4A 1SPYA 1AUIB 1S26D 3BUOB 1QV1A 2EC6B 1QASA 3OB1B 1EL4A 1QATA 5HKWA 2H2KA 1YRTB 5AANA 1SL8A 1S3PA 1S6IA 4C0LA 1JC2A 2O5GA 3GK4X 2NCPA 2LMUA 4AQIA 2L4HA 1B9AA 1ZACA 2KYCA 2QPTA 1HQVA 2F2OA 3DVKA 1M39A 1TNPA 4JPZB 4MVFA 5J3XA 1YUTA 1IG5A 2CT9A 1SCMC 1UHIA 4MZJA 1JSAA 4M2OA 1QVIZ 1KFUL 5CSFA 1LXFC 1JUOA 4XYNA 2CTNA 2HETA 4A4BA 1B1GA 1BJFA 1B8CA 2LVJA 3BXKA 3H4SE 1XO5A 1WLMA 1SCVA 1SYMA 2LNKA 4GBAA 1S36A 2PSRA 2HPSA 2KDHA 1BODA 3VRPA 1ZOTB 2WORA 3IF7A 2KI4C 1K95A 5KU1A 3RLZA 1EH2A 1A4PA 4DUQA 1NPQA 2ZNEA 1NIWA 4GAOA 3PN7B 2JULA 5I2LA 1K2HA 2OTGC 1AJ4A 1TCFA 2JPTA 2GV5A 1OMRA 1SR6C 2L0PA 1PSRA 1SBJA 3QRXA 1YRUB 1XFZO 1SY9A 1UHKA 3K21A 5I8NA 2JC2A 3F45A 4ORAB 3NSOA 2LLUA 4PALA 3A8RA 4MZKA 1VRKA 1KSMA 1SRAA 1A75B 2E6WA 2KGRA 3HCMA 1PALA 1B47A 3VRNA 1TNXA 1GGZA 3BYAA 3LLEA 4ICBA 2MRDA 4Q04A 1J7QA 1Y1AA 1CFCA 1BG1A 1F4OA 3VRQA 4AOMA 4CFQA 1N2DA 1FI6A 3OB2B 2HF5A 1BMOA 2HQWA 2LE9B 2OS8C 1XFXO 3CTNA 1AJ5A 3EK7A 1JF0A 1L2OC 2K7CA 2KGBC 2F33A 2KSPA 1UHHA 1B7TZ 2WCEA 3NXAA 2Y1MA 1QX2A 3PSRA 1CNPA 1ZFSA 5HYDA 5DKRA 1AP4A 4YGBB 1YR5A 4YGDB 4PE7A 4U8DA 1JFKA 3NSIA 5K89A 1AK8A 1G8IA 3I5HB 3OX6A 2Y5IA 3DVEA 2KBMA 3TS5B 5KSZA 4GUKA 1CLMA 1TCOB 3AAKA 3IQQA 4NDCA 2LLSA 1NWDA 4MBEA 4MRYA 2K2AA 4GGFA 1D1OA 1JWDA 2F2PA 2CXJA 3JTDC 3I5GC 1OE9B 3CR2A 3KO0A 5HLOA 2SCPA 4MRXA 2K61A 4MEWA 1ZUZA 2BECA 1WLZA 1DGVA 3I5FB 2Q91A 3PFVA 1KWOB 3SG2A 4AQJA 1GJYA 2CBLA 4E68A 2VRGA 1GQMA 3O6BA 4CPVA 3EVUA 1R2UA 4M2QA 1PULA 1IGVA 2K2FA 1CDPA 2JXCA 1KK8C 2M3WA 5FYXA 1KFXL 4OV2A 2FCEA 3EK4A 1F71A 3AKAA 3SG7A 1DJZA 2KFHA 1NUBA 5TNCA 2K0JA 2WC8A 1TTXA 3LK1A 4WQ2A 5DKQA 2G9BA 3SG6A 4PHNA 1IKUA 1H8BA 1TNQA 1MQ1A 2F8PA 1CB1A 1QLKA 3SG4A 4PE4A 4OVNF 1C7VA 3I5IB 1A75A 5HLVA 1XFVO 1KQMC 1SNLA 4WRIA 2JT0A 2JWWA 2MJWB 2EC6C 2EGDA 1IH0A 2L4IA 3DD4A 4MLWA 1OOJA 1F70A 2CCMA 1C07A 1DVIA 1KK7Z 2K8MB 2LP2A 2M29A 2ZNDA 1X02A 1QLSA 2L5XB 1BR4B 1BU3A 1OQPA 2LMVA 5BPJA 1DJXA 5I2OA 1GGWA 1F4QA 1NX3A 2JTZA 4PE1A 3DVMA 4DIRA 2AMIA 1F8HA 3NSKA 1DJYA 3CR4X 2KI6C 1F55A 1NX0A 2BL0B 1MR8A 3IQOA 1WRKA 1K96A 1S5GZ 1XVJA 2KBIA 2LHLA 1NCXA 1S6CA 1CDMA 1K94A 2KNEA 2PMYA 3GK1A 3OX5A 1PSBA 2WOSA 3KF9A 5F6TA 1N65A 5IBWA 1SL7A 3PN7C 1Q80A 3ZWHA 4A4CA 1BLQA 2OPOA 2O60A 3D10A 1RROA 1WY9A 1UWOA 3CS1A 4C0KA 2BCAA 3E3RA 3LL8B 2L98A 2ZRTA 2LAPA 1IJ6A 3WXAA 2LCPA 2NCOA 3DF0B 4C0JA 1R6PA 1YX7A 3EKHA 2BE4A 3CR5X 4CFRA 2BKHB 4QJ3B 2BE6A 1CLLA 2M8UA 1BT6A 1PRWA 4P5OE 3RM1A 1CFPA 3BUWB 1J55A 1OZOA 5GQQC 5HKZA 2FOTA 1FW4A 2ZN8A 3KPXA 3GK2A 2KI4B 2WNDA 4YBHB 1S6JA 2JT8A 2KI6D 2PALA 2I94A 3VROA 2K7BA 2D8NA 1N0YA 4BY5A 2MLEC 1B4CA 1EXRA 5DKNA 2AUCA 2F3ZA 4YGAA 2BBNA 1XFUO 2F3YA 3I5HC 1IRJA 3AKBA 1DF0B 2V53A 2KQYA 1DTLA 1CKKA 2MAZA 2MHHA 1TIZA 2BCXA 4MZLA 1OZSA 1MXEA 4QJ4B 3A4UB 4DS7A 2H61A 3LCPC 4ZCUA 1Y1UA 1LKJA 3EVRA 1IWQA 1NSHA 2LP3A 1LA0A 3SJSA 1DT7B 1DJGA 4CIDA 4DRWA 5HKYA 4OKHA 1L2OB 1EG4A 2I2RE 2JZIA 1CDLA 1KK7Y 1C7WA 1TRFA 1SL9A 2ZRSA 4HSZA 1RTP1 2M7LA 1EG3A 1PK0D 4F0ZB 1WDCB 2Y1NA 2EHBA 1LA3A 3D0YB 4IL1A 2M1KB 3TUYC 3O2PA 4MSPA 1JFJA 1QJTA 1DGUA 1YVHA 1M31A 1CFFA 3TDZA 1QVIY 1G33A 2M7NA 4ETOA 1NX2A 4ZCVA 4NQGA 3CWGA 2LHIA 1UHJA 3FIAA 2PVBA 2M9GA 3GOFA 1K9PA 2HQ8A 5CPVA 1LINA 1U5IB 3DF0A 1L7ZA 4JQ0D 2K7DA 2M0RA 2IS9A 3CZTX 1A03A 1BOCA 3I5IC 1FPWA 4PDZA 4I5NB 1IJ5A 5CSNA 3CLNA 1S1EA 3OP0A 4PHJA 1CDNA 2KYFA 3NSLA 5AERA 3SIBA 1G4YR 4FTGA 1QV0A 3OHMB 1AVSA 2AAOA 3FWCA 5ER5A 1YVLA 2KAYA 5CSJA 1K9KA 2KOTA 1KQVA 1E8AA 1KK8B 1NP8A 5JOLA 5KTYA 1SKTA 1CM4A 3FS7A 1DJWA 1K9UA 1SK6D 2JNXA 4NDDA 1A29A 4P2YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN0 A;  4D1E A;  4GGF C;  3JVT B;  1XFY O;  1CFD A;  3MSE B;  1QIV A;  2GGM A;  2R2I A;  2LUC A;  1XA5 A;  5ER4 X;  2L2E A;  1RFJ A;  1IQ3 A;  1DF0 A;  2MA2 A;  2BL0 C;  2LLT A;  3PAT A;  2KQ6 A;  3EKJ A;  2KHN A;  3TDI A;  1FBV A;  1KQM B;  4PHM A;  1MHO A;  2B1U A;  4DCK A;  1J7R A;  1QIW A;  2K7O A;  2LV7 A;  1AHR A;  1QTX A;  2GGZ A;  3BOW B;  1XK4 A;  1RK9 A;  1WRZ A;  1YUU A;  4GGN A;  2G2B A;  4YI9 A;  1B7T Y;  1EJ3 A;  1UUS A;  2M49 B;  1XYD A;  1LVC D;  1QX5 B;  2Y4Q A;  1MF8 B;  1J7O A;  4I5J A;  1ALW A;  3EVV A;  1NX1 A;  2JTT A;  2NXQ A;  1ODB A;  4CLN A;  3AAJ A;  1Y1X A;  4L9M A;  5AFP A;  5D69 A;  1KFU S;  2E30 A;  3BUN B;  3PAL A;  2JQ6 A;  4YI8 A;  2LAN A;  1SCM B;  3D0Y A;  2KFF A;  4HRH A;  5AXI A;  2JRF A;  2NZ0 A;  1YX8 A;  1UP5 A;  4USL A;  1M46 A;  1M45 A;  2P6B B;  5D7F A;  4N1G A;  5CSI A;  2I18 A;  2NLN A;  2KAV A;  1DMO A;  4XJK B;  2ISD A;  4R1E A;  2KAX A;  3PLF B;  1U5I A;  2BKI B;  1K90 D;  1W7J B;  2DOQ A;  2ZN9 A;  2WCB A;  2PAS A;  1WRL A;  1YUR A;  2A4J A;  2OTG B;  4GFT A;  2LVK A;  2SAS A;  2L51 A;  1CLB A;  1OMD A;  1SR6 B;  4HRG A;  5JJG A;  1CTR A;  1B8L A;  2LC5 A;  4NDB A;  5I2Q A;  1BF5 A;  4UPG A;  1Y6W A;  1J7P A;  1REC A;  2MBX A;  1OMV A;  1KSO A;  3TS5 C;  3FWB A;  4ORC B;  1XK4 C;  2PRU A;  3SIA A;  1B8R A;  3CGA A;  1J1D A;  4GPL B;  1SMG A;  1NCY A;  1FI5 A;  2CNP A;  2OS8 B;  2RGI A;  3I5F C;  3LK0 A;  2BCB A;  1J1E A;  1TN4 A;  2ZFD A;  3BQ3 A;  4OCI A;  1F54 A;  1KWO C;  1PVB A;  1Y0V H;  1QX7 A;  3VGO A;  1YTZ C;  1WDC C;  2JOJ A;  1TNW A;  3BOW A;  3C1V A;  4PHK A;  3TDU A;  1KCY A;  1RWY A;  3KHE A;  1MXL C;  2FJU B;  1A2X A;  2JXL A;  4TNC A;  4YGC B;  2BBM A;  3EK8 A;  4JWQ A;  3BUX B;  3SG5 A;  3KEV A;  1ZMZ A;  2ZKM X;  2LM5 A;  1K93 D;  1YUS A;  1S5G Y;  3O4Y A;  4M2P A;  3WHU B;  1CM1 A;  2Q4U A;  4ORB B;  2JT3 A;  3JTD B;  3I5G B;  2M97 A;  2LVI A;  1PVA A;  4I5K A;  4PE0 A;  4GNK B;  4QJ5 B;  2WCF A;  1MUX A;  1OSA A;  2L50 A;  2M1U A;  4BY4 A;  5AEQ A;  1SW8 A;  2JU0 A;  4PCW A;  1K8U A;  2FCD A;  1UUR A;  2LMT A;  4N5X A;  1ALV A;  2JNF A;  2KFG A;  4XJK A;  5B8I B;  1TOP A;  1M63 B;  3TUY B;  1CMG A;  1KFX S;  2LUX A;  3ICB A;  3WNX B;  1NCZ A;  1FF1 A;  3ZNI A;  1XFW O;  4I5L B;  1CMF A;  1UHN A;  2QAC A;  2COL B;  1NYA A;  1QXP A;  2H61 C;  1W7I B;  2LVV A;  1JF2 A;  3JVT C;  5G08 A;  1IQ5 A;  3PM8 A;  1MWN A;  1H4B A;  2I7A A;  4OR9 B;  5PAL A;  1HT9 A;  4HRE E;  4WQ3 A;  1RJV A;  4YRU A;  4YGE B;  1V1F A;  3BUM B;  2MLF C;  1BR1 B;  1DJI A;  3M0W A;  1V1G A;  4FQO A;  1QS7 A;  3HX4 A;  1JBA A;  3VRR A;  3O78 A;  3DVJ A;  1DJH A;  3SG3 A;  4N1F A;  3TZ1 A;  3WHT B;  2TN4 A;  1SPY A;  1AUI B;  1S26 D;  3BUO B;  1QV1 A;  2EC6 B;  1QAS A;  3OB1 B;  1EL4 A;  1QAT A;  5HKW A;  2H2K A;  1YRT B;  5AAN A;  1SL8 A;  1S3P A;  1S6I A;  4C0L A;  1JC2 A;  2O5G A;  3GK4 X;  2NCP A;  2LMU A;  4AQI A;  2L4H A;  1B9A A;  1ZAC A;  2KYC A;  2QPT A;  1HQV A;  2F2O A;  3DVK A;  1M39 A;  1TNP A;  4JPZ B;  4MVF A;  5J3X A;  1YUT A;  1IG5 A;  2CT9 A;  1SCM C;  1UHI A;  4MZJ A;  1JSA A;  4M2O A;  1QVI Z;  1KFU L;  5CSF A;  1LXF C;  1JUO A;  4XYN A;  2CTN A;  2HET A;  4A4B A;  1B1G A;  1BJF A;  1B8C A;  2LVJ A;  3BXK A;  3H4S E;  1XO5 A;  1WLM A;  1SCV A;  1SYM A;  2LNK A;  4GBA A;  1S36 A;  2PSR A;  2HPS A;  2KDH A;  1BOD A;  3VRP A;  1ZOT B;  2WOR A;  3IF7 A;  2KI4 C;  1K95 A;  5KU1 A;  3RLZ A;  1EH2 A;  1A4P A;  4DUQ A;  1NPQ A;  2ZNE A;  1NIW A;  4GAO A;  3PN7 B;  2JUL A;  5I2L A;  1K2H A;  2OTG C;  1AJ4 A;  1TCF A;  2JPT A;  2GV5 A;  1OMR A;  1SR6 C;  2L0P A;  1PSR A;  1SBJ A;  3QRX A;  1YRU B;  1XFZ O;  1SY9 A;  1UHK A;  3K21 A;  5I8N A;  2JC2 A;  3F45 A;  4ORA B;  3NSO A;  2LLU A;  4PAL A;  3A8R A;  4MZK A;  1VRK A;  1KSM A;  1SRA A;  1A75 B;  2E6W A;  2KGR A;  3HCM A;  1PAL A;  1B47 A;  3VRN A;  1TNX A;  1GGZ A;  3BYA A;  3LLE A;  4ICB A;  2MRD A;  4Q04 A;  1J7Q A;  1Y1A A;  1CFC A;  1BG1 A;  1F4O A;  3VRQ A;  4AOM A;  4CFQ A;  1N2D A;  1FI6 A;  3OB2 B;  2HF5 A;  1BMO A;  2HQW A;  2LE9 B;  2OS8 C;  1XFX O;  3CTN A;  1AJ5 A;  3EK7 A;  1JF0 A;  1L2O C;  2K7C A;  2KGB C;  2F33 A;  2KSP A;  1UHH A;  1B7T Z;  2WCE A;  3NXA A;  2Y1M A;  1QX2 A;  3PSR A;  1CNP A;  1ZFS A;  5HYD A;  5DKR A;  1AP4 A;  4YGB B;  1YR5 A;  4YGD B;  4PE7 A;  4U8D A;  1JFK A;  3NSI A;  5K89 A;  1AK8 A;  1G8I A;  3I5H B;  3OX6 A;  2Y5I A;  3DVE A;  2KBM A;  3TS5 B;  5KSZ A;  4GUK A;  1CLM A;  1TCO B;  3AAK A;  3IQQ A;  4NDC A;  2LLS A;  1NWD A;  4MBE A;  4MRY A;  2K2A A;  4GGF A;  1D1O A;  1JWD A;  2F2P A;  2CXJ A;  3JTD C;  3I5G C;  1OE9 B;  3CR2 A;  3KO0 A;  5HLO A;  2SCP A;  4MRX A;  2K61 A;  4MEW A;  1ZUZ A;  2BEC A;  1WLZ A;  1DGV A;  3I5F B;  2Q91 A;  3PFV A;  1KWO B;  3SG2 A;  4AQJ A;  1GJY A;  2CBL A;  4E68 A;  2VRG A;  1GQM A;  3O6B A;  4CPV A;  3EVU A;  1R2U A;  4M2Q A;  1PUL A;  1IGV A;  2K2F A;  1CDP A;  2JXC A;  1KK8 C;  2M3W A;  5FYX A;  1KFX L;  4OV2 A;  2FCE A;  3EK4 A;  1F71 A;  3AKA A;  3SG7 A;  1DJZ A;  2KFH A;  1NUB A;  5TNC A;  2K0J A;  2WC8 A;  1TTX A;  3LK1 A;  4WQ2 A;  5DKQ A;  2G9B A;  3SG6 A;  4PHN A;  1IKU A;  1H8B A;  1TNQ A;  1MQ1 A;  2F8P A;  1CB1 A;  1QLK A;  3SG4 A;  4PE4 A;  4OVN F;  1C7V A;  3I5I B;  1A75 A;  5HLV A;  1XFV O;  1KQM C;  1SNL A;  4WRI A;  2JT0 A;  2JWW A;  2MJW B;  2EC6 C;  2EGD A;  1IH0 A;  2L4I A;  3DD4 A;  4MLW A;  1OOJ A;  1F70 A;  2CCM A;  1C07 A;  1DVI A;  1KK7 Z;  2K8M B;  2LP2 A;  2M29 A;  2ZND A;  1X02 A;  1QLS A;  2L5X B;  1BR4 B;  1BU3 A;  1OQP A;  2LMV A;  5BPJ A;  1DJX A;  5I2O A;  1GGW A;  1F4Q A;  1NX3 A;  2JTZ A;  4PE1 A;  3DVM A;  4DIR A;  2AMI A;  1F8H A;  3NSK A;  1DJY A;  3CR4 X;  2KI6 C;  1F55 A;  1NX0 A;  2BL0 B;  1MR8 A;  3IQO A;  1WRK A;  1K96 A;  1S5G Z;  1XVJ A;  2KBI A;  2LHL A;  1NCX A;  1S6C A;  1CDM A;  1K94 A;  2KNE A;  2PMY A;  3GK1 A;  3OX5 A;  1PSB A;  2WOS A;  3KF9 A;  5F6T A;  1N65 A;  5IBW A;  1SL7 A;  3PN7 C;  1Q80 A;  3ZWH A;  4A4C A;  1BLQ A;  2OPO A;  2O60 A;  3D10 A;  1RRO A;  1WY9 A;  1UWO A;  3CS1 A;  4C0K A;  2BCA A;  3E3R A;  3LL8 B;  2L98 A;  2ZRT A;  2LAP A;  1IJ6 A;  3WXA A;  2LCP A;  2NCO A;  3DF0 B;  4C0J A;  1R6P A;  1YX7 A;  3EKH A;  2BE4 A;  3CR5 X;  4CFR A;  2BKH B;  4QJ3 B;  2BE6 A;  1CLL A;  2M8U A;  1BT6 A;  1PRW A;  4P5O E;  3RM1 A;  1CFP A;  3BUW B;  1J55 A;  1OZO A;  5GQQ C;  5HKZ A;  2FOT A;  1FW4 A;  2ZN8 A;  3KPX A;  3GK2 A;  2KI4 B;  2WND A;  4YBH B;  1S6J A;  2JT8 A;  2KI6 D;  2PAL A;  2I94 A;  3VRO A;  2K7B A;  2D8N A;  1N0Y A;  4BY5 A;  2MLE C;  1B4C A;  1EXR A;  5DKN A;  2AUC A;  2F3Z A;  4YGA A;  2BBN A;  1XFU O;  2F3Y A;  3I5H C;  1IRJ A;  3AKB A;  1DF0 B;  2V53 A;  2KQY A;  1DTL A;  1CKK A;  2MAZ A;  2MHH A;  1TIZ A;  2BCX A;  4MZL A;  1OZS A;  1MXE A;  4QJ4 B;  3A4U B;  4DS7 A;  2H61 A;  3LCP C;  4ZCU A;  1Y1U A;  1LKJ A;  3EVR A;  1IWQ A;  1NSH A;  2LP3 A;  1LA0 A;  3SJS A;  1DT7 B;  1DJG A;  4CID A;  4DRW A;  5HKY A;  4OKH A;  1L2O B;  1EG4 A;  2I2R E;  2JZI A;  1CDL A;  1KK7 Y;  1C7W A;  1TRF A;  1SL9 A;  2ZRS A;  4HSZ A;  1RTP 1;  2M7L A;  1EG3 A;  1PK0 D;  4F0Z B;  1WDC B;  2Y1N A;  2EHB A;  1LA3 A;  3D0Y B;  4IL1 A;  2M1K B;  3TUY C;  3O2P A;  4MSP A;  1JFJ A;  1QJT A;  1DGU A;  1YVH A;  1M31 A;  1CFF A;  3TDZ A;  1QVI Y;  1G33 A;  2M7N A;  4ETO A;  1NX2 A;  4ZCV A;  4NQG A;  3CWG A;  2LHI A;  1UHJ A;  3FIA A;  2PVB A;  2M9G A;  3GOF A;  1K9P A;  2HQ8 A;  5CPV A;  1LIN A;  1U5I B;  3DF0 A;  1L7Z A;  4JQ0 D;  2K7D A;  2M0R A;  2IS9 A;  3CZT X;  1A03 A;  1BOC A;  3I5I C;  1FPW A;  4PDZ A;  4I5N B;  1IJ5 A;  5CSN A;  3CLN A;  1S1E A;  3OP0 A;  4PHJ A;  1CDN A;  2KYF A;  3NSL A;  5AER A;  3SIB A;  1G4Y R;  4FTG A;  1QV0 A;  3OHM B;  1AVS A;  2AAO A;  3FWC A;  5ER5 A;  1YVL A;  2KAY A;  5CSJ A;  1K9K A;  2KOT A;  1KQV A;  1E8A A;  1KK8 B;  1NP8 A;  5JOL A;  5KTY A;  1SKT A;  1CM4 A;  3FS7 A;  1DJW A;  1K9U A;  1SK6 D;  2JNX A;  4NDD A;  1A29 A;  4P2Y B; 
#chains in the Genus database with same CATH topology
 4MN0 A;  4D1E A;  3S0A A;  3BJH A;  3JVT B;  1XFY O;  1CFD A;  4GGF C;  3MSE B;  1QIV A;  2GGM A;  2R2I A;  3NHT A;  2LUC A;  1Z4H A;  3IVT A;  1XA5 A;  5ER4 X;  2L2E A;  1RFJ A;  1IQ3 A;  1DF0 A;  2MA2 A;  2BL0 C;  2LLT A;  3DYE A;  2KQ6 A;  3EKJ A;  2BNX A;  2KHN A;  1FBV A;  1KQM B;  3PAT A;  1MHO A;  2B1U A;  4PHM A;  3TDI A;  1J7R A;  1QIW A;  2K7O A;  4DCK A;  2LV7 A;  4OZD A;  1AHR A;  1QTX A;  2GGZ A;  3BOW B;  1XK4 A;  1RK9 A;  1WRZ A;  1YUU A;  3B86 A;  4GGN A;  4IJ7 A;  1W9Z A;  2G2B A;  1B7T Y;  1EJ3 A;  1UUS A;  2M49 B;  3D75 A;  4YI9 A;  1OOI X;  1XYD A;  1LVC D;  1QX5 B;  2Y4Q A;  2BAP A;  3B6X A;  1MF8 B;  1J7O A;  4I5J A;  3CZ0 A;  1ALW A;  3EVV A;  1NX1 A;  2JTT A;  2NXQ A;  1ODB A;  4CLN A;  3AAJ A;  1Y1X A;  4L9M A;  5AFP A;  3D74 A;  5D69 A;  1KFU S;  3B88 A;  2E30 A;  3BUN B;  3PAL A;  2JQ6 A;  3CZ1 A;  4YI8 A;  2LAN A;  1SCM B;  3D0Y A;  2WC6 A;  3S0D A;  2WCK A;  2KFF A;  4HRH A;  5AXI A;  2JRF A;  2NZ0 A;  1YX8 A;  3R72 A;  1UP5 A;  4USL A;  1M46 A;  1M45 A;  2P6B B;  3BFH A;  3NGV A;  5D7F A;  3R1O A;  4N1G A;  1QWV A;  2I18 A;  5CSI A;  2NLN A;  2KAV A;  1DMO A;  4XJK B;  5D3O A;  2ISD A;  4R1E A;  2KAX A;  3PLF B;  1U5I A;  2BKI B;  1K90 D;  1W7J B;  2DOQ A;  2ZN9 A;  2WCB A;  2PAS A;  1WRL A;  1YUR A;  2A4J A;  2OTG B;  4GFT A;  2LVK A;  2SAS A;  2L51 A;  3B7A A;  1CLB A;  1OMD A;  3BFB A;  5FI2 A;  1SR6 B;  3S0B A;  2P71 A;  3D78 A;  4HRG A;  5JJG A;  1CTR A;  1B8L A;  2LC5 A;  4NDB A;  5I2Q A;  1BF5 A;  4UPG A;  1Y6W A;  1J7P A;  1REC A;  2MBX A;  1OMV A;  1KSO A;  3S0G A;  3TS5 C;  4FQT A;  3FWB A;  4ORC B;  1XK4 C;  2PRU A;  3SIA A;  1XFR A;  1B8R A;  3CGA A;  1J1D A;  4GPL B;  3N7H A;  1SMG A;  1NCY A;  3D73 A;  1FI5 A;  2CNP A;  2OS8 B;  2RGI A;  3I5F C;  3LK0 A;  2BCB A;  1J1E A;  1TN4 A;  2ZFD A;  3BQ3 A;  4OCI A;  1F54 A;  1KWO C;  1PVB A;  1Y0V H;  1QX7 A;  3UO9 A;  3VGO A;  1YTZ C;  1WDC C;  2JOJ A;  1TNW A;  3BOW A;  3C1V A;  4PHK A;  3TDU A;  1KCY A;  1RWY A;  3KHE A;  1MXL C;  2FJU B;  3QME A;  1A2X A;  2JXL A;  4TNC A;  4YGC B;  2BBM A;  3EK8 A;  4JWQ A;  3BUX B;  5DIC A;  3SG5 A;  3KEV A;  1ZMZ A;  1TUZ A;  2ZKM X;  2LM5 A;  1OW4 A;  1K93 D;  1YUS A;  3B87 A;  1S5G Y;  3O4Y A;  4M2P A;  3WHU B;  1CM1 A;  2Q4U A;  4ORB B;  2JT3 A;  3JTD B;  3I5G B;  2M97 A;  2LVI A;  1PVA A;  4I5K A;  4PE0 A;  4GNK B;  4QJ5 B;  2WCF A;  1MUX A;  1OSA A;  2L50 A;  2M1U A;  4BY4 A;  5AEQ A;  1SW8 A;  2JU0 A;  4PCW A;  1K8U A;  2FCD A;  1UUR A;  2LMT A;  4N5X A;  1ALV A;  2JNF A;  2H8V A;  2KFG A;  4XJK A;  5B8I B;  1TOP A;  1M63 B;  3TUY B;  1CMG A;  1KFX S;  2LUX A;  3ICB A;  3OGN A;  3WNX B;  1NCZ A;  1FF1 A;  3ZNI A;  1XFW O;  4I5L B;  1CMF A;  1UHN A;  2QAC A;  2COL B;  1NYA A;  1QXP A;  2H61 C;  4JKT A;  1W7I B;  1Z2C B;  1JF2 A;  2LVV A;  3JVT C;  1IQ5 A;  3PM8 A;  5G08 A;  3RZS A;  1MWN A;  1H4B A;  2I7A A;  3EG5 B;  4OR9 B;  5PAL A;  2ERB A;  1HT9 A;  4HRE E;  4WQ3 A;  1RJV A;  4YRU A;  4YGE B;  1V1F A;  4INX A;  3BUM B;  2MLF C;  1BR1 B;  1DJI A;  3M0W A;  1V1G A;  4FQO A;  1QS7 A;  3HX4 A;  3NHI A;  2WCL A;  1JBA A;  3VRR A;  3O78 A;  3DVJ A;  1DJH A;  3SG3 A;  2KLE A;  4N1F A;  3TZ1 A;  3WHT B;  2TN4 A;  1SPY A;  1AUI B;  1S26 D;  3BUO B;  1QV1 A;  2EC6 B;  1QAS A;  3OB1 B;  1EL4 A;  1QAT A;  5HKW A;  2H2K A;  1YRT B;  5AAN A;  1SL8 A;  1S3P A;  1S6I A;  4C0L A;  1JC2 A;  2O5G A;  3GK4 X;  2NCP A;  2LMU A;  4AQI A;  2L4H A;  3S0E A;  1B9A A;  1ZAC A;  2KYC A;  2QPT A;  1HQV A;  2F2O A;  2YGU A;  3DVK A;  1M39 A;  1TNP A;  4JPZ B;  4MVF A;  5J3X A;  1YUT A;  1IG5 A;  2CT9 A;  1SCM C;  1UHI A;  4MZJ A;  1JSA A;  4M2O A;  1QVI Z;  1KFU L;  5CSF A;  1GM0 A;  1LXF C;  1JUO A;  4XYN A;  2CTN A;  2HET A;  4A4B A;  1B1G A;  1BJF A;  1B8C A;  2LVJ A;  3BXK A;  3H4S E;  1XO5 A;  1WLM A;  1SCV A;  1SYM A;  2LNK A;  4GBA A;  1S36 A;  2PSR A;  2HPS A;  2KDH A;  1BOD A;  3VRP A;  1ZOT B;  2WOR A;  3IF7 A;  2KI4 C;  1K95 A;  5KU1 A;  3RLZ A;  1EH2 A;  1A4P A;  4DUQ A;  1NPQ A;  2ZNE A;  1NIW A;  4GAO A;  3PN7 B;  2JUL A;  5I2L A;  3K1E A;  1K2H A;  2OTG C;  1AJ4 A;  1TCF A;  2JPT A;  2GV5 A;  1OMR A;  1SR6 C;  2L0P A;  1PSR A;  1SBJ A;  3QRX A;  3PM2 A;  1YRU B;  1IIO A;  1XFZ O;  3SS3 A;  1SY9 A;  1UHK A;  3K21 A;  5I8N A;  1TUJ A;  1DEK A;  2JC2 A;  3F45 A;  4ORA B;  5HL1 A;  2QDI A;  3NSO A;  2LLU A;  4PAL A;  3A8R A;  4MZK A;  1VRK A;  3DY9 A;  1KSM A;  1SRA A;  4JD9 A;  1A75 B;  2E6W A;  2KGR A;  2WCJ A;  1PAL A;  1B47 A;  2QEV A;  3HCM A;  1TNX A;  3PJI A;  3VRN A;  1GGZ A;  3BYA A;  3LLE A;  4ICB A;  2MRD A;  4Q04 A;  1J7Q A;  1Y1A A;  1CFC A;  3PSR A;  1BG1 A;  1F4O A;  3VRQ A;  4AOM A;  4CFQ A;  1N2D A;  3FE9 A;  1FI6 A;  3OB2 B;  2HF5 A;  1BMO A;  2HQW A;  2LE9 B;  2OS8 C;  1XFX O;  3CTN A;  1AJ5 A;  3EK7 A;  1JF0 A;  1L2O C;  2K7C A;  2KGB C;  2F33 A;  2KSP A;  1UHH A;  1B7T Z;  2WCE A;  3NXA A;  2Y1M A;  1QX2 A;  2K60 A;  1CNP A;  1ZFS A;  5HYD A;  5DKR A;  1AP4 A;  4YGB B;  1YR5 A;  3BFA A;  4YGD B;  4PE7 A;  4U8D A;  1JFK A;  3NSI A;  5K89 A;  1AK8 A;  1G8I A;  3I5H B;  3OX6 A;  2Y5I A;  3DVE A;  2KBM A;  3TS5 B;  5KSZ A;  3FE6 A;  4GUK A;  1P28 A;  1CLM A;  1SSE B;  1TCO B;  3AAK A;  5FI6 A;  3IQQ A;  4NDC A;  2LLS A;  1NWD A;  4MBE A;  4MRY A;  2K2A A;  4GGF A;  1D1O A;  1JWD A;  2F2P A;  2CXJ A;  3JTD C;  3I5G C;  1OE9 B;  3CR2 A;  3KO0 A;  5HLO A;  2SCP A;  4MRX A;  5FI7 A;  2K61 A;  1DEL A;  4MEW A;  1ZUZ A;  2BEC A;  3L4A A;  1WLZ A;  1DGV A;  3I5F B;  2Q91 A;  3PFV A;  1KWO B;  3SG2 A;  4AQJ A;  1GJY A;  2CBL A;  4E68 A;  2VRG A;  1GQM A;  3O6B A;  4CPV A;  3EVU A;  1R2U A;  4M2Q A;  1C3Z A;  3S0F A;  1PUL A;  1IGV A;  2QEH A;  2K2F A;  2KLD A;  4PT1 A;  1ORG A;  1CDP A;  2JXC A;  1KK8 C;  2M3W A;  5FYX A;  1KFX L;  4OV2 A;  2FCE A;  3EK4 A;  1F71 A;  3AKA A;  3L4L A;  3SG7 A;  1DJZ A;  2KFH A;  1NUB A;  5TNC A;  2WC5 A;  2K0J A;  2WC8 A;  1TTX A;  3LK1 A;  4WQ2 A;  5DKQ A;  2G9B A;  3SG6 A;  4PHN A;  1IKU A;  1H8B A;  2PQL A;  1TNQ A;  1MQ1 A;  2F8P A;  1CB1 A;  1QLK A;  3SG4 A;  4PE4 A;  4OVN F;  1C7V A;  3I5I B;  1A75 A;  5HLV A;  1XFV O;  1KQM C;  1SNL A;  4WRI A;  2JT0 A;  2JWW A;  2MJW B;  2EC6 C;  2EGD A;  1IH0 A;  2L4I A;  3DD4 A;  4MLW A;  3SS4 A;  1OOJ A;  2WCM A;  1F70 A;  2CCM A;  1C07 A;  3CAB A;  1DVI A;  1KK7 Z;  2K8M B;  2LP2 A;  1OOF A;  2M29 A;  2ZND A;  1X02 A;  1QLS A;  2L5X B;  1BR4 B;  1BU3 A;  1OQP A;  2LMV A;  5BPJ A;  1C3Y A;  1DJX A;  5I2O A;  1GGW A;  1F4Q A;  1NX3 A;  2L2C A;  2JTZ A;  4PE1 A;  3DVM A;  4DIR A;  2AMI A;  1F8H A;  3NSK A;  3Q8I A;  1DJY A;  3CR4 X;  2KI6 C;  1F55 A;  1LS8 A;  1NX0 A;  2BL0 B;  1MR8 A;  3IQO A;  1WRK A;  1K96 A;  1S5G Z;  1XVJ A;  2KBI A;  2LHL A;  1NCX A;  1S6C A;  3DXL A;  1CDM A;  1K94 A;  2KNE A;  2PMY A;  3GK1 A;  3OX5 A;  1PSB A;  2WOS A;  3KF9 A;  5F6T A;  1N65 A;  5IBW A;  3R1V A;  1SL7 A;  3PN7 C;  1Q80 A;  3CDN A;  3ZWH A;  4A4C A;  1BLQ A;  2OPO A;  2O60 A;  3D10 A;  1DQE A;  1RRO A;  5I94 A;  1WY9 A;  1UWO A;  3CS1 A;  4C0K A;  2BCA A;  3E3R A;  3LL8 B;  2L98 A;  2ZRT A;  2LAP A;  1IJ6 A;  3WXA A;  2LCP A;  2NCO A;  5EL2 A;  3DF0 B;  4C0J A;  1R6P A;  1YX7 A;  3EKH A;  2BE4 A;  3CR5 X;  4CFR A;  2BKH B;  3D76 A;  4QJ3 B;  2BE6 A;  1CLL A;  3FE8 A;  2M8U A;  1BT6 A;  3SS5 A;  1PRW A;  4F7F A;  4P5O E;  3RM1 A;  1CFP A;  3BUW B;  1J55 A;  1OZO A;  2P70 A;  5GQQ C;  2FOT A;  1FW4 A;  2JPO A;  2ZN8 A;  5HKZ A;  3KPX A;  3GK2 A;  3VB1 A;  2KI4 B;  2WND A;  4YBH B;  1S6J A;  3UNW A;  2JT8 A;  2KI6 D;  2PAL A;  2I94 A;  3VRO A;  2K7B A;  2GTE A;  2D8N A;  1N0Y A;  4BY5 A;  2MLE C;  1B4C A;  1EXR A;  5DKN A;  2AUC A;  2WCH A;  2F3Z A;  3O4X A;  4YGA A;  2BBN A;  3R1P A;  1XFU O;  4INW A;  2F3Y A;  3I5H C;  1IRJ A;  3AKB A;  1OOG A;  1DF0 B;  2V53 A;  3DZT A;  2KQY A;  1DTL A;  1CKK A;  2MAZ A;  2MHH A;  1TIZ A;  2BCX A;  4MZL A;  1OZS A;  1MXE A;  4QJ4 B;  3A4U B;  4DS7 A;  2H61 A;  3CYZ A;  3LCP C;  4ZCU A;  1Y1U A;  1LKJ A;  3EVR A;  1IWQ A;  3V2L A;  1NSH A;  2LP3 A;  1LA0 A;  1T14 A;  3SJS A;  1DT7 B;  1DJG A;  4KYN A;  4CID A;  4DRW A;  5HKY A;  3L47 A;  4OKH A;  1L2O B;  1EG4 A;  2I2R E;  2JZI A;  1CDL A;  1KK7 Y;  1C7W A;  1OOH A;  1TRF A;  1SL9 A;  2ZRS A;  4HSZ A;  1RTP 1;  2M7L A;  1EG3 A;  1PK0 D;  4F0Z B;  1WDC B;  2Y1N A;  2EHB A;  1LA3 A;  3D0Y B;  4IL1 A;  2M1K B;  3TUY C;  3O2P A;  4MSP A;  1JFJ A;  1QJT A;  1DGU A;  1YVH A;  1M31 A;  1CFF A;  2L5Y A;  2KPH A;  3TDZ A;  1QVI Y;  1G33 A;  2M7N A;  4ETO A;  1NX2 A;  1TWO A;  4ZCV A;  1DC1 A;  4NQG A;  3CWG A;  2LHI A;  1UHJ A;  3FIA A;  2PVB A;  2M9G A;  3GOF A;  1K9P A;  2HQ8 A;  5CPV A;  1LIN A;  1U5I B;  3DF0 A;  1L7Z A;  3OBV A;  2K7D A;  2M0R A;  2IS9 A;  3CZT X;  4JQ0 D;  1A03 A;  1BOC A;  3I5I C;  1FPW A;  4PDZ A;  4I5N B;  3D77 A;  1IJ5 A;  5CSN A;  3CLN A;  2QEB A;  1S1E A;  3OP0 A;  4PHJ A;  1CDN A;  2KYF A;  3NSL A;  5AER A;  3SIB A;  1G4Y R;  4FTG A;  1QV0 A;  3OHM B;  1AVS A;  2AAO A;  3FWC A;  5ER5 A;  1YVL A;  2KAY A;  5CSJ A;  1K9K A;  2KOT A;  1KQV A;  1E8A A;  1KK8 B;  1NP8 A;  5JOL A;  5KTY A;  1SKT A;  1CM4 A;  2FJY A;  3FS7 A;  2QEO A;  3CZ2 A;  1DJW A;  1K9U A;  1SK6 D;  2JNX A;  2PYQ A;  4NDD A;  1A29 A;  4P2Y B; 
#chains in the Genus database with same CATH homology
 4MN0 A;  4D1E A;  4GGF C;  3JVT B;  1XFY O;  1CFD A;  3MSE B;  1QIV A;  2GGM A;  2R2I A;  2LUC A;  1XA5 A;  5ER4 X;  2L2E A;  1RFJ A;  1IQ3 A;  1DF0 A;  2MA2 A;  2BL0 C;  2LLT A;  3PAT A;  2KQ6 A;  3EKJ A;  2KHN A;  3TDI A;  1FBV A;  1KQM B;  4PHM A;  1MHO A;  2B1U A;  4DCK A;  1J7R A;  1QIW A;  2K7O A;  2LV7 A;  1AHR A;  1QTX A;  2GGZ A;  3BOW B;  1XK4 A;  1RK9 A;  1WRZ A;  1YUU A;  4GGN A;  2G2B A;  4YI9 A;  1B7T Y;  1EJ3 A;  1UUS A;  2M49 B;  1XYD A;  1LVC D;  1QX5 B;  2Y4Q A;  1MF8 B;  1J7O A;  4I5J A;  1ALW A;  3EVV A;  1NX1 A;  2JTT A;  2NXQ A;  1ODB A;  4CLN A;  3AAJ A;  1Y1X A;  4L9M A;  5AFP A;  5D69 A;  1KFU S;  2E30 A;  3BUN B;  3PAL A;  2JQ6 A;  4YI8 A;  2LAN A;  1SCM B;  3D0Y A;  2KFF A;  4HRH A;  5AXI A;  2JRF A;  2NZ0 A;  1YX8 A;  1UP5 A;  4USL A;  1M46 A;  1M45 A;  2P6B B;  5D7F A;  4N1G A;  5CSI A;  2I18 A;  2NLN A;  2KAV A;  1DMO A;  4XJK B;  2ISD A;  4R1E A;  2KAX A;  3PLF B;  1U5I A;  2BKI B;  1K90 D;  1W7J B;  2DOQ A;  2ZN9 A;  2WCB A;  2PAS A;  1WRL A;  1YUR A;  2A4J A;  2OTG B;  4GFT A;  2LVK A;  2SAS A;  2L51 A;  1CLB A;  1OMD A;  1SR6 B;  4HRG A;  5JJG A;  1CTR A;  1B8L A;  2LC5 A;  4NDB A;  5I2Q A;  1BF5 A;  4UPG A;  1Y6W A;  1J7P A;  1REC A;  2MBX A;  1OMV A;  1KSO A;  3TS5 C;  3FWB A;  4ORC B;  1XK4 C;  2PRU A;  3SIA A;  1B8R A;  3CGA A;  1J1D A;  4GPL B;  1SMG A;  1NCY A;  1FI5 A;  2CNP A;  2OS8 B;  2RGI A;  3I5F C;  3LK0 A;  2BCB A;  1J1E A;  1TN4 A;  2ZFD A;  3BQ3 A;  4OCI A;  1F54 A;  1KWO C;  1PVB A;  1Y0V H;  1QX7 A;  3VGO A;  1YTZ C;  1WDC C;  2JOJ A;  1TNW A;  3BOW A;  3C1V A;  4PHK A;  3TDU A;  1KCY A;  1RWY A;  3KHE A;  1MXL C;  2FJU B;  1A2X A;  2JXL A;  4TNC A;  4YGC B;  2BBM A;  3EK8 A;  4JWQ A;  3BUX B;  3SG5 A;  3KEV A;  1ZMZ A;  2ZKM X;  2LM5 A;  1K93 D;  1YUS A;  1S5G Y;  3O4Y A;  4M2P A;  3WHU B;  1CM1 A;  2Q4U A;  4ORB B;  2JT3 A;  3JTD B;  3I5G B;  2M97 A;  2LVI A;  1PVA A;  4I5K A;  4PE0 A;  4GNK B;  4QJ5 B;  2WCF A;  1MUX A;  1OSA A;  2L50 A;  2M1U A;  4BY4 A;  5AEQ A;  1SW8 A;  2JU0 A;  4PCW A;  1K8U A;  2FCD A;  1UUR A;  2LMT A;  4N5X A;  1ALV A;  2JNF A;  2KFG A;  4XJK A;  5B8I B;  1TOP A;  1M63 B;  3TUY B;  1CMG A;  1KFX S;  2LUX A;  3ICB A;  3WNX B;  1NCZ A;  1FF1 A;  3ZNI A;  1XFW O;  4I5L B;  1CMF A;  1UHN A;  2QAC A;  2COL B;  1NYA A;  1QXP A;  2H61 C;  1W7I B;  2LVV A;  1JF2 A;  3JVT C;  5G08 A;  1IQ5 A;  3PM8 A;  1MWN A;  1H4B A;  2I7A A;  4OR9 B;  5PAL A;  1HT9 A;  4HRE E;  4WQ3 A;  1RJV A;  4YRU A;  4YGE B;  1V1F A;  3BUM B;  2MLF C;  1BR1 B;  1DJI A;  3M0W A;  1V1G A;  4FQO A;  1QS7 A;  3HX4 A;  1JBA A;  3VRR A;  3O78 A;  3DVJ A;  1DJH A;  3SG3 A;  4N1F A;  3TZ1 A;  3WHT B;  2TN4 A;  1SPY A;  1AUI B;  1S26 D;  3BUO B;  1QV1 A;  2EC6 B;  1QAS A;  3OB1 B;  1EL4 A;  1QAT A;  5HKW A;  2H2K A;  1YRT B;  5AAN A;  1SL8 A;  1S3P A;  1S6I A;  4C0L A;  1JC2 A;  2O5G A;  3GK4 X;  2NCP A;  2LMU A;  4AQI A;  2L4H A;  1B9A A;  1ZAC A;  2KYC A;  2QPT A;  1HQV A;  2F2O A;  3DVK A;  1M39 A;  1TNP A;  4JPZ B;  4MVF A;  5J3X A;  1YUT A;  1IG5 A;  2CT9 A;  1SCM C;  1UHI A;  4MZJ A;  1JSA A;  4M2O A;  1QVI Z;  1KFU L;  5CSF A;  1LXF C;  1JUO A;  4XYN A;  2CTN A;  2HET A;  4A4B A;  1B1G A;  1BJF A;  1B8C A;  2LVJ A;  3BXK A;  3H4S E;  1XO5 A;  1WLM A;  1SCV A;  1SYM A;  2LNK A;  4GBA A;  1S36 A;  2PSR A;  2HPS A;  2KDH A;  1BOD A;  3VRP A;  1ZOT B;  2WOR A;  3IF7 A;  2KI4 C;  1K95 A;  5KU1 A;  3RLZ A;  1EH2 A;  1A4P A;  4DUQ A;  1NPQ A;  2ZNE A;  1NIW A;  4GAO A;  3PN7 B;  2JUL A;  5I2L A;  1K2H A;  2OTG C;  1AJ4 A;  1TCF A;  2JPT A;  2GV5 A;  1OMR A;  1SR6 C;  2L0P A;  1PSR A;  1SBJ A;  3QRX A;  1YRU B;  1XFZ O;  1SY9 A;  1UHK A;  3K21 A;  5I8N A;  2JC2 A;  3F45 A;  4ORA B;  3NSO A;  2LLU A;  4PAL A;  3A8R A;  4MZK A;  1VRK A;  1KSM A;  1SRA A;  1A75 B;  2E6W A;  2KGR A;  3HCM A;  1PAL A;  1B47 A;  3VRN A;  1TNX A;  1GGZ A;  3BYA A;  3LLE A;  4ICB A;  2MRD A;  4Q04 A;  1J7Q A;  1Y1A A;  1CFC A;  1BG1 A;  1F4O A;  3VRQ A;  4AOM A;  4CFQ A;  1N2D A;  1FI6 A;  3OB2 B;  2HF5 A;  1BMO A;  2HQW A;  2LE9 B;  2OS8 C;  1XFX O;  3CTN A;  1AJ5 A;  3EK7 A;  1JF0 A;  1L2O C;  2K7C A;  2KGB C;  2F33 A;  2KSP A;  1UHH A;  1B7T Z;  2WCE A;  3NXA A;  2Y1M A;  1QX2 A;  3PSR A;  1CNP A;  1ZFS A;  5HYD A;  5DKR A;  1AP4 A;  4YGB B;  1YR5 A;  4YGD B;  4PE7 A;  4U8D A;  1JFK A;  3NSI A;  5K89 A;  1AK8 A;  1G8I A;  3I5H B;  3OX6 A;  2Y5I A;  3DVE A;  2KBM A;  3TS5 B;  5KSZ A;  4GUK A;  1CLM A;  1TCO B;  3AAK A;  3IQQ A;  4NDC A;  2LLS A;  1NWD A;  4MBE A;  4MRY A;  2K2A A;  4GGF A;  1D1O A;  1JWD A;  2F2P A;  2CXJ A;  3JTD C;  3I5G C;  1OE9 B;  3CR2 A;  3KO0 A;  5HLO A;  2SCP A;  4MRX A;  2K61 A;  4MEW A;  1ZUZ A;  2BEC A;  1WLZ A;  1DGV A;  3I5F B;  2Q91 A;  3PFV A;  1KWO B;  3SG2 A;  4AQJ A;  1GJY A;  2CBL A;  4E68 A;  2VRG A;  1GQM A;  3O6B A;  4CPV A;  3EVU A;  1R2U A;  4M2Q A;  1PUL A;  1IGV A;  2K2F A;  1CDP A;  2JXC A;  1KK8 C;  2M3W A;  5FYX A;  1KFX L;  4OV2 A;  2FCE A;  3EK4 A;  1F71 A;  3AKA A;  3SG7 A;  1DJZ A;  2KFH A;  1NUB A;  5TNC A;  2K0J A;  2WC8 A;  1TTX A;  3LK1 A;  4WQ2 A;  5DKQ A;  2G9B A;  3SG6 A;  4PHN A;  1IKU A;  1H8B A;  1TNQ A;  1MQ1 A;  2F8P A;  1CB1 A;  1QLK A;  3SG4 A;  4PE4 A;  4OVN F;  1C7V A;  3I5I B;  1A75 A;  5HLV A;  1XFV O;  1KQM C;  1SNL A;  4WRI A;  2JT0 A;  2JWW A;  2MJW B;  2EC6 C;  2EGD A;  1IH0 A;  2L4I A;  3DD4 A;  4MLW A;  1OOJ A;  1F70 A;  2CCM A;  1C07 A;  1DVI A;  1KK7 Z;  2K8M B;  2LP2 A;  2M29 A;  2ZND A;  1X02 A;  1QLS A;  2L5X B;  1BR4 B;  1BU3 A;  1OQP A;  2LMV A;  5BPJ A;  1DJX A;  5I2O A;  1GGW A;  1F4Q A;  1NX3 A;  2JTZ A;  4PE1 A;  3DVM A;  4DIR A;  2AMI A;  1F8H A;  3NSK A;  1DJY A;  3CR4 X;  2KI6 C;  1F55 A;  1NX0 A;  2BL0 B;  1MR8 A;  3IQO A;  1WRK A;  1K96 A;  1S5G Z;  1XVJ A;  2KBI A;  2LHL A;  1NCX A;  1S6C A;  1CDM A;  1K94 A;  2KNE A;  2PMY A;  3GK1 A;  3OX5 A;  1PSB A;  2WOS A;  3KF9 A;  5F6T A;  1N65 A;  5IBW A;  1SL7 A;  3PN7 C;  1Q80 A;  3ZWH A;  4A4C A;  1BLQ A;  2OPO A;  2O60 A;  3D10 A;  1RRO A;  1WY9 A;  1UWO A;  3CS1 A;  4C0K A;  2BCA A;  3E3R A;  3LL8 B;  2L98 A;  2ZRT A;  2LAP A;  1IJ6 A;  3WXA A;  2LCP A;  2NCO A;  3DF0 B;  4C0J A;  1R6P A;  1YX7 A;  3EKH A;  2BE4 A;  3CR5 X;  4CFR A;  2BKH B;  4QJ3 B;  2BE6 A;  1CLL A;  2M8U A;  1BT6 A;  1PRW A;  4P5O E;  3RM1 A;  1CFP A;  3BUW B;  1J55 A;  1OZO A;  5GQQ C;  5HKZ A;  2FOT A;  1FW4 A;  2ZN8 A;  3KPX A;  3GK2 A;  2KI4 B;  2WND A;  4YBH B;  1S6J A;  2JT8 A;  2KI6 D;  2PAL A;  2I94 A;  3VRO A;  2K7B A;  2D8N A;  1N0Y A;  4BY5 A;  2MLE C;  1B4C A;  1EXR A;  5DKN A;  2AUC A;  2F3Z A;  4YGA A;  2BBN A;  1XFU O;  2F3Y A;  3I5H C;  1IRJ A;  3AKB A;  1DF0 B;  2V53 A;  2KQY A;  1DTL A;  1CKK A;  2MAZ A;  2MHH A;  1TIZ A;  2BCX A;  4MZL A;  1OZS A;  1MXE A;  4QJ4 B;  3A4U B;  4DS7 A;  2H61 A;  3LCP C;  4ZCU A;  1Y1U A;  1LKJ A;  3EVR A;  1IWQ A;  1NSH A;  2LP3 A;  1LA0 A;  3SJS A;  1DT7 B;  1DJG A;  4CID A;  4DRW A;  5HKY A;  4OKH A;  1L2O B;  1EG4 A;  2I2R E;  2JZI A;  1CDL A;  1KK7 Y;  1C7W A;  1TRF A;  1SL9 A;  2ZRS A;  4HSZ A;  1RTP 1;  2M7L A;  1EG3 A;  1PK0 D;  4F0Z B;  1WDC B;  2Y1N A;  2EHB A;  1LA3 A;  3D0Y B;  4IL1 A;  2M1K B;  3TUY C;  3O2P A;  4MSP A;  1JFJ A;  1QJT A;  1DGU A;  1YVH A;  1M31 A;  1CFF A;  3TDZ A;  1QVI Y;  1G33 A;  2M7N A;  4ETO A;  1NX2 A;  4ZCV A;  4NQG A;  3CWG A;  2LHI A;  1UHJ A;  3FIA A;  2PVB A;  2M9G A;  3GOF A;  1K9P A;  2HQ8 A;  5CPV A;  1LIN A;  1U5I B;  3DF0 A;  1L7Z A;  4JQ0 D;  2K7D A;  2M0R A;  2IS9 A;  3CZT X;  1A03 A;  1BOC A;  3I5I C;  1FPW A;  4PDZ A;  4I5N B;  1IJ5 A;  5CSN A;  3CLN A;  1S1E A;  3OP0 A;  4PHJ A;  1CDN A;  2KYF A;  3NSL A;  5AER A;  3SIB A;  1G4Y R;  4FTG A;  1QV0 A;  3OHM B;  1AVS A;  2AAO A;  3FWC A;  5ER5 A;  1YVL A;  2KAY A;  5CSJ A;  1K9K A;  2KOT A;  1KQV A;  1E8A A;  1KK8 B;  1NP8 A;  5JOL A;  5KTY A;  1SKT A;  1CM4 A;  3FS7 A;  1DJW A;  1K9U A;  1SK6 D;  2JNX A;  4NDD A;  1A29 A;  4P2Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...