1C3YA

Thp12-carrier protein from yellow meal worm
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
ETPREKLKQHSDACKAESGVSEESLNKVRNREEVDDPKLKEHAFCILKRAGFIDASGEFQLDHIKTKFKENSEHPEKVDDLVAKCAVKKDTPQHSSADFFKCVHDNRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords THP12 CARRIER PROTEIN
publication title A new class of hexahelical insect proteins revealed as putative carriers of small hydrophobic ligands.
pubmed doi rcsb
source organism Tenebrio molitor
total genus 21
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1c3yA00
3L4LA 1C3ZA 2QEOA 3CDNA 3DYEA 3BFHA 3R1VA 3D77A 3NGVA 3L47A 3RZSA 5DICA 3D74A 3NHIA 3B87A 2P71A 3S0GA 4OZDA 1TWOA 4INXA 1GM0A 3PJIA 3CYZA 2H8VA 2WCJA 1C3YA 3CABA 2WCLA 3B7AA 3R1PA 1OOHA 3V2LA 4PT1A 3CZ2A 3FE9A 4F7FA 3NHTA 1LS8A 3S0AA 3R1OA 2P70A 3N7HA 3DXLA 3K1EA 4JD9A 3S0FA 3Q8IA 1TUJA 3S0EA 3CZ0A 3B88A 3FE6A 2FJYA 2ERBA 3B6XA 3QMEA 3B86A 2QEHA 2KPHA 1P28A 3DY9A 1XFRA 3S0BA 2PQLA 3D75A 2JPOA 1OOIX 2L2CA 2WC6A 1DQEA 3R72A 1QWVA 2WC5A 2WCHA 3L4AA 1OOGA 2QEBA 3BJHA 4FQTA 4INWA 1ORGA 3BFAA 2QEVA 2WCMA 2QDIA 3D73A 3FE8A 2GTEA 3DZTA 3CZ1A 3S0DA 3D76A 1OOFA 3D78A 3OGNA 5EL2A 1OW4A 3VB1A 2WCKA 1T14A 3BFBA
chains in the Genus database with same CATH superfamily
4TNCA 1CFCA 2KI6C 1X02A 3AAJA 3I5FB 2E6WA 5BPJA 4CFQA 3SG5A 2LMTA 3D77A 1OQPA 1DJYA 2PMYA 1KSOA 3NGVA 4C0LA 2LVIA 2KNEA 3RZSA 1YUSA 1CTRA 3D74A 3TDUA 3VGOA 3NHIA 1H4BA 2WNDA 1SW8A 3PATA 1KFXL 2BECA 3S0GA 1NX2A 1HT9A 2LV7A 1AJ5A 1CB1A 1FI6A 3PSRA 1NX3A 2WCFA 1C07A 4USLA 4INXA 1SL8A 1MXEA 2Y1NA 4JPZB 1ZUZA 5TNCA 3I5IB 1M39A 1C3YA 1KQVA 3DVJA 2WCLA 3IVTA 2L4IA 3JTDB 1QATA 1KFUS 1SR6B 1QLSA 1F54A 2OS8C 4PHMA 3V2LA 2K7OA 1IH0A 1KWOC 3CZ2A 1OMVA 1PRWA 1Z2CB 1XYDA 3ZNIA 2LLSA 1TRFA 3A4UB 3MSEB 1RTP1 4XJKB 1BF5A 3HCMA 1MHOA 4P2YB 3KPXA 1DEKA 2JZIA 2L0PA 4IL1A 4YGCB 2A4JA 2NZ0A 3KF9A 3PN7B 2M1KB 5HKYA 4R1EA 3K1EA 3GK2A 1SPYA 1DJWA 1A03A 2LCPA 3SG7A 3K21A 2LAPA 1PVBA 1MQ1A 2AMIA 2KQYA 3B88A 3FE6A 1KK8B 2BCBA 1ALWA 2JNXA 1DTLA 5JOLA 4N1GA 2ERBA 1OMRA 3CR4X 3EKHA 4M2OA 1S6IA 3B86A 2JXCA 4NDBA 1NSHA 2H2KA 2QEHA 1SL9A 3O4YA 4YGEB 4BY4A 1P28A 3DY9A 1C7WA 1EG4A 3TZ1A 2PQLA 4F0ZB 2K2FA 5CSIA 1IQ3A 4DS7A 2WC6A 1DQEA 1QWVA 1UHIA 4HSZA 1GGZA 3OB1B 1B9AA 4GAOA 4PHKA 1RFJA 3L4AA 1F4QA 2MRDA 1OOJA 1SBJA 5JJGA 1BLQA 1L2OC 1DGUA 1YX8A 1ZACA 2V53A 1CFDA 4AQJA 2CBLA 4GUKA 4WRIA 1NX0A 1ZFSA 2I2RE 2F2PA 4P5OE 4NQGA 2KI4B 2QEVA 5HLVA 2DOQA 2HF5A 2MJWB 5I8NA 2F3ZA 1BT6A 2OTGC 4BY5A 5FI6A 5CSNA 4NDCA 3CLNA 3BUWB 3OX5A 2Y4QA 1CDLA 1SY9A 1IIOA 1DELA 3IQQA 3BUOB 4N5XA 1S6CA 2K2AA 1OOFA 1EG3A 1PSBA 1S5GZ 3D78A 2ZNEA 1U5IA 1XFYO 2L2EA 3NSLA 4ORAB 2JT3A 2LP3A 5J3XA 3UNWA 3KEVA 3AAKA 1K9UA 1PK0D 1OW4A 1V1FA 1XK4A 2KFFA 4MLWA 3VRQA 4ETOA 1F4OA 2JTTA 1Y6WA 2KFHA 3FWBA 3WHTB 3WXAA 3F45A 1PSRA 1TUZA 4MVFA 2WCKA 4Q04A 2KLDA 3FS7A 4MRXA 1QLKA 1ZOTB 4PHNA 5D3OA 5HYDA 1DT7B 1L7ZA 1DGVA 3CS1A 1C3ZA 1RK9A 1FI5A 2H61C 5FI7A 2BKHB 3SIBA 1CFFA 3I5FC 2QACA 2YGUA 3L47A 4A4BA 5GQQC 3RLZA 2F2OA 2ZNDA 1W7JB 2MHHA 2EC6B 1E8AA 4N1FA 4ORBB 5K89A 2JT0A 2JOJA 1ZMZA 1DJGA 3TUYB 2O5GA 2MA2A 2H8VA 2PVBA 2WCJA 1NPQA 2LLTA 1B4CA 3R1PA 1XFXO 5D7FA 1NUBA 1B47A 3GK4X 3O6BA 4PT1A 3NHTA 1DJHA 4D1EA 2MLFC 2BL0B 1KQMB 1SR6C 1QX7A 5AERA 2K60A 1UWOA 1YUUA 2E30A 2QPTA 1AHRA 3WHUB 4AOMA 2EHBA 4PDZA 3R1OA 2Y1MA 1HQVA 2NXQA 3BOWB 3I5HC 5G08A 1SCVA 3DXLA 1DF0B 1TTXA 3GK1A 1CFPA 1LKJA 1OSAA 1SYMA 2BBMA 1SNLA 3Q8IA 1DJIA 4M2QA 3EK7A 1LVCD 1D1OA 3DVKA 3IQOA 3LK1A 2HPSA 4U8DA 5ER4X 1BR4B 1CM4A 2M0RA 1AUIB 2PALA 4L9MA 1G8IA 5AANA 4PHJA 3TDIA 1A4PA 1CDMA 4XJKA 5AFPA 1GGWA 4QJ4B 2SASA 2F8PA 1S5GY 3HX4A 1MXLC 1TCOB 1UHJA 1B8CA 3KHEA 1BG1A 1KK7Y 3CWGA 1NIWA 2GV5A 1BJFA 2K0JA 2LVKA 1J7RA 4HRGA 3PM2A 1N2DA 2L2CA 1F70A 2BBNA 2K7BA 2BKIB 3TS5C 2WC5A 5I2QA 1J7OA 4PE1A 1GQMA 1J7QA 4I5LB 2ZRSA 4C0KA 3PFVA 3PALA 1JC2A 3O78A 1BMOA 3SJSA 2BCAA 1IQ5A 5IBWA 2FCDA 1K90D 1YVHA 2F33A 1TNXA 3DVMA 3ICBA 2PRUA 1WLMA 2WCMA 2QDIA 1TN4A 1WDCC 3FE8A 4PE7A 2GTEA 1W9ZA 4C0JA 4I5NB 3DZTA 2K61A 3DF0B 3S0DA 5HL1A 2K7CA 3OP0A 1K94A 1IWQA 4MRYA 3OGNA 4ORCB 3DVEA 2CNPA 5DKQA 5DKRA 1B7TZ 1K9KA 3AKBA 2FCEA 4OKHA 4DUQA 1EJ3A 1XVJA 1JF0A 3IF7A 3RM1A 1QVIZ 1UURA 2B1UA 2KLEA 1XFVO 2OS8B 3VB1A 5I2LA 2KAXA 1QJTA 1KWOB 3BFBA 1RJVA 3OB2B 2JULA 1WRLA 1JUOA 4MZJA 2MBXA 3EVRA 2GGZA 2QEOA 1DJXA 3VRNA 1AP4A 1A75A 1IGVA 1J7PA 1K95A 3QRXA 1XFUO 1UHHA 1TIZA 1XK4C 2BNXA 2Q91A 3R1VA 4FQOA 1AJ4A 1Q80A 2EGDA 2P6BB 3VROA 4WQ2A 5FI2A 5DICA 1CDNA 1LA0A 1J1EA 3BYAA 2KBIA 1W7IB 2LC5A 3B87A 2P71A 3M0WA 1A75B 3BUNB 1XFZO 1CDPA 3FIAA 3I5GC 4MBEA 2D8NA 2PSRA 4XYNA 2LHIA 1TWOA 1JWDA 1GM0A 5DKNA 1IRJA 2KAVA 2ZN9A 1F8HA 2KGBC 2NCPA 3SS5A 2KAYA 4JQ0D 1SCMB 3CABA 3B7AA 4AQIA 1WRZA 1IJ6A 2F3YA 1SSEB 2WC8A 1K93D 2KDHA 1KCYA 1BU3A 3FE9A 4HREE 4F7FA 4YRUA 2COLB 1N0YA 2I94A 1TOPA 4HRHA 1B1GA 1LS8A 3S0AA 3OX6A 3N7HA 2CCMA 3NSIA 5HKWA 2BL0C 1YX7A 1S26D 1L2OB 2JC2A 2LVJA 2WCEA 3D0YB 2CT9A 1PULA 1TUJA 3S0EA 3CZ0A 2M9GA 2HQ8A 3SS4A 3C1VA 1PVAA 3CTNA 2I18A 2FJYA 3SG3A 3TDZA 1K8UA 1QX2A 2FOTA 2OTGB 1S3PA 4I5KA 1IJ5A 1YTZC 3O4XA 4CFRA 3B6XA 1CLMA 5KSZA 1CNPA 2WCBA 1R6PA 1UP5A 4GGFA 3BOWA 1B7TY 1N65A 1OZSA 1DF0A 3OHMB 3I5IC 2TN4A 5B8IB 3SS3A 3AKAA 3JTDC 3EK4A 1QIVA 1OMDA 1QVIY 1NYAA 2KFGA 3S0BA 1OOIX 3PLFB 3R72A 2M3WA 3SG6A 1C7VA 2WCHA 2LHLA 3SG2A 1NCYA 2PYQA 1RECA 2LUCA 2KI6D 1YRUB 1QTXA 4GPLB 1OOGA 2LANA 3LK0A 3PN7C 2BE6A 1YRTB 3BJHA 4PCWA 4FQTA 1NX1A 4FTGA 1FF1A 1KFUL 1A29A 3EVVA 1S36A 2IS9A 1JSAA 2ZKMX 1QX5B 1ORGA 1KK8C 1TNWA 1UHNA 2ZRTA 2RGIA 1SMGA 2I7AA 2K7DA 1EH2A 3D73A 2Y5IA 2M8UA 3CGAA 3D10A 1NCZA 2Q4UA 1M63B 2R2IA 3CZ1A 1WRKA 4YGDB 2M29A 3SG4A 2L5XB 2PASA 4QJ5B 5EL2A 2M49B 1ODBA 1YUTA 4CIDA 4IJ7A 2JRFA 3JVTB 2WORA 1KFXS 1CKKA 2ZN8A 2JQ6A 1PALA 1FBVA 4OV2A 2M1UA 1T14A 1S6JA 3LLEA 2L4HA 4M2PA 2M97A 2JT8A 3VRPA 1QS7A 2BE4A 1AVSA 3L4LA 2LNKA 3DF0A 1TCFA 3O2PA 3LL8B 1SRAA 5F6TA 1YURA 2KBMA 4MN0A 3I5HB 3CDNA 3DYEA 3BFHA 2LLUA 2O60A 3CR2A 1Y1UA 4I5JA 2MLEC 3OBVA 4YBHB 5CPVA 3ZWHA 2KI4C 2GGMA 2KOTA 4WQ3A 2M7NA 1QASA 1LXFC 1Y1AA 4ICBA 4NDDA 4PE0A 5AEQA 4CPVA 4OZDA 1G33A 2KQ6A 1R2UA 3DD4A 3LCPC 4PE4A 5KTYA 2G9BA 3BXKA 2KGRA 1Y0VH 1CMGA 3PJIA 2LVVA 2NLNA 1RROA 2WOSA 3CYZA 1MF8B 4QJ3B 5ER5A 1QV1A 5AXIA 4E68A 1M31A 1XFWO 1BR1B 2L98A 3A8RA 5HLOA 2JTZA 3EVUA 1QV0A 1OOHA 1EXRA 2AUCA 4YGBB 1B8LA 1XA5A 4GBAA 1WLZA 1SCMC 4PALA 5CSJA 3CZTX 3TS5B 1CMFA 5KU1A 1AK8A 1K9PA 1XO5A 1YVLA 2JNFA 3EK8A 1F55A 4KYNA 2KSPA 5I94A 2LMUA 1Z4HA 3H4SE 1DVIA 2P70A 1JFJA 4ZCUA 3E3RA 1B8RA 4OVNF 3NSKA 4A4CA 1BODA 1OZOA 2CTNA 4JD9A 3S0FA 1CM1A 3SIAA 1EL4A 3KO0A 1IG5A 2JU0A 1NWDA 3BUMB 1MUXA 1F71A 2HETA 1A2XA 1NP8A 2EC6C 1WDCB 2BAPA 4MEWA 3FWCA 2JWWA 2G2BA 3QMEA 1DJZA 1TNPA 2SCPA 4YI9A 2K8MB 3TUYC 3NSOA 1SL7A 1QXPA 2LE9B 1LINA 2KPHA 2L51A 1QIWA 1JF2A 2M7LA 3D0YA 1J1DA 1Y1XA 3EKJA 4CLNA 1CLBA 1XFRA 1S1EA 2BCXA 3D75A 2JXLA 3UO9A 2JPOA 2JPTA 1G4YR 4DIRA 1JBAA 1UUSA 1H8BA 1KK7Z 1KQMC 2FJUB 3WNXB 4GFTA 5HKZA 1M45A 1CLLA 1VRKA 2QEBA 4GGFC 4YGAA 5I2OA 4MZKA 1TNQA 1YR5A 4GGNA 1MR8A 1U5IB 4OR9B 1K2HA 1MWNA 2LMVA 2AAOA 4INWA 1M46A 2LP2A 4JWQA 2ISDA 3PM8A 2NCOA 1LA3A 3BFAA 3VRRA 2ZFDA 2VRGA 3GOFA 2LM5A 3CR5X 2L50A 2HQWA 4ZCVA 4DRWA 2OPOA 4GNKB 1JFKA 1UHKA 3I5GB 4JKTA 3EG5B 1SKTA 3BUXB 4YI8A 3D76A 1ALVA 5CSFA 1BOCA 1J55A 2KHNA 1FW4A 4OCIA 4MZLA 2H61A 4UPGA 2L5YA 1KSMA 2KYCA 1V1GA 3NXAA 1GJYA 1SK6D 1DMOA 1FPWA 5PALA 1IKUA 4MSPA 1RWYA 1DC1A 3JVTC 1OE9B 2KYFA 5D69A 4DCKA 2CXJA 1NCXA 1K96A 5FYXA 3BQ3A 2LUXA 2MAZA 1WY9A
chains in the Genus database with same CATH topology
3L4LA 1C3ZA 2QEOA 3CDNA 3DYEA 3BFHA 3R1VA 3D77A 3NGVA 3L47A 3RZSA 5DICA 3D74A 3NHIA 3B87A 2P71A 3S0GA 4OZDA 1TWOA 4INXA 1GM0A 3PJIA 3CYZA 2H8VA 2WCJA 1C3YA 3CABA 2WCLA 3B7AA 3R1PA 1OOHA 3V2LA 4PT1A 3CZ2A 3FE9A 4F7FA 3NHTA 1LS8A 3S0AA 3R1OA 2P70A 3N7HA 3DXLA 3K1EA 4JD9A 3S0FA 3Q8IA 1TUJA 3S0EA 3CZ0A 3B88A 3FE6A 2FJYA 2ERBA 3B6XA 3QMEA 3B86A 2QEHA 2KPHA 1P28A 3DY9A 1XFRA 3S0BA 2PQLA 3D75A 2JPOA 1OOIX 2L2CA 2WC6A 1DQEA 3R72A 1QWVA 2WC5A 2WCHA 3L4AA 1OOGA 2QEBA 3BJHA 4FQTA 4INWA 1ORGA 3BFAA 2QEVA 2WCMA 2QDIA 3D73A 3FE8A 2GTEA 3DZTA 3CZ1A 3S0DA 3D76A 1OOFA 3D78A 3OGNA 5EL2A 1OW4A 3VB1A 2WCKA 1T14A 3BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4L A;  1C3Z A;  2QEO A;  3CDN A;  3DYE A;  3BFH A;  3R1V A;  3D77 A;  3NGV A;  3L47 A;  3RZS A;  5DIC A;  3D74 A;  3NHI A;  3B87 A;  2P71 A;  3S0G A;  4OZD A;  1TWO A;  4INX A;  1GM0 A;  3PJI A;  3CYZ A;  2H8V A;  2WCJ A;  1C3Y A;  3CAB A;  2WCL A;  3B7A A;  3R1P A;  1OOH A;  3V2L A;  4PT1 A;  3CZ2 A;  3FE9 A;  4F7F A;  3NHT A;  1LS8 A;  3S0A A;  3R1O A;  2P70 A;  3N7H A;  3DXL A;  3K1E A;  4JD9 A;  3S0F A;  3Q8I A;  1TUJ A;  3S0E A;  3CZ0 A;  3B88 A;  3FE6 A;  2FJY A;  2ERB A;  3B6X A;  3QME A;  3B86 A;  2QEH A;  2KPH A;  1P28 A;  3DY9 A;  1XFR A;  3S0B A;  2PQL A;  3D75 A;  2JPO A;  1OOI X;  2L2C A;  2WC6 A;  1DQE A;  3R72 A;  1QWV A;  2WC5 A;  2WCH A;  3L4A A;  1OOG A;  2QEB A;  3BJH A;  4FQT A;  4INW A;  1ORG A;  3BFA A;  2QEV A;  2WCM A;  2QDI A;  3D73 A;  3FE8 A;  2GTE A;  3DZT A;  3CZ1 A;  3S0D A;  3D76 A;  1OOF A;  3D78 A;  3OGN A;  5EL2 A;  1OW4 A;  3VB1 A;  2WCK A;  1T14 A;  3BFB A; 
#chains in the Genus database with same CATH topology
 4TNC A;  1CFC A;  2KI6 C;  1X02 A;  3AAJ A;  3I5F B;  2E6W A;  5BPJ A;  4CFQ A;  3SG5 A;  2LMT A;  3D77 A;  1OQP A;  1DJY A;  2PMY A;  1KSO A;  3NGV A;  4C0L A;  2LVI A;  2KNE A;  3RZS A;  1YUS A;  1CTR A;  3D74 A;  3TDU A;  3VGO A;  3NHI A;  1H4B A;  2WND A;  1SW8 A;  3PAT A;  1KFX L;  2BEC A;  3S0G A;  1NX2 A;  1HT9 A;  2LV7 A;  1AJ5 A;  1CB1 A;  1FI6 A;  3PSR A;  1NX3 A;  2WCF A;  1C07 A;  4USL A;  4INX A;  1SL8 A;  1MXE A;  2Y1N A;  4JPZ B;  1ZUZ A;  5TNC A;  3I5I B;  1M39 A;  1C3Y A;  1KQV A;  3DVJ A;  2WCL A;  3IVT A;  2L4I A;  3JTD B;  1QAT A;  1KFU S;  1SR6 B;  1QLS A;  1F54 A;  2OS8 C;  4PHM A;  3V2L A;  2K7O A;  1IH0 A;  1KWO C;  3CZ2 A;  1OMV A;  1PRW A;  1Z2C B;  1XYD A;  3ZNI A;  2LLS A;  1TRF A;  3A4U B;  3MSE B;  1RTP 1;  4XJK B;  1BF5 A;  3HCM A;  1MHO A;  4P2Y B;  3KPX A;  1DEK A;  2JZI A;  2L0P A;  4IL1 A;  4YGC B;  2A4J A;  2NZ0 A;  3KF9 A;  3PN7 B;  2M1K B;  5HKY A;  4R1E A;  3K1E A;  3GK2 A;  1SPY A;  1DJW A;  1A03 A;  2LCP A;  3SG7 A;  3K21 A;  2LAP A;  1PVB A;  1MQ1 A;  2AMI A;  2KQY A;  3B88 A;  3FE6 A;  1KK8 B;  2BCB A;  1ALW A;  2JNX A;  1DTL A;  5JOL A;  4N1G A;  2ERB A;  1OMR A;  3CR4 X;  3EKH A;  4M2O A;  1S6I A;  3B86 A;  2JXC A;  4NDB A;  1NSH A;  2H2K A;  2QEH A;  1SL9 A;  3O4Y A;  4YGE B;  4BY4 A;  1P28 A;  3DY9 A;  1C7W A;  1EG4 A;  3TZ1 A;  2PQL A;  4F0Z B;  2K2F A;  5CSI A;  1IQ3 A;  4DS7 A;  2WC6 A;  1DQE A;  1QWV A;  1UHI A;  4HSZ A;  1GGZ A;  3OB1 B;  1B9A A;  4GAO A;  4PHK A;  1RFJ A;  3L4A A;  1F4Q A;  2MRD A;  1OOJ A;  1SBJ A;  5JJG A;  1BLQ A;  1L2O C;  1DGU A;  1YX8 A;  1ZAC A;  2V53 A;  1CFD A;  4AQJ A;  2CBL A;  4GUK A;  4WRI A;  1NX0 A;  1ZFS A;  2I2R E;  2F2P A;  4P5O E;  4NQG A;  2KI4 B;  2QEV A;  5HLV A;  2DOQ A;  2HF5 A;  2MJW B;  5I8N A;  2F3Z A;  1BT6 A;  2OTG C;  4BY5 A;  5FI6 A;  5CSN A;  4NDC A;  3CLN A;  3BUW B;  3OX5 A;  2Y4Q A;  1CDL A;  1SY9 A;  1IIO A;  1DEL A;  3IQQ A;  3BUO B;  4N5X A;  1S6C A;  2K2A A;  1OOF A;  1EG3 A;  1PSB A;  1S5G Z;  3D78 A;  2ZNE A;  1U5I A;  1XFY O;  2L2E A;  3NSL A;  4ORA B;  2JT3 A;  2LP3 A;  5J3X A;  3UNW A;  3KEV A;  3AAK A;  1K9U A;  1PK0 D;  1OW4 A;  1V1F A;  1XK4 A;  2KFF A;  4MLW A;  3VRQ A;  4ETO A;  1F4O A;  2JTT A;  1Y6W A;  2KFH A;  3FWB A;  3WHT B;  3WXA A;  3F45 A;  1PSR A;  1TUZ A;  4MVF A;  2WCK A;  4Q04 A;  2KLD A;  3FS7 A;  4MRX A;  1QLK A;  1ZOT B;  4PHN A;  5D3O A;  5HYD A;  1DT7 B;  1L7Z A;  1DGV A;  3CS1 A;  1C3Z A;  1RK9 A;  1FI5 A;  2H61 C;  5FI7 A;  2BKH B;  3SIB A;  1CFF A;  3I5F C;  2QAC A;  2YGU A;  3L47 A;  4A4B A;  5GQQ C;  3RLZ A;  2F2O A;  2ZND A;  1W7J B;  2MHH A;  2EC6 B;  1E8A A;  4N1F A;  4ORB B;  5K89 A;  2JT0 A;  2JOJ A;  1ZMZ A;  1DJG A;  3TUY B;  2O5G A;  2MA2 A;  2H8V A;  2PVB A;  2WCJ A;  1NPQ A;  2LLT A;  1B4C A;  3R1P A;  1XFX O;  5D7F A;  1NUB A;  1B47 A;  3GK4 X;  3O6B A;  4PT1 A;  3NHT A;  1DJH A;  4D1E A;  2MLF C;  2BL0 B;  1KQM B;  1SR6 C;  1QX7 A;  5AER A;  2K60 A;  1UWO A;  1YUU A;  2E30 A;  2QPT A;  1AHR A;  3WHU B;  4AOM A;  2EHB A;  4PDZ A;  3R1O A;  2Y1M A;  1HQV A;  2NXQ A;  3BOW B;  3I5H C;  5G08 A;  1SCV A;  3DXL A;  1DF0 B;  1TTX A;  3GK1 A;  1CFP A;  1LKJ A;  1OSA A;  1SYM A;  2BBM A;  1SNL A;  3Q8I A;  1DJI A;  4M2Q A;  3EK7 A;  1LVC D;  1D1O A;  3DVK A;  3IQO A;  3LK1 A;  2HPS A;  4U8D A;  5ER4 X;  1BR4 B;  1CM4 A;  2M0R A;  1AUI B;  2PAL A;  4L9M A;  1G8I A;  5AAN A;  4PHJ A;  3TDI A;  1A4P A;  1CDM A;  4XJK A;  5AFP A;  1GGW A;  4QJ4 B;  2SAS A;  2F8P A;  1S5G Y;  3HX4 A;  1MXL C;  1TCO B;  1UHJ A;  1B8C A;  3KHE A;  1BG1 A;  1KK7 Y;  3CWG A;  1NIW A;  2GV5 A;  1BJF A;  2K0J A;  2LVK A;  1J7R A;  4HRG A;  3PM2 A;  1N2D A;  2L2C A;  1F70 A;  2BBN A;  2K7B A;  2BKI B;  3TS5 C;  2WC5 A;  5I2Q A;  1J7O A;  4PE1 A;  1GQM A;  1J7Q A;  4I5L B;  2ZRS A;  4C0K A;  3PFV A;  3PAL A;  1JC2 A;  3O78 A;  1BMO A;  3SJS A;  2BCA A;  1IQ5 A;  5IBW A;  2FCD A;  1K90 D;  1YVH A;  2F33 A;  1TNX A;  3DVM A;  3ICB A;  2PRU A;  1WLM A;  2WCM A;  2QDI A;  1TN4 A;  1WDC C;  3FE8 A;  4PE7 A;  2GTE A;  1W9Z A;  4C0J A;  4I5N B;  3DZT A;  2K61 A;  3DF0 B;  3S0D A;  5HL1 A;  2K7C A;  3OP0 A;  1K94 A;  1IWQ A;  4MRY A;  3OGN A;  4ORC B;  3DVE A;  2CNP A;  5DKQ A;  5DKR A;  1B7T Z;  1K9K A;  3AKB A;  2FCE A;  4OKH A;  4DUQ A;  1EJ3 A;  1XVJ A;  1JF0 A;  3IF7 A;  3RM1 A;  1QVI Z;  1UUR A;  2B1U A;  2KLE A;  1XFV O;  2OS8 B;  3VB1 A;  5I2L A;  2KAX A;  1QJT A;  1KWO B;  3BFB A;  1RJV A;  3OB2 B;  2JUL A;  1WRL A;  1JUO A;  4MZJ A;  2MBX A;  3EVR A;  2GGZ A;  2QEO A;  1DJX A;  3VRN A;  1AP4 A;  1A75 A;  1IGV A;  1J7P A;  1K95 A;  3QRX A;  1XFU O;  1UHH A;  1TIZ A;  1XK4 C;  2BNX A;  2Q91 A;  3R1V A;  4FQO A;  1AJ4 A;  1Q80 A;  2EGD A;  2P6B B;  3VRO A;  4WQ2 A;  5FI2 A;  5DIC A;  1CDN A;  1LA0 A;  1J1E A;  3BYA A;  2KBI A;  1W7I B;  2LC5 A;  3B87 A;  2P71 A;  3M0W A;  1A75 B;  3BUN B;  1XFZ O;  1CDP A;  3FIA A;  3I5G C;  4MBE A;  2D8N A;  2PSR A;  4XYN A;  2LHI A;  1TWO A;  1JWD A;  1GM0 A;  5DKN A;  1IRJ A;  2KAV A;  2ZN9 A;  1F8H A;  2KGB C;  2NCP A;  3SS5 A;  2KAY A;  4JQ0 D;  1SCM B;  3CAB A;  3B7A A;  4AQI A;  1WRZ A;  1IJ6 A;  2F3Y A;  1SSE B;  2WC8 A;  1K93 D;  2KDH A;  1KCY A;  1BU3 A;  3FE9 A;  4HRE E;  4F7F A;  4YRU A;  2COL B;  1N0Y A;  2I94 A;  1TOP A;  4HRH A;  1B1G A;  1LS8 A;  3S0A A;  3OX6 A;  3N7H A;  2CCM A;  3NSI A;  5HKW A;  2BL0 C;  1YX7 A;  1S26 D;  1L2O B;  2JC2 A;  2LVJ A;  2WCE A;  3D0Y B;  2CT9 A;  1PUL A;  1TUJ A;  3S0E A;  3CZ0 A;  2M9G A;  2HQ8 A;  3SS4 A;  3C1V A;  1PVA A;  3CTN A;  2I18 A;  2FJY A;  3SG3 A;  3TDZ A;  1K8U A;  1QX2 A;  2FOT A;  2OTG B;  1S3P A;  4I5K A;  1IJ5 A;  1YTZ C;  3O4X A;  4CFR A;  3B6X A;  1CLM A;  5KSZ A;  1CNP A;  2WCB A;  1R6P A;  1UP5 A;  4GGF A;  3BOW A;  1B7T Y;  1N65 A;  1OZS A;  1DF0 A;  3OHM B;  3I5I C;  2TN4 A;  5B8I B;  3SS3 A;  3AKA A;  3JTD C;  3EK4 A;  1QIV A;  1OMD A;  1QVI Y;  1NYA A;  2KFG A;  3S0B A;  1OOI X;  3PLF B;  3R72 A;  2M3W A;  3SG6 A;  1C7V A;  2WCH A;  2LHL A;  3SG2 A;  1NCY A;  2PYQ A;  1REC A;  2LUC A;  2KI6 D;  1YRU B;  1QTX A;  4GPL B;  1OOG A;  2LAN A;  3LK0 A;  3PN7 C;  2BE6 A;  1YRT B;  3BJH A;  4PCW A;  4FQT A;  1NX1 A;  4FTG A;  1FF1 A;  1KFU L;  1A29 A;  3EVV A;  1S36 A;  2IS9 A;  1JSA A;  2ZKM X;  1QX5 B;  1ORG A;  1KK8 C;  1TNW A;  1UHN A;  2ZRT A;  2RGI A;  1SMG A;  2I7A A;  2K7D A;  1EH2 A;  3D73 A;  2Y5I A;  2M8U A;  3CGA A;  3D10 A;  1NCZ A;  2Q4U A;  1M63 B;  2R2I A;  3CZ1 A;  1WRK A;  4YGD B;  2M29 A;  3SG4 A;  2L5X B;  2PAS A;  4QJ5 B;  5EL2 A;  2M49 B;  1ODB A;  1YUT A;  4CID A;  4IJ7 A;  2JRF A;  3JVT B;  2WOR A;  1KFX S;  1CKK A;  2ZN8 A;  2JQ6 A;  1PAL A;  1FBV A;  4OV2 A;  2M1U A;  1T14 A;  1S6J A;  3LLE A;  2L4H A;  4M2P A;  2M97 A;  2JT8 A;  3VRP A;  1QS7 A;  2BE4 A;  1AVS A;  3L4L A;  2LNK A;  3DF0 A;  1TCF A;  3O2P A;  3LL8 B;  1SRA A;  5F6T A;  1YUR A;  2KBM A;  4MN0 A;  3I5H B;  3CDN A;  3DYE A;  3BFH A;  2LLU A;  2O60 A;  3CR2 A;  1Y1U A;  4I5J A;  2MLE C;  3OBV A;  4YBH B;  5CPV A;  3ZWH A;  2KI4 C;  2GGM A;  2KOT A;  4WQ3 A;  2M7N A;  1QAS A;  1LXF C;  1Y1A A;  4ICB A;  4NDD A;  4PE0 A;  5AEQ A;  4CPV A;  4OZD A;  1G33 A;  2KQ6 A;  1R2U A;  3DD4 A;  3LCP C;  4PE4 A;  5KTY A;  2G9B A;  3BXK A;  2KGR A;  1Y0V H;  1CMG A;  3PJI A;  2LVV A;  2NLN A;  1RRO A;  2WOS A;  3CYZ A;  1MF8 B;  4QJ3 B;  5ER5 A;  1QV1 A;  5AXI A;  4E68 A;  1M31 A;  1XFW O;  1BR1 B;  2L98 A;  3A8R A;  5HLO A;  2JTZ A;  3EVU A;  1QV0 A;  1OOH A;  1EXR A;  2AUC A;  4YGB B;  1B8L A;  1XA5 A;  4GBA A;  1WLZ A;  1SCM C;  4PAL A;  5CSJ A;  3CZT X;  3TS5 B;  1CMF A;  5KU1 A;  1AK8 A;  1K9P A;  1XO5 A;  1YVL A;  2JNF A;  3EK8 A;  1F55 A;  4KYN A;  2KSP A;  5I94 A;  2LMU A;  1Z4H A;  3H4S E;  1DVI A;  2P70 A;  1JFJ A;  4ZCU A;  3E3R A;  1B8R A;  4OVN F;  3NSK A;  4A4C A;  1BOD A;  1OZO A;  2CTN A;  4JD9 A;  3S0F A;  1CM1 A;  3SIA A;  1EL4 A;  3KO0 A;  1IG5 A;  2JU0 A;  1NWD A;  3BUM B;  1MUX A;  1F71 A;  2HET A;  1A2X A;  1NP8 A;  2EC6 C;  1WDC B;  2BAP A;  4MEW A;  3FWC A;  2JWW A;  2G2B A;  3QME A;  1DJZ A;  1TNP A;  2SCP A;  4YI9 A;  2K8M B;  3TUY C;  3NSO A;  1SL7 A;  1QXP A;  2LE9 B;  1LIN A;  2KPH A;  2L51 A;  1QIW A;  1JF2 A;  2M7L A;  3D0Y A;  1J1D A;  1Y1X A;  3EKJ A;  4CLN A;  1CLB A;  1XFR A;  1S1E A;  2BCX A;  3D75 A;  2JXL A;  3UO9 A;  2JPO A;  2JPT A;  1G4Y R;  4DIR A;  1JBA A;  1UUS A;  1H8B A;  1KK7 Z;  1KQM C;  2FJU B;  3WNX B;  4GFT A;  5HKZ A;  1M45 A;  1CLL A;  1VRK A;  2QEB A;  4GGF C;  4YGA A;  5I2O A;  4MZK A;  1TNQ A;  1YR5 A;  4GGN A;  1MR8 A;  1U5I B;  4OR9 B;  1K2H A;  1MWN A;  2LMV A;  2AAO A;  4INW A;  1M46 A;  2LP2 A;  4JWQ A;  2ISD A;  3PM8 A;  2NCO A;  1LA3 A;  3BFA A;  3VRR A;  2ZFD A;  2VRG A;  3GOF A;  2LM5 A;  3CR5 X;  2L50 A;  2HQW A;  4ZCV A;  4DRW A;  2OPO A;  4GNK B;  1JFK A;  1UHK A;  3I5G B;  4JKT A;  3EG5 B;  1SKT A;  3BUX B;  4YI8 A;  3D76 A;  1ALV A;  5CSF A;  1BOC A;  1J55 A;  2KHN A;  1FW4 A;  4OCI A;  4MZL A;  2H61 A;  4UPG A;  2L5Y A;  1KSM A;  2KYC A;  1V1G A;  3NXA A;  1GJY A;  1SK6 D;  1DMO A;  1FPW A;  5PAL A;  1IKU A;  4MSP A;  1RWY A;  1DC1 A;  3JVT C;  1OE9 B;  2KYF A;  5D69 A;  4DCK A;  2CXJ A;  1NCX A;  1K96 A;  5FYX A;  3BQ3 A;  2LUX A;  2MAZ A;  1WY9 A; 
#chains in the Genus database with same CATH homology
 3L4L A;  1C3Z A;  2QEO A;  3CDN A;  3DYE A;  3BFH A;  3R1V A;  3D77 A;  3NGV A;  3L47 A;  3RZS A;  5DIC A;  3D74 A;  3NHI A;  3B87 A;  2P71 A;  3S0G A;  4OZD A;  1TWO A;  4INX A;  1GM0 A;  3PJI A;  3CYZ A;  2H8V A;  2WCJ A;  1C3Y A;  3CAB A;  2WCL A;  3B7A A;  3R1P A;  1OOH A;  3V2L A;  4PT1 A;  3CZ2 A;  3FE9 A;  4F7F A;  3NHT A;  1LS8 A;  3S0A A;  3R1O A;  2P70 A;  3N7H A;  3DXL A;  3K1E A;  4JD9 A;  3S0F A;  3Q8I A;  1TUJ A;  3S0E A;  3CZ0 A;  3B88 A;  3FE6 A;  2FJY A;  2ERB A;  3B6X A;  3QME A;  3B86 A;  2QEH A;  2KPH A;  1P28 A;  3DY9 A;  1XFR A;  3S0B A;  2PQL A;  3D75 A;  2JPO A;  1OOI X;  2L2C A;  2WC6 A;  1DQE A;  3R72 A;  1QWV A;  2WC5 A;  2WCH A;  3L4A A;  1OOG A;  2QEB A;  3BJH A;  4FQT A;  4INW A;  1ORG A;  3BFA A;  2QEV A;  2WCM A;  2QDI A;  3D73 A;  3FE8 A;  2GTE A;  3DZT A;  3CZ1 A;  3S0D A;  3D76 A;  1OOF A;  3D78 A;  3OGN A;  5EL2 A;  1OW4 A;  3VB1 A;  2WCK A;  1T14 A;  3BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...