1C7VA

Nmr solution structure of the calcium-bound c-terminal domain (w81-s161) of calcium vector protein from amphioxus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
EEEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDIPEFMDLIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords CALCIUM VECTOR PROTEIN
publication title Sequential calcium binding to the regulatory domain of calcium vector protein reveals functional asymmetry and a novel mode of structural rearrangement.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2000-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1c7vA00
2KBMA 4F0ZB 2P6BB 4CPVA 2M3WA 3TUYB 4A4BA 3SG7A 1F4OA 5KTYA 2QPTA 1J55A 1MR8A 2WNDA 1S3PA 1BODA 3DF0A 3HX4A 3I5GB 1QX5B 2A4JA 4JQ0D 1IGVA 2K8MB 1QLKA 4YGEB 1CFDA 1PSBA 1TTXA 4YGBB 4CFQA 2M0RA 4GGNA 1ALVA 2V53A 4DUQA 4TNCA 4YBHB 1K9UA 1SMGA 4DIRA 1JF2A 1KK8B 3BOWB 1DVIA 4HRHA 1IG5A 1QX7A 2IS9A 4GPLB 4BY4A 1S6CA 1BF5A 1X02A 4AQJA 2O5GA 1IRJA 1DJHA 3PSRA 3ZWHA 2ZNEA 1FI5A 1OQPA 5BPJA 1YRUB 2H2KA 1XK4A 1KWOC 2Y1MA 1UUSA 2EC6C 2F8PA 2ZN9A 1KQMB 1MF8B 2JC2A 3I5FC 3OP0A 5IBWA 1HQVA 2WOSA 2LHLA 1GGZA 1YUSA 1CDMA 3IF7A 1B8RA 1UHNA 3GK1A 2MJWB 4GFTA 2JNFA 1CDNA 4MRYA 1CNPA 4CLNA 5AFPA 1C07A 3I5IB 4C0KA 2GGZA 1B8CA 1FBVA 1UP5A 4QJ5B 2LLUA 5HLOA 1LKJA 3WHTB 2F3ZA 1E8AA 1S6IA 4OR9B 2AMIA 1RWYA 4N1GA 1SNLA 3CLNA 2EGDA 1Q80A 3I5HC 1DMOA 2K2AA 2LLSA 5HLVA 1QVIY 1WLZA 1QIWA 1SR6C 2LHIA 3BXKA 4MZJA 5I2OA 4MBEA 4CFRA 3SIAA 2E30A 1OZOA 2G2BA 1PVBA 1XFXO 1KK7Z 2K2FA 2KFHA 5CPVA 2PSRA 1QATA 1SCMC 1MXLC 1M63B 3KF9A 3JVTC 1KFUL 2NXQA 1ZUZA 2DOQA 3PFVA 3RLZA 1B9AA 2ZNDA 2BKHB 2LC5A 2GV5A 2Q91A 1A29A 3LK1A 2M8UA 2LVJA 4NDDA 2WCFA 1NCYA 2JT0A 1NIWA 1YURA 4OKHA 2LVIA 1IQ3A 4HRGA 1M45A 2ZKMX 1TCOB 3D10A 4PE7A 1AVSA 1AUIB 2LMTA 2FCDA 1RECA 3NSLA 1AHRA 3QRXA 3MSEB 2BBNA 1PK0D 3CR5X 2WC8A 3WNXB 2MA2A 2KHNA 2LLTA 2H61C 2JXLA 1PVAA 2OTGB 1SY9A 3NXAA 1IQ5A 1A4PA 1N65A 2JTZA 1RK9A 1U5IA 2BE4A 2JT8A 5AERA 1QX2A 3HCMA 3PN7C 1WDCC 1AP4A 4FTGA 2KAXA 1YR5A 4P5OE 2LVKA 2MRDA 1OMDA 1L2OB 1A75A 2LE9B 1QJTA 1AJ4A 3DF0B 3NSOA 2K61A 5D69A 2BCBA 1M39A 4GBAA 1IJ5A 2L50A 1Y0VH 1KCYA 2Y1NA 2KYFA 2LMUA 3GK4X 2F3YA 5F6TA 4I5KA 1XFUO 1OMRA 2LP3A 1S6JA 5I2QA 2KOTA 4PHNA 3OX5A 1UURA 1TOPA 2MHHA 5CSIA 1Y1XA 1J1DA 1KK8C 1B8LA 1F4QA 1UHIA 2FCEA 3O6BA 2AAOA 1DJZA 1NX2A 1TNXA 2M49B 1YTZC 1B4CA 3TS5C 4I5JA 1RJVA 4MLWA 1B1GA 1JFJA 2LCPA 3FWBA 2JQ6A 4YGAA 1DJYA 1SL9A 1M46A 1IJ6A 2PMYA 1XO5A 1TN4A 1N0YA 1CFCA 4MN0A 2I18A 1KQMC 5TNCA 1RFJA 2KYCA 1CMGA 1RTP1 3IQQA 3JTDC 1NX1A 2BCXA 3K21A 4GGFC 1DJIA 2LAPA 1AJ5A 1K9KA 1LA0A 2E6WA 3IQOA 3O78A 4ORCB 2L5XB 4AQIA 1K9PA 3EK7A 2HQWA 3LCPC 4NDCA 1XVJA 1LA3A 2KI4C 2L4IA 1MWNA 2H61A 2M1KB 1EG3A 1XFZO 4PALA 1F54A 3EKHA 3GK2A 1B7TZ 2GGMA 3H4SE 3WXAA 1SL8A 2AUCA 2JRFA 2JXCA 2KQ6A 2SCPA 1EH2A 2CBLA 1CLLA 4YGCB 2NCOA 4OV2A 3D0YA 1ALWA 1PULA 1CFFA 5G08A 4YRUA 3DD4A 1DJGA 1TNWA 3VRNA 1KK7Y 1F71A 1A2XA 2JWWA 2COLB 2M1UA 2PASA 1BJFA 3M0WA 2CXJA 2OPOA 2L0PA 1OSAA 2I2RE 2KGRA 1JSAA 3CTNA 3KPXA 4PE0A 1KFXL 4U8DA 3CWGA 3VGOA 1ZFSA 1C7VA 2HPSA 5DKRA 1ODBA 3FIAA 2LUCA 1G8IA 1Y6WA 2K7CA 3SG6A 3OB1B 4JPZB 4CIDA 5ER5A 2JNXA 1KWOB 4ETOA 1NWDA 2FJUB 1G4YR 3BUNB 4ICBA 1H8BA 2EC6B 1S1EA 3I5FB 1JC2A 2Y4QA 1IWQA 1XYDA 4PE4A 2KSPA 4Q04A 3EVUA 3NSIA 1EJ3A 3TDIA 2Q4UA 4IL1A 4L9MA 3OHMB 4I5NB 1N2DA 4GGFA 1BG1A 3CZTX 2OS8B 5B8IB 1WRZA 1BR4B 5HKWA 4AOMA 5DKQA 2KFGA 3ICBA 1UHHA 2BL0B 2NLNA 3CR2A 4ORBB 3O2PA 4C0JA 1FF1A 1J7OA 2M29A 1C7WA 4WRIA 2NZ0A 1PSRA 3I5HB 1U5IB 3VRQA 1ZACA 4ORAB 1CKKA 5I2LA 3VRRA 1BU3A 1QASA 1QS7A 5HKZA 5AANA 1MXEA 3SG4A 3DVMA 4NDBA 5CSNA 1V1GA 2LNKA 3EK4A 1A75B 3EK8A 1DTLA 1YX7A 5GQQC 1CM4A 1D1OA 1WRLA 1CTRA 3SG3A 4MRXA 3LLEA 5AXIA 5FYXA 2L2EA 4YI8A 1SCMB 3O4YA 1NCXA 1TNPA 2I94A 2K7OA 5CSFA 1SPYA 1K96A 3JVTB 4XJKA 3DVJA 1J7QA 2LUXA 2M7NA 1SRAA 2KDHA 3KO0A 2ZRSA 2LV7A 1NYAA 3ZNIA 4UPGA 3PLFB 1UHKA 4GAOA 2M7LA 4BY5A 1F55A 1GQMA 2Y5IA 2CTNA 3BYAA 4MEWA 5K89A 1SL7A 3TUYC 2B1UA 3OX6A 4DS7A 1S5GZ 1W7JB 1SBJA 5AEQA 1ZOTB 3I5GC 1FPWA 1TCFA 2KFFA 1KSOA 3LK0A 4GUKA 1R6PA 2JOJA 1XFWO 1SYMA 4QJ4B 1CMFA 2FOTA 2WCEA 1MQ1A 4OCIA 1DGVA 1QIVA 2WORA 3A8RA 3KEVA 2KAVA 1DGUA 2KGBC 2ZFDA 2R2IA 5HYDA 3VRPA 3BUOB 1MHOA 1DJXA 3TDZA 4QJ3B 4D1EA 1B7TY 3DVKA 1S26D 3PM8A 4N1FA 1MUXA 3C1VA 2MLFC 1LVCD 1QV1A 1NSHA 1CDPA 2CNPA 1A03A 1WDCB 3KHEA 2BKIB 4ZCVA 1B47A 5J3XA 3SG2A 2JULA 1CB1A 3BUWB 5CSJA 3D0YB 4JWQA 1KSMA 3AAKA 1DF0A 1K90D 1F8HA 3DVEA 1H4BA 3TZ1A 1XA5A 1YX8A 1TRFA 3I5IC 1KQVA 3CS1A 3E3RA 4I5LB 3RM1A 1J7PA 2BCAA 1DJWA 2LM5A 2QACA 1LINA 5ER4X 4PCWA 1BOCA 4XYNA 2TN4A 1HT9A 3CR4X 4YGDB 2KNEA 2BE6A 2ISDA 1CLMA 1R2UA 1CM1A 2JZIA 2K0JA 4PHJA 1CDLA 1K94A 2MAZA 1FI6A 3TS5B 1Y1UA 2I7AA 1YRTB 1WRKA 2BBMA 1Y1AA 2JPTA 1EL4A 3BQ3A 2PVBA 3FS7A 4NQGA 1M31A 1S36A 3JTDB 3LL8B 1EXRA 1NX3A 1SKTA 1V1FA 4PE1A 1TIZA 1W7IB 1UWOA 2JTTA 3BOWA 1QTXA 1F70A 5PALA 2F2OA 2L98A 2KI4B 2M97A 2KBIA 1YVLA 2K7BA 2OS8C 2MBXA 1QXPA 2K7DA 1SK6D 2ZN8A 5D7FA 1L7ZA 2BL0C 1GGWA 2F33A 3SIBA 1ZMZA 3BUMB 2G9BA 1NX0A 4MSPA 3A4UB 1G33A 3PALA 3VROA 4E68A 1KFXS 4DRWA 3GOFA 1SCVA 3SG5A 2PALA 3BUXB 4GNKB 1DT7B 2JU0A 3PATA 1PALA 4YI9A 3EVRA 5JOLA 1K93D 2WCBA 3EVVA 2HETA 2LMVA 1WLMA 2HF5A 3AKAA 1XFYO 1NP8A 1SR6B 2LP2A 1XFVO 1OZSA 4XJKB 2OTGC 3TDUA 1CLBA 4M2OA 1J7RA 1NCZA 5KU1A 1JF0A 3AAJA 1KFUS 1RROA 1SW8A 2O60A 1QVIZ 2MLEC 4MZKA 2L4HA 1BLQA 4MVFA 2ZRTA 4PHKA 1L2OC 1S5GY 2JT3A 2RGIA 2CCMA 3AKBA 4HSZA 2M9GA 4FQOA 4PDZA 1LXFC 4WQ2A 1IKUA 2KAYA 1UHJA 1NPQA 2LANA 2VRGA 1FW4A 4USLA 1OE9B 4WQ3A 4M2QA 1NUBA 2D8NA 2KI6C 4N5XA 2F2PA 1BMOA 4R1EA 1IH0A 1YUTA 3FWCA 1TNQA 4M2PA 3OB2B 1EG4A 1OOJA 1JBAA 1XK4C 5I8NA 2NCPA 1QLSA 1VRKA 5DKNA 1QV0A 1JUOA 1WY9A 2KI6D 2KQYA 4A4CA 1YVHA 3EKJA 3CGAA 4PHMA 2EHBA 1AK8A 1J1EA 1K95A 4C0LA 1CFPA 5HKYA 4MZLA 3WHUB 2CT9A 1DF0B 1K8UA 1YUUA 4ZCUA 4HREE 3NSKA 1K2HA 1OMVA 5JJGA 1JWDA 3F45A 4P2YB 2LVVA 1JFKA 4OVNF 1BR1B 2HQ8A 2SASA 5KSZA 1BT6A 3PN7B 2PRUA 1GJYA 1PRWA 2L51A 2BECA 3SJSA 4DCKA
chains in the Genus database with same CATH superfamily
2KBMA 4F0ZB 2P6BB 4CPVA 2M3WA 3TUYB 4A4BA 3SG7A 1F4OA 5KTYA 2QPTA 1J55A 1MR8A 2WNDA 1S3PA 1BODA 3DF0A 3HX4A 3I5GB 1QX5B 2A4JA 4JQ0D 1IGVA 2K8MB 1QLKA 4YGEB 1CFDA 1PSBA 1TTXA 2QEOA 4YGBB 4CFQA 2M0RA 2P71A 1ALVA 2V53A 4GGNA 4DUQA 4TNCA 4YBHB 1K9UA 1SMGA 3QMEA 4DIRA 1JF2A 3S0AA 1KK8B 3BOWB 1DVIA 4HRHA 1IG5A 1QX7A 2IS9A 4GPLB 4BY4A 1S6CA 1BF5A 1X02A 4AQJA 2O5GA 1IRJA 1DJHA 3PSRA 3S0FA 3ZWHA 2ZNEA 1FI5A 1OQPA 5D3OA 5BPJA 1YRUB 2H2KA 1OOIX 1XK4A 1KWOC 2Y1MA 1UUSA 2EC6C 2F8PA 2ZN9A 1KQMB 1MF8B 2JC2A 3I5FC 3OP0A 5IBWA 1HQVA 2WOSA 2LHLA 1GGZA 1YUSA 1CDMA 3IF7A 3R72A 1B8RA 1UHNA 3GK1A 2MJWB 4GFTA 2JNFA 1CDNA 3D73A 4MRYA 1CNPA 4CLNA 5AFPA 1C07A 3I5IB 4C0KA 1LS8A 3B7AA 2GGZA 1B8CA 1FBVA 1UP5A 4QJ5B 2LLUA 5HLOA 1LKJA 3WHTB 2F3ZA 1E8AA 1S6IA 4OR9B 2AMIA 1RWYA 4N1GA 1SNLA 3CLNA 2EGDA 1Q80A 3I5HC 3CZ1A 1DMOA 2K2AA 2LLSA 5HLVA 1QVIY 1WLZA 4JD9A 1QIWA 1SR6C 2LHIA 3BXKA 3UNWA 4MZJA 3V2LA 5I2OA 4MBEA 4CFRA 1TWOA 1Z2CB 3SIAA 2E30A 1C3ZA 1OZOA 2G2BA 1PVBA 1XFXO 1KK7Z 2KPHA 2K2FA 2KFHA 5CPVA 2PSRA 1QATA 1SCMC 1TUZA 1MXLC 1M63B 1Z4HA 3KF9A 3JVTC 1KFUL 2NXQA 1ZUZA 2DOQA 2QDIA 3PFVA 3FE6A 3RLZA 1B9AA 2ZNDA 2BKHB 2LC5A 2GV5A 5EL2A 2Q91A 1A29A 3LK1A 1OW4A 2M8UA 3SS3A 2LVJA 4NDDA 2WCFA 1NCYA 2JT0A 1NIWA 1YURA 4OKHA 3BFAA 2LVIA 1IQ3A 4HRGA 1M45A 2ZKMX 1TCOB 4KYNA 3D10A 4PE7A 1AVSA 1AUIB 2LMTA 2FCDA 1RECA 3NSLA 1AHRA 3QRXA 3MSEB 3L47A 4FQTA 1C3YA 2BBNA 1PK0D 2WCMA 3CR5X 2WC8A 3WNXB 2MA2A 2KHNA 2LLTA 2H61C 2JXLA 1PVAA 2OTGB 1SY9A 3NXAA 1IQ5A 1A4PA 1N65A 2JTZA 1RK9A 1U5IA 2BE4A 3D74A 2JT8A 5AERA 1QX2A 3HCMA 3SS5A 3PN7C 1WDCC 1AP4A 4FTGA 2KAXA 1YR5A 4P5OE 2LVKA 2MRDA 1OMDA 1L2OB 1A75A 2LE9B 1QJTA 1AJ4A 3DF0B 3NHTA 3L4AA 3NSOA 2K61A 2P70A 5D69A 3DZTA 2BCBA 1M39A 2KLDA 4GBAA 1IJ5A 2L50A 1Y0VH 1KCYA 2Y1NA 2KYFA 2LMUA 3GK4X 2F3YA 5FI6A 5F6TA 4I5KA 1XFUO 1OMRA 2LP3A 1S6JA 5I2QA 2KOTA 4PHNA 3OX5A 1UURA 1TOPA 2MHHA 5CSIA 1Y1XA 1J1DA 1B8LA 1KK8C 1F4QA 1UHIA 2FCEA 3O6BA 2AAOA 3BFBA 1DJZA 3SS4A 1NX2A 1TNXA 2M49B 1YTZC 1B4CA 3TS5C 4I5JA 1RJVA 4MLWA 1B1GA 1XFRA 1JFJA 2LCPA 3FWBA 2JQ6A 4YGAA 1DJYA 1SL9A 2PQLA 3BFHA 1M46A 1IJ6A 2PMYA 1XO5A 1TN4A 1N0YA 1CFCA 4MN0A 2I18A 1KQMC 5TNCA 1RFJA 2KYCA 1CMGA 1RTP1 3IQQA 3JTDC 1NX1A 2BCXA 3K21A 3R1OA 4GGFC 1DJIA 2LAPA 3S0EA 1AJ5A 1K9KA 1LA0A 2E6WA 3IQOA 3O78A 4ORCB 2L5XB 4AQIA 1K9PA 3EK7A 2HQWA 3LCPC 4NDCA 1XVJA 1LA3A 2KI4C 2L4IA 1MWNA 2H61A 2M1KB 1EG3A 1XFZO 4PALA 1F54A 2KLEA 1OOHA 3EKHA 3GK2A 1B7TZ 2GGMA 3FE8A 3H4SE 3WXAA 1SL8A 2AUCA 2JRFA 2JXCA 2KQ6A 2SCPA 1EH2A 2CBLA 1CLLA 4YGCB 2NCOA 2WC5A 4OV2A 3D0YA 1ALWA 1PULA 1IIOA 1CFFA 5G08A 4YRUA 3DD4A 1DJGA 1TNWA 3VRNA 1KK7Y 1F71A 1A2XA 3DY9A 2JWWA 2COLB 4F7FA 2M1UA 2PASA 1BJFA 3EG5B 3M0WA 2CXJA 3CDNA 2OPOA 2L0PA 3Q8IA 1OSAA 2I2RE 2KGRA 1JSAA 3CTNA 3KPXA 4PE0A 1KFXL 3CYZA 4U8DA 2JPOA 3CWGA 3VGOA 1ZFSA 1C7VA 1SSEB 2HPSA 5DKRA 1ODBA 3FIAA 2LUCA 1G8IA 1Y6WA 2K7CA 3SG6A 3OB1B 4JPZB 4CIDA 5ER5A 2JNXA 1KWOB 4ETOA 1NWDA 2FJUB 1G4YR 3BUNB 1OOFA 4ICBA 3PJIA 1H8BA 2EC6B 1S1EA 5FI7A 3I5FB 2WCKA 1JC2A 2Y4QA 1IWQA 1XYDA 4PE4A 2KSPA 4Q04A 3EVUA 3NSIA 1QWVA 1EJ3A 3TDIA 2Q4UA 4IL1A 4L9MA 3OHMB 3D76A 4I5NB 1N2DA 4GGFA 5I94A 1BG1A 3CZTX 2OS8B 5B8IB 1WRZA 1BR4B 5HKWA 4AOMA 5DKQA 2KFGA 3ICBA 1UHHA 5HL1A 2BL0B 2NLNA 3CR2A 2GTEA 4ORBB 3O2PA 4C0JA 1FF1A 1J7OA 2M29A 1C7WA 4WRIA 2NZ0A 1PSRA 3I5HB 1U5IB 3CABA 1ZACA 4ORAB 3VRQA 5I2LA 1CKKA 3VRRA 1BU3A 1QASA 1QS7A 5HKZA 5AANA 1MXEA 3SG4A 2BNXA 3DVMA 4NDBA 2WC6A 1V1GA 2LNKA 5CSNA 3D75A 4INXA 3EK4A 1A75B 3EK8A 1DTLA 1YX7A 5GQQC 1CM4A 1D1OA 1WRLA 1CTRA 3SG3A 4MRXA 3LLEA 5AXIA 2WCLA 5FYXA 2L2EA 4YI8A 1SCMB 3O4YA 1NCXA 1TNPA 1OOGA 2I94A 2K7OA 2QEVA 1SPYA 5CSFA 3UO9A 1DEKA 1K96A 3JVTB 3B86A 3DVJA 4XJKA 2LUXA 1J7QA 2M7NA 1SRAA 2KDHA 3KO0A 2ZRSA 2LV7A 1NYAA 3ZNIA 3NGVA 4UPGA 3PLFB 1UHKA 4GAOA 2M7LA 3N7HA 4BY5A 1F55A 1GQMA 2Y5IA 2CTNA 3BYAA 4MEWA 5K89A 1SL7A 3TUYC 1P28A 2B1UA 3OX6A 4DS7A 3D77A 1S5GZ 1W7JB 1SBJA 5AEQA 1ZOTB 3I5GC 1FPWA 1TCFA 2KFFA 1KSOA 3LK0A 4GUKA 1R6PA 2JOJA 1XFWO 1SYMA 4QJ4B 1CMFA 2FOTA 2WCEA 1MQ1A 4OCIA 1DGVA 3PM2A 1QIVA 2WORA 3A8RA 3KEVA 2KAVA 1DGUA 2KGBC 2ZFDA 2R2IA 5HYDA 3VRPA 3BUOB 1MHOA 1DJXA 4IJ7A 3TDZA 4QJ3B 4D1EA 1B7TY 3DVKA 1S26D 3PM8A 4N1FA 1MUXA 3C1VA 2MLFC 1LVCD 1QV1A 1NSHA 1CDPA 3D78A 2CNPA 1A03A 1WDCB 3KHEA 2BKIB 4ZCVA 1B47A 5J3XA 3SG2A 2JULA 1CB1A 3BUWB 5CSJA 3D0YB 4JWQA 1KSMA 3AAKA 1DF0A 1K90D 1F8HA 3DVEA 1H4BA 3TZ1A 1XA5A 1YX8A 1TRFA 3I5IC 1KQVA 3VB1A 4INWA 3CS1A 3E3RA 4I5LB 3RM1A 1J7PA 2BCAA 1DJWA 2LM5A 2QACA 1LINA 5ER4X 4PCWA 1BOCA 1DQEA 4XYNA 2TN4A 1HT9A 3CR4X 4YGDB 1DC1A 2KNEA 2BE6A 2ISDA 1CLMA 1R2UA 3B88A 1CM1A 2JZIA 2K0JA 4PHJA 5DICA 5FI2A 1CDLA 2L5YA 3BJHA 2YGUA 2L2CA 1K94A 3K1EA 2MAZA 1FI6A 3TS5B 1Y1UA 2I7AA 1YRTB 1WRKA 3FE9A 2BBMA 1Y1AA 2JPTA 1EL4A 3BQ3A 2PVBA 3FS7A 4NQGA 1M31A 1S36A 3JTDB 3LL8B 1EXRA 1NX3A 1SKTA 1V1FA 4PE1A 3DXLA 1TIZA 1W7IB 1UWOA 2JTTA 3BOWA 1QTXA 1F70A 3NHIA 5PALA 2F2OA 2L98A 2WCJA 2KI4B 2M97A 2KBIA 2H8VA 1YVLA 2K7BA 2OS8C 2MBXA 1QXPA 2K7DA 1SK6D 2ZN8A 5D7FA 1L7ZA 2BL0C 1GGWA 2F33A 3SIBA 1ZMZA 3BUMB 3R1VA 4JKTA 2G9BA 1NX0A 4MSPA 3A4UB 1G33A 3PALA 3VROA 4E68A 2QEHA 1KFXS 4DRWA 3GOFA 1SCVA 3SG5A 2PALA 3BUXB 4GNKB 1DT7B 2JU0A 3DYEA 3PATA 1PALA 4YI9A 3EVRA 5JOLA 1K93D 2WCBA 3EVVA 2HETA 4PT1A 2LMVA 3B6XA 1WLMA 2HF5A 3CZ2A 1ORGA 3AKAA 1XFYO 1NP8A 1SR6B 1TUJA 1XFVO 1OZSA 2LP2A 2OTGC 3OGNA 4XJKB 3TDUA 4M2OA 1T14A 1J7RA 1NCZA 3S0DA 5KU1A 1CLBA 1JF0A 3AAJA 3OBVA 1KFUS 1RROA 1SW8A 2O60A 1QVIZ 2MLEC 4MZKA 2QEBA 2L4HA 1BLQA 4MVFA 2ZRTA 4PHKA 1L2OC 1S5GY 2JT3A 2RGIA 2CCMA 2WCHA 3AKBA 3O4XA 4HSZA 2BAPA 2M9GA 4FQOA 4PDZA 1LXFC 4WQ2A 1IKUA 2KAYA 1UHJA 1NPQA 2LANA 2VRGA 3RZSA 3R1PA 1FW4A 4USLA 1OE9B 4WQ3A 4M2QA 1NUBA 2D8NA 1GM0A 2KI6C 4N5XA 2F2PA 1BMOA 4OZDA 4R1EA 1IH0A 1YUTA 3FWCA 1TNQA 4M2PA 3OB2B 1EG4A 1OOJA 1JBAA 1XK4C 5I8NA 2NCPA 1QLSA 1VRKA 5DKNA 1QV0A 1JUOA 1WY9A 2KI6D 2KQYA 4A4CA 1YVHA 3EKJA 3CGAA 1DELA 4PHMA 2EHBA 2PYQA 1AK8A 1J1EA 1K95A 4C0LA 1CFPA 5HKYA 4MZLA 3WHUB 2CT9A 1DF0B 1K8UA 1YUUA 4ZCUA 4HREE 2K60A 3IVTA 3NSKA 2ERBA 1K2HA 1OMVA 5JJGA 1JWDA 3F45A 4P2YB 2LVVA 1JFKA 4OVNF 3S0GA 1BR1B 3S0BA 2HQ8A 2SASA 2FJYA 5KSZA 1BT6A 3PN7B 1W9ZA 1GJYA 1PRWA 2L51A 2PRUA 3CZ0A 3L4LA 2BECA 3SJSA 4DCKA 3B87A
chains in the Genus database with same CATH topology
2KBMA 4F0ZB 2P6BB 4CPVA 2M3WA 3TUYB 4A4BA 3SG7A 1F4OA 5KTYA 2QPTA 1J55A 1MR8A 2WNDA 1S3PA 1BODA 3DF0A 3HX4A 3I5GB 1QX5B 2A4JA 4JQ0D 1IGVA 2K8MB 1QLKA 4YGEB 1CFDA 1PSBA 1TTXA 4YGBB 4CFQA 2M0RA 4GGNA 1ALVA 2V53A 4DUQA 4TNCA 4YBHB 1K9UA 1SMGA 4DIRA 1JF2A 1KK8B 3BOWB 1DVIA 4HRHA 1IG5A 1QX7A 2IS9A 4GPLB 4BY4A 1S6CA 1BF5A 1X02A 4AQJA 2O5GA 1IRJA 1DJHA 3PSRA 3ZWHA 2ZNEA 1FI5A 1OQPA 5BPJA 1YRUB 2H2KA 1XK4A 1KWOC 2Y1MA 1UUSA 2EC6C 2F8PA 2ZN9A 1KQMB 1MF8B 2JC2A 3I5FC 3OP0A 5IBWA 1HQVA 2WOSA 2LHLA 1GGZA 1YUSA 1CDMA 3IF7A 1B8RA 1UHNA 3GK1A 2MJWB 4GFTA 2JNFA 1CDNA 4MRYA 1CNPA 4CLNA 5AFPA 1C07A 3I5IB 4C0KA 2GGZA 1B8CA 1FBVA 1UP5A 4QJ5B 2LLUA 5HLOA 1LKJA 3WHTB 2F3ZA 1E8AA 1S6IA 4OR9B 2AMIA 1RWYA 4N1GA 1SNLA 3CLNA 2EGDA 1Q80A 3I5HC 1DMOA 2K2AA 2LLSA 5HLVA 1QVIY 1WLZA 1QIWA 1SR6C 2LHIA 3BXKA 4MZJA 5I2OA 4MBEA 4CFRA 3SIAA 2E30A 1OZOA 2G2BA 1PVBA 1XFXO 1KK7Z 2K2FA 2KFHA 5CPVA 2PSRA 1QATA 1SCMC 1MXLC 1M63B 3KF9A 3JVTC 1KFUL 2NXQA 1ZUZA 2DOQA 3PFVA 3RLZA 1B9AA 2ZNDA 2BKHB 2LC5A 2GV5A 2Q91A 1A29A 3LK1A 2M8UA 2LVJA 4NDDA 2WCFA 1NCYA 2JT0A 1NIWA 1YURA 4OKHA 2LVIA 1IQ3A 4HRGA 1M45A 2ZKMX 1TCOB 3D10A 4PE7A 1AVSA 1AUIB 2LMTA 2FCDA 1RECA 3NSLA 1AHRA 3QRXA 3MSEB 2BBNA 1PK0D 3CR5X 2WC8A 3WNXB 2MA2A 2KHNA 2LLTA 2H61C 2JXLA 1PVAA 2OTGB 1SY9A 3NXAA 1IQ5A 1A4PA 1N65A 2JTZA 1RK9A 1U5IA 2BE4A 2JT8A 5AERA 1QX2A 3HCMA 3PN7C 1WDCC 1AP4A 4FTGA 2KAXA 1YR5A 4P5OE 2LVKA 2MRDA 1OMDA 1L2OB 1A75A 2LE9B 1QJTA 1AJ4A 3DF0B 3NSOA 2K61A 5D69A 2BCBA 1M39A 4GBAA 1IJ5A 2L50A 1Y0VH 1KCYA 2Y1NA 2KYFA 2LMUA 3GK4X 2F3YA 5F6TA 4I5KA 1XFUO 1OMRA 2LP3A 1S6JA 5I2QA 2KOTA 4PHNA 3OX5A 1UURA 1TOPA 2MHHA 5CSIA 1Y1XA 1J1DA 1KK8C 1B8LA 1F4QA 1UHIA 2FCEA 3O6BA 2AAOA 1DJZA 1NX2A 1TNXA 2M49B 1YTZC 1B4CA 3TS5C 4I5JA 1RJVA 4MLWA 1B1GA 1JFJA 2LCPA 3FWBA 2JQ6A 4YGAA 1DJYA 1SL9A 1M46A 1IJ6A 2PMYA 1XO5A 1TN4A 1N0YA 1CFCA 4MN0A 2I18A 1KQMC 5TNCA 1RFJA 2KYCA 1CMGA 1RTP1 3IQQA 3JTDC 1NX1A 2BCXA 3K21A 4GGFC 1DJIA 2LAPA 1AJ5A 1K9KA 1LA0A 2E6WA 3IQOA 3O78A 4ORCB 2L5XB 4AQIA 1K9PA 3EK7A 2HQWA 3LCPC 4NDCA 1XVJA 1LA3A 2KI4C 2L4IA 1MWNA 2H61A 2M1KB 1EG3A 1XFZO 4PALA 1F54A 3EKHA 3GK2A 1B7TZ 2GGMA 3H4SE 3WXAA 1SL8A 2AUCA 2JRFA 2JXCA 2KQ6A 2SCPA 1EH2A 2CBLA 1CLLA 4YGCB 2NCOA 4OV2A 3D0YA 1ALWA 1PULA 1CFFA 5G08A 4YRUA 3DD4A 1DJGA 1TNWA 3VRNA 1KK7Y 1F71A 1A2XA 2JWWA 2COLB 2M1UA 2PASA 1BJFA 3M0WA 2CXJA 2OPOA 2L0PA 1OSAA 2I2RE 2KGRA 1JSAA 3CTNA 3KPXA 4PE0A 1KFXL 4U8DA 3CWGA 3VGOA 1ZFSA 1C7VA 2HPSA 5DKRA 1ODBA 3FIAA 2LUCA 1G8IA 1Y6WA 2K7CA 3SG6A 3OB1B 4JPZB 4CIDA 5ER5A 2JNXA 1KWOB 4ETOA 1NWDA 2FJUB 1G4YR 3BUNB 4ICBA 1H8BA 2EC6B 1S1EA 3I5FB 1JC2A 2Y4QA 1IWQA 1XYDA 4PE4A 2KSPA 4Q04A 3EVUA 3NSIA 1EJ3A 3TDIA 2Q4UA 4IL1A 4L9MA 3OHMB 4I5NB 1N2DA 4GGFA 1BG1A 3CZTX 2OS8B 5B8IB 1WRZA 1BR4B 5HKWA 4AOMA 5DKQA 2KFGA 3ICBA 1UHHA 2BL0B 2NLNA 3CR2A 4ORBB 3O2PA 4C0JA 1FF1A 1J7OA 2M29A 1C7WA 4WRIA 2NZ0A 1PSRA 3I5HB 1U5IB 3VRQA 1ZACA 4ORAB 1CKKA 5I2LA 3VRRA 1BU3A 1QASA 1QS7A 5HKZA 5AANA 1MXEA 3SG4A 3DVMA 4NDBA 5CSNA 1V1GA 2LNKA 3EK4A 1A75B 3EK8A 1DTLA 1YX7A 5GQQC 1CM4A 1D1OA 1WRLA 1CTRA 3SG3A 4MRXA 3LLEA 5AXIA 5FYXA 2L2EA 4YI8A 1SCMB 3O4YA 1NCXA 1TNPA 2I94A 2K7OA 5CSFA 1SPYA 1K96A 3JVTB 4XJKA 3DVJA 1J7QA 2LUXA 2M7NA 1SRAA 2KDHA 3KO0A 2ZRSA 2LV7A 1NYAA 3ZNIA 4UPGA 3PLFB 1UHKA 4GAOA 2M7LA 4BY5A 1F55A 1GQMA 2Y5IA 2CTNA 3BYAA 4MEWA 5K89A 1SL7A 3TUYC 2B1UA 3OX6A 4DS7A 1S5GZ 1W7JB 1SBJA 5AEQA 1ZOTB 3I5GC 1FPWA 1TCFA 2KFFA 1KSOA 3LK0A 4GUKA 1R6PA 2JOJA 1XFWO 1SYMA 4QJ4B 1CMFA 2FOTA 2WCEA 1MQ1A 4OCIA 1DGVA 1QIVA 2WORA 3A8RA 3KEVA 2KAVA 1DGUA 2KGBC 2ZFDA 2R2IA 5HYDA 3VRPA 3BUOB 1MHOA 1DJXA 3TDZA 4QJ3B 4D1EA 1B7TY 3DVKA 1S26D 3PM8A 4N1FA 1MUXA 3C1VA 2MLFC 1LVCD 1QV1A 1NSHA 1CDPA 2CNPA 1A03A 1WDCB 3KHEA 2BKIB 4ZCVA 1B47A 5J3XA 3SG2A 2JULA 1CB1A 3BUWB 5CSJA 3D0YB 4JWQA 1KSMA 3AAKA 1DF0A 1K90D 1F8HA 3DVEA 1H4BA 3TZ1A 1XA5A 1YX8A 1TRFA 3I5IC 1KQVA 3CS1A 3E3RA 4I5LB 3RM1A 1J7PA 2BCAA 1DJWA 2LM5A 2QACA 1LINA 5ER4X 4PCWA 1BOCA 4XYNA 2TN4A 1HT9A 3CR4X 4YGDB 2KNEA 2BE6A 2ISDA 1CLMA 1R2UA 1CM1A 2JZIA 2K0JA 4PHJA 1CDLA 1K94A 2MAZA 1FI6A 3TS5B 1Y1UA 2I7AA 1YRTB 1WRKA 2BBMA 1Y1AA 2JPTA 1EL4A 3BQ3A 2PVBA 3FS7A 4NQGA 1M31A 1S36A 3JTDB 3LL8B 1EXRA 1NX3A 1SKTA 1V1FA 4PE1A 1TIZA 1W7IB 1UWOA 2JTTA 3BOWA 1QTXA 1F70A 5PALA 2F2OA 2L98A 2KI4B 2M97A 2KBIA 1YVLA 2K7BA 2OS8C 2MBXA 1QXPA 2K7DA 1SK6D 2ZN8A 5D7FA 1L7ZA 2BL0C 1GGWA 2F33A 3SIBA 1ZMZA 3BUMB 2G9BA 1NX0A 4MSPA 3A4UB 1G33A 3PALA 3VROA 4E68A 1KFXS 4DRWA 3GOFA 1SCVA 3SG5A 2PALA 3BUXB 4GNKB 1DT7B 2JU0A 3PATA 1PALA 4YI9A 3EVRA 5JOLA 1K93D 2WCBA 3EVVA 2HETA 2LMVA 1WLMA 2HF5A 3AKAA 1XFYO 1NP8A 1SR6B 2LP2A 1XFVO 1OZSA 4XJKB 2OTGC 3TDUA 1CLBA 4M2OA 1J7RA 1NCZA 5KU1A 1JF0A 3AAJA 1KFUS 1RROA 1SW8A 2O60A 1QVIZ 2MLEC 4MZKA 2L4HA 1BLQA 4MVFA 2ZRTA 4PHKA 1L2OC 1S5GY 2JT3A 2RGIA 2CCMA 3AKBA 4HSZA 2M9GA 4FQOA 4PDZA 1LXFC 4WQ2A 1IKUA 2KAYA 1UHJA 1NPQA 2LANA 2VRGA 1FW4A 4USLA 1OE9B 4WQ3A 4M2QA 1NUBA 2D8NA 2KI6C 4N5XA 2F2PA 1BMOA 4R1EA 1IH0A 1YUTA 3FWCA 1TNQA 4M2PA 3OB2B 1EG4A 1OOJA 1JBAA 1XK4C 5I8NA 2NCPA 1QLSA 1VRKA 5DKNA 1QV0A 1JUOA 1WY9A 2KI6D 2KQYA 4A4CA 1YVHA 3EKJA 3CGAA 4PHMA 2EHBA 1AK8A 1J1EA 1K95A 4C0LA 1CFPA 5HKYA 4MZLA 3WHUB 2CT9A 1DF0B 1K8UA 1YUUA 4ZCUA 4HREE 3NSKA 1K2HA 1OMVA 5JJGA 1JWDA 3F45A 4P2YB 2LVVA 1JFKA 4OVNF 1BR1B 2HQ8A 2SASA 5KSZA 1BT6A 3PN7B 2PRUA 1GJYA 1PRWA 2L51A 2BECA 3SJSA 4DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBM A;  4F0Z B;  2P6B B;  4CPV A;  2M3W A;  3TUY B;  4A4B A;  3SG7 A;  1F4O A;  5KTY A;  2QPT A;  1J55 A;  1MR8 A;  2WND A;  1S3P A;  1BOD A;  3DF0 A;  3HX4 A;  3I5G B;  1QX5 B;  2A4J A;  4JQ0 D;  1IGV A;  2K8M B;  1QLK A;  4YGE B;  1CFD A;  1PSB A;  1TTX A;  4YGB B;  4CFQ A;  2M0R A;  4GGN A;  1ALV A;  2V53 A;  4DUQ A;  4TNC A;  4YBH B;  1K9U A;  1SMG A;  4DIR A;  1JF2 A;  1KK8 B;  3BOW B;  1DVI A;  4HRH A;  1IG5 A;  1QX7 A;  2IS9 A;  4GPL B;  4BY4 A;  1S6C A;  1BF5 A;  1X02 A;  4AQJ A;  2O5G A;  1IRJ A;  1DJH A;  3PSR A;  3ZWH A;  2ZNE A;  1FI5 A;  1OQP A;  5BPJ A;  1YRU B;  2H2K A;  1XK4 A;  1KWO C;  2Y1M A;  1UUS A;  2EC6 C;  2F8P A;  2ZN9 A;  1KQM B;  1MF8 B;  2JC2 A;  3I5F C;  3OP0 A;  5IBW A;  1HQV A;  2WOS A;  2LHL A;  1GGZ A;  1YUS A;  1CDM A;  3IF7 A;  1B8R A;  1UHN A;  3GK1 A;  2MJW B;  4GFT A;  2JNF A;  1CDN A;  4MRY A;  1CNP A;  4CLN A;  5AFP A;  1C07 A;  3I5I B;  4C0K A;  2GGZ A;  1B8C A;  1FBV A;  1UP5 A;  4QJ5 B;  2LLU A;  5HLO A;  1LKJ A;  3WHT B;  2F3Z A;  1E8A A;  1S6I A;  4OR9 B;  2AMI A;  1RWY A;  4N1G A;  1SNL A;  3CLN A;  2EGD A;  1Q80 A;  3I5H C;  1DMO A;  2K2A A;  2LLS A;  5HLV A;  1QVI Y;  1WLZ A;  1QIW A;  1SR6 C;  2LHI A;  3BXK A;  4MZJ A;  5I2O A;  4MBE A;  4CFR A;  3SIA A;  2E30 A;  1OZO A;  2G2B A;  1PVB A;  1XFX O;  1KK7 Z;  2K2F A;  2KFH A;  5CPV A;  2PSR A;  1QAT A;  1SCM C;  1MXL C;  1M63 B;  3KF9 A;  3JVT C;  1KFU L;  2NXQ A;  1ZUZ A;  2DOQ A;  3PFV A;  3RLZ A;  1B9A A;  2ZND A;  2BKH B;  2LC5 A;  2GV5 A;  2Q91 A;  1A29 A;  3LK1 A;  2M8U A;  2LVJ A;  4NDD A;  2WCF A;  1NCY A;  2JT0 A;  1NIW A;  1YUR A;  4OKH A;  2LVI A;  1IQ3 A;  4HRG A;  1M45 A;  2ZKM X;  1TCO B;  3D10 A;  4PE7 A;  1AVS A;  1AUI B;  2LMT A;  2FCD A;  1REC A;  3NSL A;  1AHR A;  3QRX A;  3MSE B;  2BBN A;  1PK0 D;  3CR5 X;  2WC8 A;  3WNX B;  2MA2 A;  2KHN A;  2LLT A;  2H61 C;  2JXL A;  1PVA A;  2OTG B;  1SY9 A;  3NXA A;  1IQ5 A;  1A4P A;  1N65 A;  2JTZ A;  1RK9 A;  1U5I A;  2BE4 A;  2JT8 A;  5AER A;  1QX2 A;  3HCM A;  3PN7 C;  1WDC C;  1AP4 A;  4FTG A;  2KAX A;  1YR5 A;  4P5O E;  2LVK A;  2MRD A;  1OMD A;  1L2O B;  1A75 A;  2LE9 B;  1QJT A;  1AJ4 A;  3DF0 B;  3NSO A;  2K61 A;  5D69 A;  2BCB A;  1M39 A;  4GBA A;  1IJ5 A;  2L50 A;  1Y0V H;  1KCY A;  2Y1N A;  2KYF A;  2LMU A;  3GK4 X;  2F3Y A;  5F6T A;  4I5K A;  1XFU O;  1OMR A;  2LP3 A;  1S6J A;  5I2Q A;  2KOT A;  4PHN A;  3OX5 A;  1UUR A;  1TOP A;  2MHH A;  5CSI A;  1Y1X A;  1J1D A;  1KK8 C;  1B8L A;  1F4Q A;  1UHI A;  2FCE A;  3O6B A;  2AAO A;  1DJZ A;  1NX2 A;  1TNX A;  2M49 B;  1YTZ C;  1B4C A;  3TS5 C;  4I5J A;  1RJV A;  4MLW A;  1B1G A;  1JFJ A;  2LCP A;  3FWB A;  2JQ6 A;  4YGA A;  1DJY A;  1SL9 A;  1M46 A;  1IJ6 A;  2PMY A;  1XO5 A;  1TN4 A;  1N0Y A;  1CFC A;  4MN0 A;  2I18 A;  1KQM C;  5TNC A;  1RFJ A;  2KYC A;  1CMG A;  1RTP 1;  3IQQ A;  3JTD C;  1NX1 A;  2BCX A;  3K21 A;  4GGF C;  1DJI A;  2LAP A;  1AJ5 A;  1K9K A;  1LA0 A;  2E6W A;  3IQO A;  3O78 A;  4ORC B;  2L5X B;  4AQI A;  1K9P A;  3EK7 A;  2HQW A;  3LCP C;  4NDC A;  1XVJ A;  1LA3 A;  2KI4 C;  2L4I A;  1MWN A;  2H61 A;  2M1K B;  1EG3 A;  1XFZ O;  4PAL A;  1F54 A;  3EKH A;  3GK2 A;  1B7T Z;  2GGM A;  3H4S E;  3WXA A;  1SL8 A;  2AUC A;  2JRF A;  2JXC A;  2KQ6 A;  2SCP A;  1EH2 A;  2CBL A;  1CLL A;  4YGC B;  2NCO A;  4OV2 A;  3D0Y A;  1ALW A;  1PUL A;  1CFF A;  5G08 A;  4YRU A;  3DD4 A;  1DJG A;  1TNW A;  3VRN A;  1KK7 Y;  1F71 A;  1A2X A;  2JWW A;  2COL B;  2M1U A;  2PAS A;  1BJF A;  3M0W A;  2CXJ A;  2OPO A;  2L0P A;  1OSA A;  2I2R E;  2KGR A;  1JSA A;  3CTN A;  3KPX A;  4PE0 A;  1KFX L;  4U8D A;  3CWG A;  3VGO A;  1ZFS A;  1C7V A;  2HPS A;  5DKR A;  1ODB A;  3FIA A;  2LUC A;  1G8I A;  1Y6W A;  2K7C A;  3SG6 A;  3OB1 B;  4JPZ B;  4CID A;  5ER5 A;  2JNX A;  1KWO B;  4ETO A;  1NWD A;  2FJU B;  1G4Y R;  3BUN B;  4ICB A;  1H8B A;  2EC6 B;  1S1E A;  3I5F B;  1JC2 A;  2Y4Q A;  1IWQ A;  1XYD A;  4PE4 A;  2KSP A;  4Q04 A;  3EVU A;  3NSI A;  1EJ3 A;  3TDI A;  2Q4U A;  4IL1 A;  4L9M A;  3OHM B;  4I5N B;  1N2D A;  4GGF A;  1BG1 A;  3CZT X;  2OS8 B;  5B8I B;  1WRZ A;  1BR4 B;  5HKW A;  4AOM A;  5DKQ A;  2KFG A;  3ICB A;  1UHH A;  2BL0 B;  2NLN A;  3CR2 A;  4ORB B;  3O2P A;  4C0J A;  1FF1 A;  1J7O A;  2M29 A;  1C7W A;  4WRI A;  2NZ0 A;  1PSR A;  3I5H B;  1U5I B;  3VRQ A;  1ZAC A;  4ORA B;  1CKK A;  5I2L A;  3VRR A;  1BU3 A;  1QAS A;  1QS7 A;  5HKZ A;  5AAN A;  1MXE A;  3SG4 A;  3DVM A;  4NDB A;  5CSN A;  1V1G A;  2LNK A;  3EK4 A;  1A75 B;  3EK8 A;  1DTL A;  1YX7 A;  5GQQ C;  1CM4 A;  1D1O A;  1WRL A;  1CTR A;  3SG3 A;  4MRX A;  3LLE A;  5AXI A;  5FYX A;  2L2E A;  4YI8 A;  1SCM B;  3O4Y A;  1NCX A;  1TNP A;  2I94 A;  2K7O A;  5CSF A;  1SPY A;  1K96 A;  3JVT B;  4XJK A;  3DVJ A;  1J7Q A;  2LUX A;  2M7N A;  1SRA A;  2KDH A;  3KO0 A;  2ZRS A;  2LV7 A;  1NYA A;  3ZNI A;  4UPG A;  3PLF B;  1UHK A;  4GAO A;  2M7L A;  4BY5 A;  1F55 A;  1GQM A;  2Y5I A;  2CTN A;  3BYA A;  4MEW A;  5K89 A;  1SL7 A;  3TUY C;  2B1U A;  3OX6 A;  4DS7 A;  1S5G Z;  1W7J B;  1SBJ A;  5AEQ A;  1ZOT B;  3I5G C;  1FPW A;  1TCF A;  2KFF A;  1KSO A;  3LK0 A;  4GUK A;  1R6P A;  2JOJ A;  1XFW O;  1SYM A;  4QJ4 B;  1CMF A;  2FOT A;  2WCE A;  1MQ1 A;  4OCI A;  1DGV A;  1QIV A;  2WOR A;  3A8R A;  3KEV A;  2KAV A;  1DGU A;  2KGB C;  2ZFD A;  2R2I A;  5HYD A;  3VRP A;  3BUO B;  1MHO A;  1DJX A;  3TDZ A;  4QJ3 B;  4D1E A;  1B7T Y;  3DVK A;  1S26 D;  3PM8 A;  4N1F A;  1MUX A;  3C1V A;  2MLF C;  1LVC D;  1QV1 A;  1NSH A;  1CDP A;  2CNP A;  1A03 A;  1WDC B;  3KHE A;  2BKI B;  4ZCV A;  1B47 A;  5J3X A;  3SG2 A;  2JUL A;  1CB1 A;  3BUW B;  5CSJ A;  3D0Y B;  4JWQ A;  1KSM A;  3AAK A;  1DF0 A;  1K90 D;  1F8H A;  3DVE A;  1H4B A;  3TZ1 A;  1XA5 A;  1YX8 A;  1TRF A;  3I5I C;  1KQV A;  3CS1 A;  3E3R A;  4I5L B;  3RM1 A;  1J7P A;  2BCA A;  1DJW A;  2LM5 A;  2QAC A;  1LIN A;  5ER4 X;  4PCW A;  1BOC A;  4XYN A;  2TN4 A;  1HT9 A;  3CR4 X;  4YGD B;  2KNE A;  2BE6 A;  2ISD A;  1CLM A;  1R2U A;  1CM1 A;  2JZI A;  2K0J A;  4PHJ A;  1CDL A;  1K94 A;  2MAZ A;  1FI6 A;  3TS5 B;  1Y1U A;  2I7A A;  1YRT B;  1WRK A;  2BBM A;  1Y1A A;  2JPT A;  1EL4 A;  3BQ3 A;  2PVB A;  3FS7 A;  4NQG A;  1M31 A;  1S36 A;  3JTD B;  3LL8 B;  1EXR A;  1NX3 A;  1SKT A;  1V1F A;  4PE1 A;  1TIZ A;  1W7I B;  1UWO A;  2JTT A;  3BOW A;  1QTX A;  1F70 A;  5PAL A;  2F2O A;  2L98 A;  2KI4 B;  2M97 A;  2KBI A;  1YVL A;  2K7B A;  2OS8 C;  2MBX A;  1QXP A;  2K7D A;  1SK6 D;  2ZN8 A;  5D7F A;  1L7Z A;  2BL0 C;  1GGW A;  2F33 A;  3SIB A;  1ZMZ A;  3BUM B;  2G9B A;  1NX0 A;  4MSP A;  3A4U B;  1G33 A;  3PAL A;  3VRO A;  4E68 A;  1KFX S;  4DRW A;  3GOF A;  1SCV A;  3SG5 A;  2PAL A;  3BUX B;  4GNK B;  1DT7 B;  2JU0 A;  3PAT A;  1PAL A;  4YI9 A;  3EVR A;  5JOL A;  1K93 D;  2WCB A;  3EVV A;  2HET A;  2LMV A;  1WLM A;  2HF5 A;  3AKA A;  1XFY O;  1NP8 A;  1SR6 B;  2LP2 A;  1XFV O;  1OZS A;  4XJK B;  2OTG C;  3TDU A;  1CLB A;  4M2O A;  1J7R A;  1NCZ A;  5KU1 A;  1JF0 A;  3AAJ A;  1KFU S;  1RRO A;  1SW8 A;  2O60 A;  1QVI Z;  2MLE C;  4MZK A;  2L4H A;  1BLQ A;  4MVF A;  2ZRT A;  4PHK A;  1L2O C;  1S5G Y;  2JT3 A;  2RGI A;  2CCM A;  3AKB A;  4HSZ A;  2M9G A;  4FQO A;  4PDZ A;  1LXF C;  4WQ2 A;  1IKU A;  2KAY A;  1UHJ A;  1NPQ A;  2LAN A;  2VRG A;  1FW4 A;  4USL A;  1OE9 B;  4WQ3 A;  4M2Q A;  1NUB A;  2D8N A;  2KI6 C;  4N5X A;  2F2P A;  1BMO A;  4R1E A;  1IH0 A;  1YUT A;  3FWC A;  1TNQ A;  4M2P A;  3OB2 B;  1EG4 A;  1OOJ A;  1JBA A;  1XK4 C;  5I8N A;  2NCP A;  1QLS A;  1VRK A;  5DKN A;  1QV0 A;  1JUO A;  1WY9 A;  2KI6 D;  2KQY A;  4A4C A;  1YVH A;  3EKJ A;  3CGA A;  4PHM A;  2EHB A;  1AK8 A;  1J1E A;  1K95 A;  4C0L A;  1CFP A;  5HKY A;  4MZL A;  3WHU B;  2CT9 A;  1DF0 B;  1K8U A;  1YUU A;  4ZCU A;  4HRE E;  3NSK A;  1K2H A;  1OMV A;  5JJG A;  1JWD A;  3F45 A;  4P2Y B;  2LVV A;  1JFK A;  4OVN F;  1BR1 B;  2HQ8 A;  2SAS A;  5KSZ A;  1BT6 A;  3PN7 B;  2PRU A;  1GJY A;  1PRW A;  2L51 A;  2BEC A;  3SJS A;  4DCK A; 
#chains in the Genus database with same CATH topology
 2KBM A;  4F0Z B;  2P6B B;  4CPV A;  2M3W A;  3TUY B;  4A4B A;  3SG7 A;  1F4O A;  5KTY A;  2QPT A;  1J55 A;  1MR8 A;  2WND A;  1S3P A;  1BOD A;  3DF0 A;  3HX4 A;  3I5G B;  1QX5 B;  2A4J A;  4JQ0 D;  1IGV A;  2K8M B;  1QLK A;  4YGE B;  1CFD A;  1PSB A;  1TTX A;  2QEO A;  4YGB B;  4CFQ A;  2M0R A;  2P71 A;  1ALV A;  2V53 A;  4GGN A;  4DUQ A;  4TNC A;  4YBH B;  1K9U A;  1SMG A;  3QME A;  4DIR A;  1JF2 A;  3S0A A;  1KK8 B;  3BOW B;  1DVI A;  4HRH A;  1IG5 A;  1QX7 A;  2IS9 A;  4GPL B;  4BY4 A;  1S6C A;  1BF5 A;  1X02 A;  4AQJ A;  2O5G A;  1IRJ A;  1DJH A;  3PSR A;  3S0F A;  3ZWH A;  2ZNE A;  1FI5 A;  1OQP A;  5D3O A;  5BPJ A;  1YRU B;  2H2K A;  1OOI X;  1XK4 A;  1KWO C;  2Y1M A;  1UUS A;  2EC6 C;  2F8P A;  2ZN9 A;  1KQM B;  1MF8 B;  2JC2 A;  3I5F C;  3OP0 A;  5IBW A;  1HQV A;  2WOS A;  2LHL A;  1GGZ A;  1YUS A;  1CDM A;  3IF7 A;  3R72 A;  1B8R A;  1UHN A;  3GK1 A;  2MJW B;  4GFT A;  2JNF A;  1CDN A;  3D73 A;  4MRY A;  1CNP A;  4CLN A;  5AFP A;  1C07 A;  3I5I B;  4C0K A;  1LS8 A;  3B7A A;  2GGZ A;  1B8C A;  1FBV A;  1UP5 A;  4QJ5 B;  2LLU A;  5HLO A;  1LKJ A;  3WHT B;  2F3Z A;  1E8A A;  1S6I A;  4OR9 B;  2AMI A;  1RWY A;  4N1G A;  1SNL A;  3CLN A;  2EGD A;  1Q80 A;  3I5H C;  3CZ1 A;  1DMO A;  2K2A A;  2LLS A;  5HLV A;  1QVI Y;  1WLZ A;  4JD9 A;  1QIW A;  1SR6 C;  2LHI A;  3BXK A;  3UNW A;  4MZJ A;  3V2L A;  5I2O A;  4MBE A;  4CFR A;  1TWO A;  1Z2C B;  3SIA A;  2E30 A;  1C3Z A;  1OZO A;  2G2B A;  1PVB A;  1XFX O;  1KK7 Z;  2KPH A;  2K2F A;  2KFH A;  5CPV A;  2PSR A;  1QAT A;  1SCM C;  1TUZ A;  1MXL C;  1M63 B;  1Z4H A;  3KF9 A;  3JVT C;  1KFU L;  2NXQ A;  1ZUZ A;  2DOQ A;  2QDI A;  3PFV A;  3FE6 A;  3RLZ A;  1B9A A;  2ZND A;  2BKH B;  2LC5 A;  2GV5 A;  5EL2 A;  2Q91 A;  1A29 A;  3LK1 A;  1OW4 A;  2M8U A;  3SS3 A;  2LVJ A;  4NDD A;  2WCF A;  1NCY A;  2JT0 A;  1NIW A;  1YUR A;  4OKH A;  3BFA A;  2LVI A;  1IQ3 A;  4HRG A;  1M45 A;  2ZKM X;  1TCO B;  4KYN A;  3D10 A;  4PE7 A;  1AVS A;  1AUI B;  2LMT A;  2FCD A;  1REC A;  3NSL A;  1AHR A;  3QRX A;  3MSE B;  3L47 A;  4FQT A;  1C3Y A;  2BBN A;  1PK0 D;  2WCM A;  3CR5 X;  2WC8 A;  3WNX B;  2MA2 A;  2KHN A;  2LLT A;  2H61 C;  2JXL A;  1PVA A;  2OTG B;  1SY9 A;  3NXA A;  1IQ5 A;  1A4P A;  1N65 A;  2JTZ A;  1RK9 A;  1U5I A;  2BE4 A;  3D74 A;  2JT8 A;  5AER A;  1QX2 A;  3HCM A;  3SS5 A;  3PN7 C;  1WDC C;  1AP4 A;  4FTG A;  2KAX A;  1YR5 A;  4P5O E;  2LVK A;  2MRD A;  1OMD A;  1L2O B;  1A75 A;  2LE9 B;  1QJT A;  1AJ4 A;  3DF0 B;  3NHT A;  3L4A A;  3NSO A;  2K61 A;  2P70 A;  5D69 A;  3DZT A;  2BCB A;  1M39 A;  2KLD A;  4GBA A;  1IJ5 A;  2L50 A;  1Y0V H;  1KCY A;  2Y1N A;  2KYF A;  2LMU A;  3GK4 X;  2F3Y A;  5FI6 A;  5F6T A;  4I5K A;  1XFU O;  1OMR A;  2LP3 A;  1S6J A;  5I2Q A;  2KOT A;  4PHN A;  3OX5 A;  1UUR A;  1TOP A;  2MHH A;  5CSI A;  1Y1X A;  1J1D A;  1B8L A;  1KK8 C;  1F4Q A;  1UHI A;  2FCE A;  3O6B A;  2AAO A;  3BFB A;  1DJZ A;  3SS4 A;  1NX2 A;  1TNX A;  2M49 B;  1YTZ C;  1B4C A;  3TS5 C;  4I5J A;  1RJV A;  4MLW A;  1B1G A;  1XFR A;  1JFJ A;  2LCP A;  3FWB A;  2JQ6 A;  4YGA A;  1DJY A;  1SL9 A;  2PQL A;  3BFH A;  1M46 A;  1IJ6 A;  2PMY A;  1XO5 A;  1TN4 A;  1N0Y A;  1CFC A;  4MN0 A;  2I18 A;  1KQM C;  5TNC A;  1RFJ A;  2KYC A;  1CMG A;  1RTP 1;  3IQQ A;  3JTD C;  1NX1 A;  2BCX A;  3K21 A;  3R1O A;  4GGF C;  1DJI A;  2LAP A;  3S0E A;  1AJ5 A;  1K9K A;  1LA0 A;  2E6W A;  3IQO A;  3O78 A;  4ORC B;  2L5X B;  4AQI A;  1K9P A;  3EK7 A;  2HQW A;  3LCP C;  4NDC A;  1XVJ A;  1LA3 A;  2KI4 C;  2L4I A;  1MWN A;  2H61 A;  2M1K B;  1EG3 A;  1XFZ O;  4PAL A;  1F54 A;  2KLE A;  1OOH A;  3EKH A;  3GK2 A;  1B7T Z;  2GGM A;  3FE8 A;  3H4S E;  3WXA A;  1SL8 A;  2AUC A;  2JRF A;  2JXC A;  2KQ6 A;  2SCP A;  1EH2 A;  2CBL A;  1CLL A;  4YGC B;  2NCO A;  2WC5 A;  4OV2 A;  3D0Y A;  1ALW A;  1PUL A;  1IIO A;  1CFF A;  5G08 A;  4YRU A;  3DD4 A;  1DJG A;  1TNW A;  3VRN A;  1KK7 Y;  1F71 A;  1A2X A;  3DY9 A;  2JWW A;  2COL B;  4F7F A;  2M1U A;  2PAS A;  1BJF A;  3EG5 B;  3M0W A;  2CXJ A;  3CDN A;  2OPO A;  2L0P A;  3Q8I A;  1OSA A;  2I2R E;  2KGR A;  1JSA A;  3CTN A;  3KPX A;  4PE0 A;  1KFX L;  3CYZ A;  4U8D A;  2JPO A;  3CWG A;  3VGO A;  1ZFS A;  1C7V A;  1SSE B;  2HPS A;  5DKR A;  1ODB A;  3FIA A;  2LUC A;  1G8I A;  1Y6W A;  2K7C A;  3SG6 A;  3OB1 B;  4JPZ B;  4CID A;  5ER5 A;  2JNX A;  1KWO B;  4ETO A;  1NWD A;  2FJU B;  1G4Y R;  3BUN B;  1OOF A;  4ICB A;  3PJI A;  1H8B A;  2EC6 B;  1S1E A;  5FI7 A;  3I5F B;  2WCK A;  1JC2 A;  2Y4Q A;  1IWQ A;  1XYD A;  4PE4 A;  2KSP A;  4Q04 A;  3EVU A;  3NSI A;  1QWV A;  1EJ3 A;  3TDI A;  2Q4U A;  4IL1 A;  4L9M A;  3OHM B;  3D76 A;  4I5N B;  1N2D A;  4GGF A;  5I94 A;  1BG1 A;  3CZT X;  2OS8 B;  5B8I B;  1WRZ A;  1BR4 B;  5HKW A;  4AOM A;  5DKQ A;  2KFG A;  3ICB A;  1UHH A;  5HL1 A;  2BL0 B;  2NLN A;  3CR2 A;  2GTE A;  4ORB B;  3O2P A;  4C0J A;  1FF1 A;  1J7O A;  2M29 A;  1C7W A;  4WRI A;  2NZ0 A;  1PSR A;  3I5H B;  1U5I B;  3CAB A;  1ZAC A;  4ORA B;  3VRQ A;  5I2L A;  1CKK A;  3VRR A;  1BU3 A;  1QAS A;  1QS7 A;  5HKZ A;  5AAN A;  1MXE A;  3SG4 A;  2BNX A;  3DVM A;  4NDB A;  2WC6 A;  1V1G A;  2LNK A;  5CSN A;  3D75 A;  4INX A;  3EK4 A;  1A75 B;  3EK8 A;  1DTL A;  1YX7 A;  5GQQ C;  1CM4 A;  1D1O A;  1WRL A;  1CTR A;  3SG3 A;  4MRX A;  3LLE A;  5AXI A;  2WCL A;  5FYX A;  2L2E A;  4YI8 A;  1SCM B;  3O4Y A;  1NCX A;  1TNP A;  1OOG A;  2I94 A;  2K7O A;  2QEV A;  1SPY A;  5CSF A;  3UO9 A;  1DEK A;  1K96 A;  3JVT B;  3B86 A;  3DVJ A;  4XJK A;  2LUX A;  1J7Q A;  2M7N A;  1SRA A;  2KDH A;  3KO0 A;  2ZRS A;  2LV7 A;  1NYA A;  3ZNI A;  3NGV A;  4UPG A;  3PLF B;  1UHK A;  4GAO A;  2M7L A;  3N7H A;  4BY5 A;  1F55 A;  1GQM A;  2Y5I A;  2CTN A;  3BYA A;  4MEW A;  5K89 A;  1SL7 A;  3TUY C;  1P28 A;  2B1U A;  3OX6 A;  4DS7 A;  3D77 A;  1S5G Z;  1W7J B;  1SBJ A;  5AEQ A;  1ZOT B;  3I5G C;  1FPW A;  1TCF A;  2KFF A;  1KSO A;  3LK0 A;  4GUK A;  1R6P A;  2JOJ A;  1XFW O;  1SYM A;  4QJ4 B;  1CMF A;  2FOT A;  2WCE A;  1MQ1 A;  4OCI A;  1DGV A;  3PM2 A;  1QIV A;  2WOR A;  3A8R A;  3KEV A;  2KAV A;  1DGU A;  2KGB C;  2ZFD A;  2R2I A;  5HYD A;  3VRP A;  3BUO B;  1MHO A;  1DJX A;  4IJ7 A;  3TDZ A;  4QJ3 B;  4D1E A;  1B7T Y;  3DVK A;  1S26 D;  3PM8 A;  4N1F A;  1MUX A;  3C1V A;  2MLF C;  1LVC D;  1QV1 A;  1NSH A;  1CDP A;  3D78 A;  2CNP A;  1A03 A;  1WDC B;  3KHE A;  2BKI B;  4ZCV A;  1B47 A;  5J3X A;  3SG2 A;  2JUL A;  1CB1 A;  3BUW B;  5CSJ A;  3D0Y B;  4JWQ A;  1KSM A;  3AAK A;  1DF0 A;  1K90 D;  1F8H A;  3DVE A;  1H4B A;  3TZ1 A;  1XA5 A;  1YX8 A;  1TRF A;  3I5I C;  1KQV A;  3VB1 A;  4INW A;  3CS1 A;  3E3R A;  4I5L B;  3RM1 A;  1J7P A;  2BCA A;  1DJW A;  2LM5 A;  2QAC A;  1LIN A;  5ER4 X;  4PCW A;  1BOC A;  1DQE A;  4XYN A;  2TN4 A;  1HT9 A;  3CR4 X;  4YGD B;  1DC1 A;  2KNE A;  2BE6 A;  2ISD A;  1CLM A;  1R2U A;  3B88 A;  1CM1 A;  2JZI A;  2K0J A;  4PHJ A;  5DIC A;  5FI2 A;  1CDL A;  2L5Y A;  3BJH A;  2YGU A;  2L2C A;  1K94 A;  3K1E A;  2MAZ A;  1FI6 A;  3TS5 B;  1Y1U A;  2I7A A;  1YRT B;  1WRK A;  3FE9 A;  2BBM A;  1Y1A A;  2JPT A;  1EL4 A;  3BQ3 A;  2PVB A;  3FS7 A;  4NQG A;  1M31 A;  1S36 A;  3JTD B;  3LL8 B;  1EXR A;  1NX3 A;  1SKT A;  1V1F A;  4PE1 A;  3DXL A;  1TIZ A;  1W7I B;  1UWO A;  2JTT A;  3BOW A;  1QTX A;  1F70 A;  3NHI A;  5PAL A;  2F2O A;  2L98 A;  2WCJ A;  2KI4 B;  2M97 A;  2KBI A;  2H8V A;  1YVL A;  2K7B A;  2OS8 C;  2MBX A;  1QXP A;  2K7D A;  1SK6 D;  2ZN8 A;  5D7F A;  1L7Z A;  2BL0 C;  1GGW A;  2F33 A;  3SIB A;  1ZMZ A;  3BUM B;  3R1V A;  4JKT A;  2G9B A;  1NX0 A;  4MSP A;  3A4U B;  1G33 A;  3PAL A;  3VRO A;  4E68 A;  2QEH A;  1KFX S;  4DRW A;  3GOF A;  1SCV A;  3SG5 A;  2PAL A;  3BUX B;  4GNK B;  1DT7 B;  2JU0 A;  3DYE A;  3PAT A;  1PAL A;  4YI9 A;  3EVR A;  5JOL A;  1K93 D;  2WCB A;  3EVV A;  2HET A;  4PT1 A;  2LMV A;  3B6X A;  1WLM A;  2HF5 A;  3CZ2 A;  1ORG A;  3AKA A;  1XFY O;  1NP8 A;  1SR6 B;  1TUJ A;  1XFV O;  1OZS A;  2LP2 A;  2OTG C;  3OGN A;  4XJK B;  3TDU A;  4M2O A;  1T14 A;  1J7R A;  1NCZ A;  3S0D A;  5KU1 A;  1CLB A;  1JF0 A;  3AAJ A;  3OBV A;  1KFU S;  1RRO A;  1SW8 A;  2O60 A;  1QVI Z;  2MLE C;  4MZK A;  2QEB A;  2L4H A;  1BLQ A;  4MVF A;  2ZRT A;  4PHK A;  1L2O C;  1S5G Y;  2JT3 A;  2RGI A;  2CCM A;  2WCH A;  3AKB A;  3O4X A;  4HSZ A;  2BAP A;  2M9G A;  4FQO A;  4PDZ A;  1LXF C;  4WQ2 A;  1IKU A;  2KAY A;  1UHJ A;  1NPQ A;  2LAN A;  2VRG A;  3RZS A;  3R1P A;  1FW4 A;  4USL A;  1OE9 B;  4WQ3 A;  4M2Q A;  1NUB A;  2D8N A;  1GM0 A;  2KI6 C;  4N5X A;  2F2P A;  1BMO A;  4OZD A;  4R1E A;  1IH0 A;  1YUT A;  3FWC A;  1TNQ A;  4M2P A;  3OB2 B;  1EG4 A;  1OOJ A;  1JBA A;  1XK4 C;  5I8N A;  2NCP A;  1QLS A;  1VRK A;  5DKN A;  1QV0 A;  1JUO A;  1WY9 A;  2KI6 D;  2KQY A;  4A4C A;  1YVH A;  3EKJ A;  3CGA A;  1DEL A;  4PHM A;  2EHB A;  2PYQ A;  1AK8 A;  1J1E A;  1K95 A;  4C0L A;  1CFP A;  5HKY A;  4MZL A;  3WHU B;  2CT9 A;  1DF0 B;  1K8U A;  1YUU A;  4ZCU A;  4HRE E;  2K60 A;  3IVT A;  3NSK A;  2ERB A;  1K2H A;  1OMV A;  5JJG A;  1JWD A;  3F45 A;  4P2Y B;  2LVV A;  1JFK A;  4OVN F;  3S0G A;  1BR1 B;  3S0B A;  2HQ8 A;  2SAS A;  2FJY A;  5KSZ A;  1BT6 A;  3PN7 B;  1W9Z A;  1GJY A;  1PRW A;  2L51 A;  2PRU A;  3CZ0 A;  3L4L A;  2BEC A;  3SJS A;  4DCK A;  3B87 A; 
#chains in the Genus database with same CATH homology
 2KBM A;  4F0Z B;  2P6B B;  4CPV A;  2M3W A;  3TUY B;  4A4B A;  3SG7 A;  1F4O A;  5KTY A;  2QPT A;  1J55 A;  1MR8 A;  2WND A;  1S3P A;  1BOD A;  3DF0 A;  3HX4 A;  3I5G B;  1QX5 B;  2A4J A;  4JQ0 D;  1IGV A;  2K8M B;  1QLK A;  4YGE B;  1CFD A;  1PSB A;  1TTX A;  4YGB B;  4CFQ A;  2M0R A;  4GGN A;  1ALV A;  2V53 A;  4DUQ A;  4TNC A;  4YBH B;  1K9U A;  1SMG A;  4DIR A;  1JF2 A;  1KK8 B;  3BOW B;  1DVI A;  4HRH A;  1IG5 A;  1QX7 A;  2IS9 A;  4GPL B;  4BY4 A;  1S6C A;  1BF5 A;  1X02 A;  4AQJ A;  2O5G A;  1IRJ A;  1DJH A;  3PSR A;  3ZWH A;  2ZNE A;  1FI5 A;  1OQP A;  5BPJ A;  1YRU B;  2H2K A;  1XK4 A;  1KWO C;  2Y1M A;  1UUS A;  2EC6 C;  2F8P A;  2ZN9 A;  1KQM B;  1MF8 B;  2JC2 A;  3I5F C;  3OP0 A;  5IBW A;  1HQV A;  2WOS A;  2LHL A;  1GGZ A;  1YUS A;  1CDM A;  3IF7 A;  1B8R A;  1UHN A;  3GK1 A;  2MJW B;  4GFT A;  2JNF A;  1CDN A;  4MRY A;  1CNP A;  4CLN A;  5AFP A;  1C07 A;  3I5I B;  4C0K A;  2GGZ A;  1B8C A;  1FBV A;  1UP5 A;  4QJ5 B;  2LLU A;  5HLO A;  1LKJ A;  3WHT B;  2F3Z A;  1E8A A;  1S6I A;  4OR9 B;  2AMI A;  1RWY A;  4N1G A;  1SNL A;  3CLN A;  2EGD A;  1Q80 A;  3I5H C;  1DMO A;  2K2A A;  2LLS A;  5HLV A;  1QVI Y;  1WLZ A;  1QIW A;  1SR6 C;  2LHI A;  3BXK A;  4MZJ A;  5I2O A;  4MBE A;  4CFR A;  3SIA A;  2E30 A;  1OZO A;  2G2B A;  1PVB A;  1XFX O;  1KK7 Z;  2K2F A;  2KFH A;  5CPV A;  2PSR A;  1QAT A;  1SCM C;  1MXL C;  1M63 B;  3KF9 A;  3JVT C;  1KFU L;  2NXQ A;  1ZUZ A;  2DOQ A;  3PFV A;  3RLZ A;  1B9A A;  2ZND A;  2BKH B;  2LC5 A;  2GV5 A;  2Q91 A;  1A29 A;  3LK1 A;  2M8U A;  2LVJ A;  4NDD A;  2WCF A;  1NCY A;  2JT0 A;  1NIW A;  1YUR A;  4OKH A;  2LVI A;  1IQ3 A;  4HRG A;  1M45 A;  2ZKM X;  1TCO B;  3D10 A;  4PE7 A;  1AVS A;  1AUI B;  2LMT A;  2FCD A;  1REC A;  3NSL A;  1AHR A;  3QRX A;  3MSE B;  2BBN A;  1PK0 D;  3CR5 X;  2WC8 A;  3WNX B;  2MA2 A;  2KHN A;  2LLT A;  2H61 C;  2JXL A;  1PVA A;  2OTG B;  1SY9 A;  3NXA A;  1IQ5 A;  1A4P A;  1N65 A;  2JTZ A;  1RK9 A;  1U5I A;  2BE4 A;  2JT8 A;  5AER A;  1QX2 A;  3HCM A;  3PN7 C;  1WDC C;  1AP4 A;  4FTG A;  2KAX A;  1YR5 A;  4P5O E;  2LVK A;  2MRD A;  1OMD A;  1L2O B;  1A75 A;  2LE9 B;  1QJT A;  1AJ4 A;  3DF0 B;  3NSO A;  2K61 A;  5D69 A;  2BCB A;  1M39 A;  4GBA A;  1IJ5 A;  2L50 A;  1Y0V H;  1KCY A;  2Y1N A;  2KYF A;  2LMU A;  3GK4 X;  2F3Y A;  5F6T A;  4I5K A;  1XFU O;  1OMR A;  2LP3 A;  1S6J A;  5I2Q A;  2KOT A;  4PHN A;  3OX5 A;  1UUR A;  1TOP A;  2MHH A;  5CSI A;  1Y1X A;  1J1D A;  1KK8 C;  1B8L A;  1F4Q A;  1UHI A;  2FCE A;  3O6B A;  2AAO A;  1DJZ A;  1NX2 A;  1TNX A;  2M49 B;  1YTZ C;  1B4C A;  3TS5 C;  4I5J A;  1RJV A;  4MLW A;  1B1G A;  1JFJ A;  2LCP A;  3FWB A;  2JQ6 A;  4YGA A;  1DJY A;  1SL9 A;  1M46 A;  1IJ6 A;  2PMY A;  1XO5 A;  1TN4 A;  1N0Y A;  1CFC A;  4MN0 A;  2I18 A;  1KQM C;  5TNC A;  1RFJ A;  2KYC A;  1CMG A;  1RTP 1;  3IQQ A;  3JTD C;  1NX1 A;  2BCX A;  3K21 A;  4GGF C;  1DJI A;  2LAP A;  1AJ5 A;  1K9K A;  1LA0 A;  2E6W A;  3IQO A;  3O78 A;  4ORC B;  2L5X B;  4AQI A;  1K9P A;  3EK7 A;  2HQW A;  3LCP C;  4NDC A;  1XVJ A;  1LA3 A;  2KI4 C;  2L4I A;  1MWN A;  2H61 A;  2M1K B;  1EG3 A;  1XFZ O;  4PAL A;  1F54 A;  3EKH A;  3GK2 A;  1B7T Z;  2GGM A;  3H4S E;  3WXA A;  1SL8 A;  2AUC A;  2JRF A;  2JXC A;  2KQ6 A;  2SCP A;  1EH2 A;  2CBL A;  1CLL A;  4YGC B;  2NCO A;  4OV2 A;  3D0Y A;  1ALW A;  1PUL A;  1CFF A;  5G08 A;  4YRU A;  3DD4 A;  1DJG A;  1TNW A;  3VRN A;  1KK7 Y;  1F71 A;  1A2X A;  2JWW A;  2COL B;  2M1U A;  2PAS A;  1BJF A;  3M0W A;  2CXJ A;  2OPO A;  2L0P A;  1OSA A;  2I2R E;  2KGR A;  1JSA A;  3CTN A;  3KPX A;  4PE0 A;  1KFX L;  4U8D A;  3CWG A;  3VGO A;  1ZFS A;  1C7V A;  2HPS A;  5DKR A;  1ODB A;  3FIA A;  2LUC A;  1G8I A;  1Y6W A;  2K7C A;  3SG6 A;  3OB1 B;  4JPZ B;  4CID A;  5ER5 A;  2JNX A;  1KWO B;  4ETO A;  1NWD A;  2FJU B;  1G4Y R;  3BUN B;  4ICB A;  1H8B A;  2EC6 B;  1S1E A;  3I5F B;  1JC2 A;  2Y4Q A;  1IWQ A;  1XYD A;  4PE4 A;  2KSP A;  4Q04 A;  3EVU A;  3NSI A;  1EJ3 A;  3TDI A;  2Q4U A;  4IL1 A;  4L9M A;  3OHM B;  4I5N B;  1N2D A;  4GGF A;  1BG1 A;  3CZT X;  2OS8 B;  5B8I B;  1WRZ A;  1BR4 B;  5HKW A;  4AOM A;  5DKQ A;  2KFG A;  3ICB A;  1UHH A;  2BL0 B;  2NLN A;  3CR2 A;  4ORB B;  3O2P A;  4C0J A;  1FF1 A;  1J7O A;  2M29 A;  1C7W A;  4WRI A;  2NZ0 A;  1PSR A;  3I5H B;  1U5I B;  3VRQ A;  1ZAC A;  4ORA B;  1CKK A;  5I2L A;  3VRR A;  1BU3 A;  1QAS A;  1QS7 A;  5HKZ A;  5AAN A;  1MXE A;  3SG4 A;  3DVM A;  4NDB A;  5CSN A;  1V1G A;  2LNK A;  3EK4 A;  1A75 B;  3EK8 A;  1DTL A;  1YX7 A;  5GQQ C;  1CM4 A;  1D1O A;  1WRL A;  1CTR A;  3SG3 A;  4MRX A;  3LLE A;  5AXI A;  5FYX A;  2L2E A;  4YI8 A;  1SCM B;  3O4Y A;  1NCX A;  1TNP A;  2I94 A;  2K7O A;  5CSF A;  1SPY A;  1K96 A;  3JVT B;  4XJK A;  3DVJ A;  1J7Q A;  2LUX A;  2M7N A;  1SRA A;  2KDH A;  3KO0 A;  2ZRS A;  2LV7 A;  1NYA A;  3ZNI A;  4UPG A;  3PLF B;  1UHK A;  4GAO A;  2M7L A;  4BY5 A;  1F55 A;  1GQM A;  2Y5I A;  2CTN A;  3BYA A;  4MEW A;  5K89 A;  1SL7 A;  3TUY C;  2B1U A;  3OX6 A;  4DS7 A;  1S5G Z;  1W7J B;  1SBJ A;  5AEQ A;  1ZOT B;  3I5G C;  1FPW A;  1TCF A;  2KFF A;  1KSO A;  3LK0 A;  4GUK A;  1R6P A;  2JOJ A;  1XFW O;  1SYM A;  4QJ4 B;  1CMF A;  2FOT A;  2WCE A;  1MQ1 A;  4OCI A;  1DGV A;  1QIV A;  2WOR A;  3A8R A;  3KEV A;  2KAV A;  1DGU A;  2KGB C;  2ZFD A;  2R2I A;  5HYD A;  3VRP A;  3BUO B;  1MHO A;  1DJX A;  3TDZ A;  4QJ3 B;  4D1E A;  1B7T Y;  3DVK A;  1S26 D;  3PM8 A;  4N1F A;  1MUX A;  3C1V A;  2MLF C;  1LVC D;  1QV1 A;  1NSH A;  1CDP A;  2CNP A;  1A03 A;  1WDC B;  3KHE A;  2BKI B;  4ZCV A;  1B47 A;  5J3X A;  3SG2 A;  2JUL A;  1CB1 A;  3BUW B;  5CSJ A;  3D0Y B;  4JWQ A;  1KSM A;  3AAK A;  1DF0 A;  1K90 D;  1F8H A;  3DVE A;  1H4B A;  3TZ1 A;  1XA5 A;  1YX8 A;  1TRF A;  3I5I C;  1KQV A;  3CS1 A;  3E3R A;  4I5L B;  3RM1 A;  1J7P A;  2BCA A;  1DJW A;  2LM5 A;  2QAC A;  1LIN A;  5ER4 X;  4PCW A;  1BOC A;  4XYN A;  2TN4 A;  1HT9 A;  3CR4 X;  4YGD B;  2KNE A;  2BE6 A;  2ISD A;  1CLM A;  1R2U A;  1CM1 A;  2JZI A;  2K0J A;  4PHJ A;  1CDL A;  1K94 A;  2MAZ A;  1FI6 A;  3TS5 B;  1Y1U A;  2I7A A;  1YRT B;  1WRK A;  2BBM A;  1Y1A A;  2JPT A;  1EL4 A;  3BQ3 A;  2PVB A;  3FS7 A;  4NQG A;  1M31 A;  1S36 A;  3JTD B;  3LL8 B;  1EXR A;  1NX3 A;  1SKT A;  1V1F A;  4PE1 A;  1TIZ A;  1W7I B;  1UWO A;  2JTT A;  3BOW A;  1QTX A;  1F70 A;  5PAL A;  2F2O A;  2L98 A;  2KI4 B;  2M97 A;  2KBI A;  1YVL A;  2K7B A;  2OS8 C;  2MBX A;  1QXP A;  2K7D A;  1SK6 D;  2ZN8 A;  5D7F A;  1L7Z A;  2BL0 C;  1GGW A;  2F33 A;  3SIB A;  1ZMZ A;  3BUM B;  2G9B A;  1NX0 A;  4MSP A;  3A4U B;  1G33 A;  3PAL A;  3VRO A;  4E68 A;  1KFX S;  4DRW A;  3GOF A;  1SCV A;  3SG5 A;  2PAL A;  3BUX B;  4GNK B;  1DT7 B;  2JU0 A;  3PAT A;  1PAL A;  4YI9 A;  3EVR A;  5JOL A;  1K93 D;  2WCB A;  3EVV A;  2HET A;  2LMV A;  1WLM A;  2HF5 A;  3AKA A;  1XFY O;  1NP8 A;  1SR6 B;  2LP2 A;  1XFV O;  1OZS A;  4XJK B;  2OTG C;  3TDU A;  1CLB A;  4M2O A;  1J7R A;  1NCZ A;  5KU1 A;  1JF0 A;  3AAJ A;  1KFU S;  1RRO A;  1SW8 A;  2O60 A;  1QVI Z;  2MLE C;  4MZK A;  2L4H A;  1BLQ A;  4MVF A;  2ZRT A;  4PHK A;  1L2O C;  1S5G Y;  2JT3 A;  2RGI A;  2CCM A;  3AKB A;  4HSZ A;  2M9G A;  4FQO A;  4PDZ A;  1LXF C;  4WQ2 A;  1IKU A;  2KAY A;  1UHJ A;  1NPQ A;  2LAN A;  2VRG A;  1FW4 A;  4USL A;  1OE9 B;  4WQ3 A;  4M2Q A;  1NUB A;  2D8N A;  2KI6 C;  4N5X A;  2F2P A;  1BMO A;  4R1E A;  1IH0 A;  1YUT A;  3FWC A;  1TNQ A;  4M2P A;  3OB2 B;  1EG4 A;  1OOJ A;  1JBA A;  1XK4 C;  5I8N A;  2NCP A;  1QLS A;  1VRK A;  5DKN A;  1QV0 A;  1JUO A;  1WY9 A;  2KI6 D;  2KQY A;  4A4C A;  1YVH A;  3EKJ A;  3CGA A;  4PHM A;  2EHB A;  1AK8 A;  1J1E A;  1K95 A;  4C0L A;  1CFP A;  5HKY A;  4MZL A;  3WHU B;  2CT9 A;  1DF0 B;  1K8U A;  1YUU A;  4ZCU A;  4HRE E;  3NSK A;  1K2H A;  1OMV A;  5JJG A;  1JWD A;  3F45 A;  4P2Y B;  2LVV A;  1JFK A;  4OVN F;  1BR1 B;  2HQ8 A;  2SAS A;  5KSZ A;  1BT6 A;  3PN7 B;  2PRU A;  1GJY A;  1PRW A;  2L51 A;  2BEC A;  3SJS A;  4DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...