1DT7B

Solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the negative regulatory domain of p53 bound to S100B(betabeta).
pubmed doi rcsb
molecule keywords S100 CALCIUM-BINDING PROTEIN
molecule tags Signaling protein
source organism Rattus norvegicus
total genus 27
structure length 92
sequence length 92
chains with identical sequence A
ec nomenclature
pdb deposition date 2000-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00036 EF-hand_1 EF hand
B PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1dt7B00
1WLZA 2MJWB 3BUWB 1UHNA 1BF5A 1SKTA 1XFYO 3EKJA 3AKBA 4WRIA 3H4SE 3PM8A 2WCFA 1K93D 3BUOB 1G4YR 5KU1A 1QXPA 5CSJA 1BOCA 1QIWA 1UHJA 2MRDA 1EH2A 1XFVO 1IGVA 2K0JA 4I5KA 3SIAA 1RK9A 3SIBA 5AERA 1HQVA 2OS8C 4DCKA 4ETOA 2OS8B 2GGZA 2LHLA 2LVKA 1N0YA 1CFPA 1GGWA 3FS7A 4PHNA 1TNQA 1YRTB 3CZTX 4HSZA 1DJWA 2KNEA 5FYXA 1CM4A 2A4JA 3IQQA 2KGBC 1SR6C 1NCYA 1IJ5A 1DGVA 1SR6B 1F71A 3BUMB 2AAOA 1LXFC 2EC6C 1ZFSA 2EGDA 2M29A 3BXKA 2KOTA 1D1OA 1S3PA 3EVRA 3FWBA 3K21A 4FTGA 1FI6A 4YGAA 1G8IA 2F8PA 2KAXA 1B1GA 3LK1A 3LCPC 1QIVA 1M31A 2KBIA 3D10A 1C7VA 1FPWA 1B47A 2PVBA 1NIWA 5HKZA 1YUSA 2CNPA 2LMTA 4CFRA 3BOWA 2KQYA 1CFDA 1J1EA 3LL8B 4GUKA 1L2OC 1PSRA 1XA5A 1L2OB 3PSRA 2JT8A 2JNXA 3NSIA 4M2PA 4PE7A 1CDNA 2BE4A 1CMFA 3I5HC 1DT7B 1CLMA 3I5HB 1N65A 1VRKA 4OVNF 1K9PA 3JTDC 1F4QA 3I5FC 4MVFA 5JJGA 3JTDB 2NCPA 3I5FB 5DKRA 2E30A 1J7QA 2PASA 1RROA 2L98A 2KFFA 5DKNA 3DF0B 2F2OA 1AJ5A 3DVJA 1FW4A 3KPXA 2KHNA 5GQQC 4OKHA 2AUCA 1TCFA 2ZN8A 4MZKA 4YBHB 1K95A 1ALVA 2I18A 3EVUA 4P2YB 1WRKA 1K90D 4C0KA 5AFPA 1B8RA 5CSNA 3DD4A 1F55A 2R2IA 2K7CA 4YI8A 2KI6C 1M45A 2Y5IA 2LHIA 1TNPA 4PE0A 5F6TA 2ZRTA 4TNCA 3GK2A 2CCMA 2K7OA 1C7WA 4ORCB 2H2KA 1BG1A 1BMOA 2MA2A 3CGAA 4MN0A 1GQMA 1EL4A 1XVJA 1X02A 2M7NA 1YTZC 1UURA 3OX5A 1E8AA 2LP3A 2NZ0A 1QVIZ 5I2LA 1Y1XA 1MXEA 4AQJA 5CSFA 2WCEA 1QATA 1B9AA 1SPYA 5AXIA 4NDDA 1RJVA 4WQ2A 1OZSA 4UPGA 2PSRA 1M63B 2JWWA 1A03A 4I5LB 5HLOA 1BLQA 1BT6A 2L5XB 1MQ1A 1MUXA 1NCXA 1QLSA 1WDCC 4ICBA 4YI9A 1OSAA 3TDZA 1WDCB 1ZUZA 3LLEA 1H4BA 2K61A 2L4IA 1HT9A 3FWCA 5HLVA 2HETA 1SCMC 2LANA 4GGFA 1BJFA 3CR4X 1SCMB 3SG6A 3NXAA 3CS1A 1NCZA 2L2EA 2BCAA 3EK4A 4M2QA 1W7JB 1A2XA 4F0ZB 4MSPA 4OCIA 1DJGA 1NPQA 2K7DA 2M49B 4AOMA 1XK4A 1IRJA 1QV1A 2O5GA 2Q91A 3FIAA 2PRUA 2JZIA 4I5JA 1J7PA 2G2BA 3DVEA 1JC2A 2M7LA 4D1EA 2LLUA 2CXJA 1YURA 1ODBA 1S6CA 2MLEC 4PDZA 2OTGC 2OTGB 3SG4A 1YX8A 4PE4A 2JULA 2ZNEA 1TOPA 2L4HA 2M97A 2KGRA 1CB1A 1PVBA 2F3YA 4A4CA 3DVMA 2LVJA 5ER5A 3WHTB 1J7OA 1UHKA 3O6BA 2KAYA 1F54A 4GBAA 1K2HA 4C0LA 4YGBB 1CDLA 3JVTC 3JVTB 2LVVA 3O2PA 4HRHA 1OOJA 3E3RA 2F33A 2LCPA 1YVHA 1M39A 4PALA 1BU3A 2JPTA 1AVSA 1TNXA 1QLKA 2LM5A 3NSLA 2KQ6A 2LC5A 2SASA 1K96A 2DOQA 1JFKA 2KBMA 1CNPA 4QJ5B 1C07A 1SRAA 1DTLA 3HX4A 1DJXA 2D8NA 4GFTA 1KSOA 1QV0A 3BUNB 3PALA 1A29A 1IWQA 2TN4A 4JPZB 3OX6A 1S6JA 2NXQA 3F45A 4N1FA 5PALA 1U5IB 2BKIB 4I5NB 5HKWA 1B7TZ 3IQOA 1OMRA 3EKHA 1LKJA 4JQ0D 2I7AA 3KHEA 3D0YA 4MZJA 4CLNA 4XJKB 1V1GA 2LV7A 5IBWA 1XFXO 2LVIA 3VGOA 1MHOA 1PVAA 4WQ3A 4XYNA 2KSPA 2H61C 1XFWO 5J3XA 2M3WA 1YVLA 5B8IB 1XFUO 1TNWA 1LINA 1NX3A 3C1VA 3EK8A 1M46A 1KCYA 2V53A 4GNKB 3CLNA 1ZOTB 2JXLA 4U8DA 2CBLA 3SG2A 2GGMA 2MAZA 1IQ3A 1DF0B 1K94A 1KK7Z 2JTZA 1S6IA 1NSHA 1RECA 2I94A 2K8MB 3QRXA 4GGFC 1FI5A 2JC2A 2WOSA 3ZNIA 2RGIA 2COLB 5BPJA 2AMIA 1RTP1 2ZFDA 1LA3A 2WC8A 2I2RE 3BUXB 3BYAA 1DJZA 3CR2A 2BCBA 4N5XA 3IF7A 1DJHA 1XK4C 1NYAA 3I5IC 3I5IB 2HF5A 2Q4UA 3TS5C 4GGNA 3TS5B 2Y1NA 3PFVA 2KAVA 1J1DA 1CMGA 4BY4A 1GGZA 1OQPA 1QX5B 1UHIA 1EG4A 2SCPA 1Y1AA 1TRFA 3PN7C 1IKUA 3PN7B 3OHMB 4PCWA 1R2UA 1JUOA 2M8UA 4DUQA 2HPSA 2NLNA 2CTNA 5DKQA 2QPTA 3HCMA 3AAJA 1MR8A 3BQ3A 3CR5X 4PHKA 1SMGA 2WORA 3SG7A 1XFZO 2L50A 3M0WA 1DVIA 4MBEA 5CSIA 4MRXA 1JSAA 1Q80A 2JOJA 4MRYA 3DVKA 1LVCD 1IG5A 4IL1A 1S1EA 1CLLA 3ICBA 5D7FA 3RM1A 1TIZA 2ZRSA 3VRNA 2LE9B 3GK4X 1DMOA 1S36A 1AUIB 1QJTA 3WXAA 1QVIY 2IS9A 5ER4X 2HQ8A 2QACA 1F8HA 1A75A 1AK8A 4MEWA 2LLTA 1F70A 3GK1A 5AEQA 1RFJA 2LAPA 1Y0VH 2OPOA 3AKAA 5CPVA 1SNLA 1PK0D 2EHBA 1AJ4A 5I8NA 4OR9B 4FQOA 1SCVA 5AANA 2VRGA 1KSMA 1MWNA 1TCOB 2KFHA 5K89A 4CPVA 1KQVA 1SBJA 4DRWA 1BR4B 1QTXA 3CWGA 2JQ6A 1B8CA 1NUBA 4N1GA 5KSZA 1CM1A 1NX1A 3I5GC 2E6WA 4CIDA 2FCEA 3I5GB 1PALA 3BOWB 1Y6WA 4MLWA 1EJ3A 3OB1B 1SK6D 2JT0A 2KI4C 1SW8A 2K2FA 2KI4B 3AAKA 1AP4A 4A4BA 1G33A 3GOFA 1V1FA 4NDBA 4YGCB 1BODA 3OB2B 2ZNDA 3EK7A 3CTNA 4YGDB 2G9BA 2ISDA 1QX2A 4ORBB 1ALWA 3SJSA 4YRUA 3VROA 1R6PA 1OMDA 5I2OA 1JF0A 1FBVA 3D0YB 5TNCA 1W7IB 2LNKA 2JNFA 3TZ1A 4OV2A 3VRPA 2FJUB 2M1KB 1IH0A 1NX2A 1YUUA 1BR1B 1N2DA 1MXLC 1SL8A 1OZOA 4HRGA 4CFQA 1DGUA 2KFGA 1F4OA 4R1EA 2LLSA 2BL0C 1JFJA 3O78A 2BL0B 4DIRA 1B4CA 1S26D 1Y1UA 3WHUB 4P5OE 1WY9A 2F3ZA 2FCDA 2EC6B 2L51A 1CDMA 3KF9A 5I2QA 1MF8B 1CFFA 3VRQA 1XO5A 3PATA 1H8BA 1NWDA 1CFCA 1ZMZA 1UWOA 1KFUL 2BE6A 1K9KA 1KFXL 2NCOA 2PMYA 5G08A 1TTXA 1RWYA 4ZCUA 3ZWHA 4PHMA 1WRLA 4M2OA 2L0PA 2MHHA 3KO0A 3A8RA 1QS7A 1J55A 1JWDA 4BY5A 1S5GZ 5D69A 1TN4A 1UP5A 1GJYA 2LMVA 5HKYA 5JOLA 3TUYC 3MSEB 3TUYB 1WRZA 3VRRA 4GAOA 1IQ5A 4HREE 2BBNA 3SG5A 2MLFC 2JRFA 1K9UA 1KQMC 1EXRA 1NX0A 2FOTA 1KQMB 2LP2A 1JBAA 1PSBA 2M0RA 1OMVA 1SL9A 2P6BB 3OP0A 3O4YA 1CDPA 1YR5A 2PALA 1PULA 1AHRA 4PHJA 2KDHA 4E68A 2ZN9A 3RLZA 1B7TY 2M9GA 4ORAB 1SYMA 1PRWA 2F2PA 4NDCA 1K8UA 2O60A 1CTRA 3TDUA 1KWOC 5KTYA 1NP8A 4L9MA 1A75B 1KWOB 2KYFA 3A4UB 1ZACA 2JTTA 1B8LA 1YRUB 2WCBA 2LUCA 1UHHA 1KK8C 3WNXB 1U5IA 1KK8B 2JU0A 3SG3A 2K7BA 1SL7A 4QJ3B 4USLA 1DJIA 2LUXA 3DF0A 1S5GY 4AQIA 4JWQA 1J7RA 1YUTA 1QASA 2ZKMX 4XJKA 3NSKA 2Y4QA 4YGEB 1KFUS 1KFXS 2GV5A 2H61A 4MZLA 1KK7Y 1CLBA 1L7ZA 4PE1A 1JF2A 1WLMA 1YX7A 3NSOA 4C0JA 2BBMA 2K2AA 2HQWA 2LMUA 2JXCA 1OE9B 2KYCA 2M1UA 3TDIA 3KEVA 4GPLB 2BECA 2WNDA 1QX7A 1LA0A 1SY9A 3EVVA 2BCXA 1DF0A 4ZCVA 2MBXA 4Q04A 1IJ6A 2B1UA 4NQGA 1DJYA 1CKKA 1EG3A 2KI6D 4QJ4B 2JT3A 3PLFB 2CT9A 1FF1A 1UUSA 1XYDA 3LK0A 5HYDA 4DS7A 2Y1MA 1A4PA 2BKHB
chains in the Genus database with same CATH superfamily
1WLZA 2MJWB 3BUWB 1UHNA 1BF5A 1SKTA 1XFYO 3EKJA 3AKBA 2QEHA 4WRIA 3H4SE 3PM8A 2WC5A 1K93D 2WCFA 3BUOB 1G4YR 3DXLA 5KU1A 1QXPA 5CSJA 1BOCA 1QIWA 1UHJA 1TUJA 2MRDA 1EH2A 3FE8A 1XFVO 1IGVA 2K0JA 4I5KA 3SIAA 1RK9A 3SIBA 3N7HA 5AERA 1HQVA 2OS8C 4DCKA 4ETOA 2OS8B 2PYQA 2GGZA 2LHLA 2L2CA 2LVKA 1N0YA 1CFPA 1GGWA 3FS7A 3BFBA 4PHNA 1TNQA 1YRTB 3CZTX 4HSZA 3EG5B 1DJWA 3R1OA 2KNEA 5FYXA 1CM4A 2A4JA 3IQQA 2KGBC 1SR6C 1NCYA 1IJ5A 1DGVA 1SR6B 1F71A 3BUMB 2AAOA 1LXFC 2EC6C 1ZFSA 2EGDA 2M29A 3BXKA 2KOTA 1D1OA 1S3PA 3BFHA 3EVRA 3FWBA 3K21A 4FTGA 1FI6A 4YGAA 1G8IA 2F8PA 2KAXA 1B1GA 3LK1A 3LCPC 1QIVA 1M31A 2KBIA 3D10A 4IJ7A 5FI2A 1B47A 2PVBA 1NIWA 1C7VA 1FPWA 3O4XA 5HKZA 1YUSA 2CNPA 1OOHA 2LMTA 4CFRA 3BOWA 2KQYA 1CFDA 1J1EA 3LL8B 4GUKA 1L2OC 1TUZA 1PSRA 1XA5A 1L2OB 3PSRA 2JT8A 2JNXA 3NSIA 4M2PA 4PE7A 1CDNA 2BE4A 1CMFA 3I5HC 1DT7B 1CLMA 2KLEA 3I5HB 1N65A 1VRKA 3R1PA 1K9PA 4OVNF 3JTDC 1F4QA 3BJHA 3I5FC 3L4AA 3JTDB 2NCPA 3I5FB 4MVFA 5DKRA 5JJGA 2E30A 3NHIA 1J7QA 2PASA 1RROA 2L98A 2KFFA 4INWA 3DF0B 5DKNA 2F2OA 1AJ5A 3DVJA 1FW4A 3KPXA 2KHNA 5GQQC 4OKHA 2AUCA 1TCFA 2ZN8A 4MZKA 4YBHB 1K95A 1ALVA 2I18A 3EVUA 4P2YB 1WRKA 1K90D 4C0KA 5AFPA 1B8RA 5CSNA 3DD4A 1F55A 2R2IA 2K7CA 4YI8A 2KI6C 1M45A 2Y5IA 3IVTA 1TWOA 2LHIA 1TNPA 4PE0A 5F6TA 2ZRTA 4TNCA 3GK2A 2CCMA 2K7OA 1C7WA 2KPHA 4ORCB 2H2KA 1BG1A 1BMOA 4JD9A 1OW4A 2MA2A 3OGNA 3CGAA 4MN0A 1GQMA 1EL4A 1XVJA 3SS4A 1X02A 2M7NA 1YTZC 1UURA 3OX5A 1E8AA 2LP3A 2NZ0A 1QVIZ 5I2LA 1Y1XA 1MXEA 3QMEA 4AQJA 5CSFA 2WCEA 2FJYA 1QATA 3B87A 1B9AA 1SPYA 2QDIA 5AXIA 4NDDA 1RJVA 4WQ2A 1OZSA 4UPGA 2PSRA 2QEOA 1M63B 2JWWA 1A03A 4I5LB 5HLOA 1BLQA 1BT6A 2L5XB 1MQ1A 1MUXA 1NCXA 1QLSA 1WDCC 2ERBA 4ICBA 1OSAA 3TDZA 1WDCB 1ZUZA 3LLEA 1H4BA 2K61A 3K1EA 2L4IA 1HT9A 3FWCA 5HLVA 2YGUA 2HETA 1SCMC 2LANA 4GGFA 1BJFA 3CR4X 1SCMB 3SG6A 3NXAA 3CS1A 1DEKA 1NCZA 2L2EA 2BCAA 3EK4A 4M2QA 1W7JB 1A2XA 4F0ZB 4MSPA 4OCIA 1DJGA 1NPQA 2JPOA 2K7DA 2M49B 4AOMA 1XK4A 3DZTA 1IRJA 1QV1A 2O5GA 2Q91A 3FIAA 2PRUA 3FE9A 2JZIA 4I5JA 4OZDA 1J7PA 2G2BA 3DVEA 1JC2A 2P70A 2M7LA 3B6XA 4D1EA 2LLUA 2CXJA 1YURA 1ODBA 1S6CA 2MLEC 4PDZA 2OTGC 1SSEB 2OTGB 3Q8IA 5I94A 3L47A 3D75A 3SG4A 3VB1A 2QEVA 1YX8A 4PE4A 2JULA 2ZNEA 1TOPA 2L4HA 2M97A 3BFAA 2KGRA 1CB1A 1PVBA 2F3YA 3S0AA 4A4CA 3DVMA 2LVJA 5ER5A 3WHTB 1J7OA 1UHKA 3O6BA 2KAYA 1F54A 4GBAA 1K2HA 3B86A 4YGBB 1OOIX 4C0LA 1CDLA 3JVTC 3JVTB 2LVVA 4FQTA 3O2PA 4HRHA 1OOJA 3E3RA 2F33A 5DICA 2LCPA 1YVHA 1M39A 1DC1A 4PALA 1W9ZA 2L5YA 4YI9A 5HL1A 1BU3A 2JPTA 1AVSA 1TNXA 1QLKA 2LM5A 3NSLA 2KQ6A 2LC5A 2SASA 1K96A 3SS5A 2DOQA 1JFKA 2KBMA 1CNPA 4QJ5B 1C07A 1SRAA 1DTLA 3HX4A 1DJXA 2D8NA 4GFTA 1KSOA 1QV0A 3BUNB 3PALA 1A29A 1IWQA 1XFRA 2TN4A 3RZSA 4JPZB 2WCMA 3OX6A 1S6JA 2NXQA 3F45A 3OBVA 4N1FA 5PALA 3S0DA 1U5IB 2BKIB 4I5NB 5HKWA 1B7TZ 3IQOA 1OMRA 3EKHA 3PJIA 1LKJA 4JQ0D 2GTEA 2I7AA 2QEBA 3KHEA 3D0YA 4MZJA 4CLNA 4XJKB 1V1GA 2LV7A 3SS3A 5IBWA 1XFXO 2LVIA 3VGOA 1MHOA 1PVAA 4WQ3A 4XYNA 2KSPA 2H61C 1XFWO 2WCKA 5J3XA 1Z2CB 2M3WA 1YVLA 5B8IB 1XFUO 1TNWA 1LINA 1NX3A 3C1VA 3EK8A 1M46A 1KCYA 2V53A 4GNKB 3CLNA 1ZOTB 2JXLA 4U8DA 2CBLA 1OOGA 3SG2A 2GGMA 2MAZA 1IQ3A 1DF0B 1K94A 1KK7Z 3CZ0A 2JTZA 1S6IA 1NSHA 1RECA 2I94A 2K8MB 3QRXA 4GGFC 4INXA 1FI5A 2JC2A 2WOSA 3ZNIA 2RGIA 2COLB 5BPJA 2AMIA 1RTP1 2WCHA 3L4LA 2ZFDA 1LA3A 2WC8A 2I2RE 3BUXB 3BYAA 1DJZA 3CR2A 2BCBA 1IIOA 4N5XA 4F7FA 3IF7A 1DJHA 1XK4C 1NYAA 3I5IC 3I5IB 2HF5A 2Q4UA 3TS5C 4GGNA 3S0FA 3TS5B 2Y1NA 3PFVA 2KAVA 1J1DA 1CMGA 4BY4A 1GGZA 1OQPA 3CZ2A 1QX5B 1UHIA 1EG4A 2SCPA 1Y1AA 1TRFA 3PN7C 1IKUA 3PN7B 3OHMB 4PCWA 1R2UA 1JUOA 2M8UA 4DUQA 2HPSA 2NLNA 2WCLA 2CTNA 5DKQA 2QPTA 3HCMA 1DQEA 1MR8A 3AAJA 3BQ3A 3CR5X 1SMGA 4PHKA 2WORA 3SG7A 1XFZO 5FI7A 2L50A 3M0WA 1DVIA 4MBEA 5CSIA 1OOFA 4MRXA 1JSAA 3D78A 1Q80A 3R72A 2JOJA 4MRYA 3D76A 3DVKA 1LVCD 1IG5A 4IL1A 1S1EA 1CLLA 3ICBA 5D7FA 3RM1A 1TIZA 2ZRSA 3VRNA 2LE9B 3GK4X 1DMOA 1S36A 1AUIB 1QJTA 3WXAA 1QVIY 2IS9A 5ER4X 2HQ8A 2QACA 1LS8A 1A75A 1AK8A 1F8HA 4MEWA 2LLTA 1F70A 3GK1A 5AEQA 1RFJA 2LAPA 1Y0VH 2OPOA 3AKAA 5CPVA 1SNLA 1PK0D 2EHBA 1AJ4A 5I8NA 4OR9B 4FQOA 1SCVA 5AANA 2VRGA 1KSMA 1MWNA 1TCOB 2KFHA 5K89A 4CPVA 1KQVA 1SBJA 4DRWA 1Z4HA 4JKTA 1BR4B 1QTXA 3CWGA 2JQ6A 1B8CA 1NUBA 4N1GA 5KSZA 1CM1A 1NX1A 3I5GC 2E6WA 4CIDA 2FCEA 3I5GB 1PALA 3BOWB 1Y6WA 4MLWA 1EJ3A 3OB1B 2WCJA 1SK6D 2JT0A 2KI4C 1SW8A 2K2FA 2KI4B 3AAKA 2P71A 3CABA 3S0GA 4A4BA 1AP4A 1G33A 3GOFA 1V1FA 4NDBA 3UNWA 4YGCB 1BODA 3OB2B 2ZNDA 3EK7A 3CTNA 4YGDB 2G9BA 2ISDA 1QX2A 4ORBB 1ALWA 3SJSA 4YRUA 2KLDA 1R6PA 1OMDA 3VROA 1JF0A 1FBVA 3D0YB 5TNCA 1W7IB 2LNKA 2JNFA 3TZ1A 4OV2A 3VRPA 2FJUB 2M1KB 3B7AA 3D74A 1IH0A 1NX2A 1YUUA 1BR1B 1N2DA 1MXLC 1SL8A 1OZOA 4HRGA 4CFQA 1DGUA 2KFGA 5D3OA 1F4OA 4R1EA 3DYEA 2LLSA 2BL0C 4KYNA 1JFJA 3O78A 2BL0B 4DIRA 1B4CA 1S26D 3UO9A 1Y1UA 3WHUB 4P5OE 1GM0A 1WY9A 3D77A 2F3ZA 2FCDA 2EC6B 2L51A 2PQLA 2WC6A 2BAPA 1CDMA 1QWVA 3KF9A 3S0EA 5I2QA 1MF8B 1CFFA 3VRQA 1XO5A 3PATA 1H8BA 1NWDA 1C3YA 1CFCA 1ZMZA 1UWOA 1KFUL 2BE6A 1K9KA 1KFXL 2NCOA 2PMYA 5G08A 1TTXA 1RWYA 4ZCUA 3ZWHA 4PHMA 1WRLA 4M2OA 2L0PA 2MHHA 3KO0A 3A8RA 1QS7A 1J55A 1JWDA 4BY5A 1S5GZ 5D69A 1TN4A 1UP5A 1GJYA 2LMVA 5HKYA 5EL2A 5JOLA 3TUYC 3PM2A 3MSEB 3TUYB 5I2OA 1WRZA 3VRRA 1DELA 1IQ5A 4GAOA 2BBNA 4HREE 3SG5A 3V2LA 2MLFC 2JRFA 1K9UA 1KQMC 1EXRA 1NX0A 1T14A 1KQMB 2FOTA 2LP2A 1JBAA 5FI6A 1PSBA 1C3ZA 2M0RA 1OMVA 1SL9A 2P6BB 3OP0A 3O4YA 1CDPA 1YR5A 2PALA 3CDNA 2H8VA 1PULA 1AHRA 4PHJA 4PT1A 2KDHA 4E68A 2ZN9A 3RLZA 1B7TY 2M9GA 4ORAB 1SYMA 1PRWA 2F2PA 3FE6A 4NDCA 1K8UA 2O60A 1CTRA 3TDUA 1KWOC 5KTYA 1NP8A 4L9MA 1A75B 1KWOB 2KYFA 3A4UB 1ZACA 2JTTA 1B8LA 1YRUB 2WCBA 2LUCA 3NHTA 1UHHA 1KK8C 2BNXA 3WNXB 1U5IA 3R1VA 1KK8B 3CYZA 2JU0A 3SG3A 3S0BA 2K7BA 1SL7A 4QJ3B 4USLA 1DJIA 2LUXA 3DF0A 1S5GY 4AQIA 1ORGA 1J7RA 1YUTA 1QASA 2ZKMX 3B88A 4JWQA 4XJKA 3NSKA 2Y4QA 4YGEB 1KFUS 1KFXS 2GV5A 2H61A 4MZLA 1KK7Y 1CLBA 1L7ZA 4PE1A 1JF2A 1WLMA 1YX7A 3NSOA 4C0JA 2BBMA 2K2AA 2HQWA 2LMUA 3D73A 2JXCA 1OE9B 2KYCA 2M1UA 3NGVA 3KEVA 3TDIA 4GPLB 2BECA 2WNDA 1QX7A 1LA0A 1SY9A 3EVVA 2BCXA 1DF0A 4ZCVA 2MBXA 4Q04A 1IJ6A 2B1UA 4NQGA 1DJYA 1CKKA 1P28A 1EG3A 2KI6D 3CZ1A 3DY9A 4QJ4B 2JT3A 3PLFB 2CT9A 1FF1A 1UUSA 1XYDA 3LK0A 5HYDA 4DS7A 2Y1MA 1A4PA 2BKHB 2K60A
chains in the Genus database with same CATH topology
1WLZA 2MJWB 3BUWB 1UHNA 1BF5A 1SKTA 1XFYO 3EKJA 3AKBA 4WRIA 3H4SE 3PM8A 2WCFA 1K93D 3BUOB 1G4YR 5KU1A 1QXPA 5CSJA 1BOCA 1QIWA 1UHJA 2MRDA 1EH2A 1XFVO 1IGVA 2K0JA 4I5KA 3SIAA 1RK9A 3SIBA 5AERA 1HQVA 2OS8C 4DCKA 4ETOA 2OS8B 2GGZA 2LHLA 2LVKA 1N0YA 1CFPA 1GGWA 3FS7A 4PHNA 1TNQA 1YRTB 3CZTX 4HSZA 1DJWA 2KNEA 5FYXA 1CM4A 2A4JA 3IQQA 2KGBC 1SR6C 1NCYA 1IJ5A 1DGVA 1SR6B 1F71A 3BUMB 2AAOA 1LXFC 2EC6C 1ZFSA 2EGDA 2M29A 3BXKA 2KOTA 1D1OA 1S3PA 3EVRA 3FWBA 3K21A 4FTGA 1FI6A 4YGAA 1G8IA 2F8PA 2KAXA 1B1GA 3LK1A 3LCPC 1QIVA 1M31A 2KBIA 3D10A 1C7VA 1FPWA 1B47A 2PVBA 1NIWA 5HKZA 1YUSA 2CNPA 2LMTA 4CFRA 3BOWA 2KQYA 1CFDA 1J1EA 3LL8B 4GUKA 1L2OC 1PSRA 1XA5A 1L2OB 3PSRA 2JT8A 2JNXA 3NSIA 4M2PA 4PE7A 1CDNA 2BE4A 1CMFA 3I5HC 1DT7B 1CLMA 3I5HB 1N65A 1VRKA 4OVNF 1K9PA 3JTDC 1F4QA 3I5FC 4MVFA 5JJGA 3JTDB 2NCPA 3I5FB 5DKRA 2E30A 1J7QA 2PASA 1RROA 2L98A 2KFFA 5DKNA 3DF0B 2F2OA 1AJ5A 3DVJA 1FW4A 3KPXA 2KHNA 5GQQC 4OKHA 2AUCA 1TCFA 2ZN8A 4MZKA 4YBHB 1K95A 1ALVA 2I18A 3EVUA 4P2YB 1WRKA 1K90D 4C0KA 5AFPA 1B8RA 5CSNA 3DD4A 1F55A 2R2IA 2K7CA 4YI8A 2KI6C 1M45A 2Y5IA 2LHIA 1TNPA 4PE0A 5F6TA 2ZRTA 4TNCA 3GK2A 2CCMA 2K7OA 1C7WA 4ORCB 2H2KA 1BG1A 1BMOA 2MA2A 3CGAA 4MN0A 1GQMA 1EL4A 1XVJA 1X02A 2M7NA 1YTZC 1UURA 3OX5A 1E8AA 2LP3A 2NZ0A 1QVIZ 5I2LA 1Y1XA 1MXEA 4AQJA 5CSFA 2WCEA 1QATA 1B9AA 1SPYA 5AXIA 4NDDA 1RJVA 4WQ2A 1OZSA 4UPGA 2PSRA 1M63B 2JWWA 1A03A 4I5LB 5HLOA 1BLQA 1BT6A 2L5XB 1MQ1A 1MUXA 1NCXA 1QLSA 1WDCC 4ICBA 4YI9A 1OSAA 3TDZA 1WDCB 1ZUZA 3LLEA 1H4BA 2K61A 2L4IA 1HT9A 3FWCA 5HLVA 2HETA 1SCMC 2LANA 4GGFA 1BJFA 3CR4X 1SCMB 3SG6A 3NXAA 3CS1A 1NCZA 2L2EA 2BCAA 3EK4A 4M2QA 1W7JB 1A2XA 4F0ZB 4MSPA 4OCIA 1DJGA 1NPQA 2K7DA 2M49B 4AOMA 1XK4A 1IRJA 1QV1A 2O5GA 2Q91A 3FIAA 2PRUA 2JZIA 4I5JA 1J7PA 2G2BA 3DVEA 1JC2A 2M7LA 4D1EA 2LLUA 2CXJA 1YURA 1ODBA 1S6CA 2MLEC 4PDZA 2OTGC 2OTGB 3SG4A 1YX8A 4PE4A 2JULA 2ZNEA 1TOPA 2L4HA 2M97A 2KGRA 1CB1A 1PVBA 2F3YA 4A4CA 3DVMA 2LVJA 5ER5A 3WHTB 1J7OA 1UHKA 3O6BA 2KAYA 1F54A 4GBAA 1K2HA 4C0LA 4YGBB 1CDLA 3JVTC 3JVTB 2LVVA 3O2PA 4HRHA 1OOJA 3E3RA 2F33A 2LCPA 1YVHA 1M39A 4PALA 1BU3A 2JPTA 1AVSA 1TNXA 1QLKA 2LM5A 3NSLA 2KQ6A 2LC5A 2SASA 1K96A 2DOQA 1JFKA 2KBMA 1CNPA 4QJ5B 1C07A 1SRAA 1DTLA 3HX4A 1DJXA 2D8NA 4GFTA 1KSOA 1QV0A 3BUNB 3PALA 1A29A 1IWQA 2TN4A 4JPZB 3OX6A 1S6JA 2NXQA 3F45A 4N1FA 5PALA 1U5IB 2BKIB 4I5NB 5HKWA 1B7TZ 3IQOA 1OMRA 3EKHA 1LKJA 4JQ0D 2I7AA 3KHEA 3D0YA 4MZJA 4CLNA 4XJKB 1V1GA 2LV7A 5IBWA 1XFXO 2LVIA 3VGOA 1MHOA 1PVAA 4WQ3A 4XYNA 2KSPA 2H61C 1XFWO 5J3XA 2M3WA 1YVLA 5B8IB 1XFUO 1TNWA 1LINA 1NX3A 3C1VA 3EK8A 1M46A 1KCYA 2V53A 4GNKB 3CLNA 1ZOTB 2JXLA 4U8DA 2CBLA 3SG2A 2GGMA 2MAZA 1IQ3A 1DF0B 1K94A 1KK7Z 2JTZA 1S6IA 1NSHA 1RECA 2I94A 2K8MB 3QRXA 4GGFC 1FI5A 2JC2A 2WOSA 3ZNIA 2RGIA 2COLB 5BPJA 2AMIA 1RTP1 2ZFDA 1LA3A 2WC8A 2I2RE 3BUXB 3BYAA 1DJZA 3CR2A 2BCBA 4N5XA 3IF7A 1DJHA 1XK4C 1NYAA 3I5IC 3I5IB 2HF5A 2Q4UA 3TS5C 4GGNA 3TS5B 2Y1NA 3PFVA 2KAVA 1J1DA 1CMGA 4BY4A 1GGZA 1OQPA 1QX5B 1UHIA 1EG4A 2SCPA 1Y1AA 1TRFA 3PN7C 1IKUA 3PN7B 3OHMB 4PCWA 1R2UA 1JUOA 2M8UA 4DUQA 2HPSA 2NLNA 2CTNA 5DKQA 2QPTA 3HCMA 3AAJA 1MR8A 3BQ3A 3CR5X 4PHKA 1SMGA 2WORA 3SG7A 1XFZO 2L50A 3M0WA 1DVIA 4MBEA 5CSIA 4MRXA 1JSAA 1Q80A 2JOJA 4MRYA 3DVKA 1LVCD 1IG5A 4IL1A 1S1EA 1CLLA 3ICBA 5D7FA 3RM1A 1TIZA 2ZRSA 3VRNA 2LE9B 3GK4X 1DMOA 1S36A 1AUIB 1QJTA 3WXAA 1QVIY 2IS9A 5ER4X 2HQ8A 2QACA 1F8HA 1A75A 1AK8A 4MEWA 2LLTA 1F70A 3GK1A 5AEQA 1RFJA 2LAPA 1Y0VH 2OPOA 3AKAA 5CPVA 1SNLA 1PK0D 2EHBA 1AJ4A 5I8NA 4OR9B 4FQOA 1SCVA 5AANA 2VRGA 1KSMA 1MWNA 1TCOB 2KFHA 5K89A 4CPVA 1KQVA 1SBJA 4DRWA 1BR4B 1QTXA 3CWGA 2JQ6A 1B8CA 1NUBA 4N1GA 5KSZA 1CM1A 1NX1A 3I5GC 2E6WA 4CIDA 2FCEA 3I5GB 1PALA 3BOWB 1Y6WA 4MLWA 1EJ3A 3OB1B 1SK6D 2JT0A 2KI4C 1SW8A 2K2FA 2KI4B 3AAKA 1AP4A 4A4BA 1G33A 3GOFA 1V1FA 4NDBA 4YGCB 1BODA 3OB2B 2ZNDA 3EK7A 3CTNA 4YGDB 2G9BA 2ISDA 1QX2A 4ORBB 1ALWA 3SJSA 4YRUA 3VROA 1R6PA 1OMDA 5I2OA 1JF0A 1FBVA 3D0YB 5TNCA 1W7IB 2LNKA 2JNFA 3TZ1A 4OV2A 3VRPA 2FJUB 2M1KB 1IH0A 1NX2A 1YUUA 1BR1B 1N2DA 1MXLC 1SL8A 1OZOA 4HRGA 4CFQA 1DGUA 2KFGA 1F4OA 4R1EA 2LLSA 2BL0C 1JFJA 3O78A 2BL0B 4DIRA 1B4CA 1S26D 1Y1UA 3WHUB 4P5OE 1WY9A 2F3ZA 2FCDA 2EC6B 2L51A 1CDMA 3KF9A 5I2QA 1MF8B 1CFFA 3VRQA 1XO5A 3PATA 1H8BA 1NWDA 1CFCA 1ZMZA 1UWOA 1KFUL 2BE6A 1K9KA 1KFXL 2NCOA 2PMYA 5G08A 1TTXA 1RWYA 4ZCUA 3ZWHA 4PHMA 1WRLA 4M2OA 2L0PA 2MHHA 3KO0A 3A8RA 1QS7A 1J55A 1JWDA 4BY5A 1S5GZ 5D69A 1TN4A 1UP5A 1GJYA 2LMVA 5HKYA 5JOLA 3TUYC 3MSEB 3TUYB 1WRZA 3VRRA 4GAOA 1IQ5A 4HREE 2BBNA 3SG5A 2MLFC 2JRFA 1K9UA 1KQMC 1EXRA 1NX0A 2FOTA 1KQMB 2LP2A 1JBAA 1PSBA 2M0RA 1OMVA 1SL9A 2P6BB 3OP0A 3O4YA 1CDPA 1YR5A 2PALA 1PULA 1AHRA 4PHJA 2KDHA 4E68A 2ZN9A 3RLZA 1B7TY 2M9GA 4ORAB 1SYMA 1PRWA 2F2PA 4NDCA 1K8UA 2O60A 1CTRA 3TDUA 1KWOC 5KTYA 1NP8A 4L9MA 1A75B 1KWOB 2KYFA 3A4UB 1ZACA 2JTTA 1B8LA 1YRUB 2WCBA 2LUCA 1UHHA 1KK8C 3WNXB 1U5IA 1KK8B 2JU0A 3SG3A 2K7BA 1SL7A 4QJ3B 4USLA 1DJIA 2LUXA 3DF0A 1S5GY 4AQIA 4JWQA 1J7RA 1YUTA 1QASA 2ZKMX 4XJKA 3NSKA 2Y4QA 4YGEB 1KFUS 1KFXS 2GV5A 2H61A 4MZLA 1KK7Y 1CLBA 1L7ZA 4PE1A 1JF2A 1WLMA 1YX7A 3NSOA 4C0JA 2BBMA 2K2AA 2HQWA 2LMUA 2JXCA 1OE9B 2KYCA 2M1UA 3TDIA 3KEVA 4GPLB 2BECA 2WNDA 1QX7A 1LA0A 1SY9A 3EVVA 2BCXA 1DF0A 4ZCVA 2MBXA 4Q04A 1IJ6A 2B1UA 4NQGA 1DJYA 1CKKA 1EG3A 2KI6D 4QJ4B 2JT3A 3PLFB 2CT9A 1FF1A 1UUSA 1XYDA 3LK0A 5HYDA 4DS7A 2Y1MA 1A4PA 2BKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLZ A;  2MJW B;  3BUW B;  1UHN A;  1BF5 A;  1SKT A;  1XFY O;  3EKJ A;  3AKB A;  4WRI A;  3H4S E;  3PM8 A;  2WCF A;  1K93 D;  3BUO B;  1G4Y R;  5KU1 A;  1QXP A;  5CSJ A;  1BOC A;  1QIW A;  1UHJ A;  2MRD A;  1EH2 A;  1XFV O;  1IGV A;  2K0J A;  4I5K A;  3SIA A;  1RK9 A;  3SIB A;  5AER A;  1HQV A;  2OS8 C;  4DCK A;  4ETO A;  2OS8 B;  2GGZ A;  2LHL A;  2LVK A;  1N0Y A;  1CFP A;  1GGW A;  3FS7 A;  4PHN A;  1TNQ A;  1YRT B;  3CZT X;  4HSZ A;  1DJW A;  2KNE A;  5FYX A;  1CM4 A;  2A4J A;  3IQQ A;  2KGB C;  1SR6 C;  1NCY A;  1IJ5 A;  1DGV A;  1SR6 B;  1F71 A;  3BUM B;  2AAO A;  1LXF C;  2EC6 C;  1ZFS A;  2EGD A;  2M29 A;  3BXK A;  2KOT A;  1D1O A;  1S3P A;  3EVR A;  3FWB A;  3K21 A;  4FTG A;  1FI6 A;  4YGA A;  1G8I A;  2F8P A;  2KAX A;  1B1G A;  3LK1 A;  3LCP C;  1QIV A;  1M31 A;  2KBI A;  3D10 A;  1C7V A;  1FPW A;  1B47 A;  2PVB A;  1NIW A;  5HKZ A;  1YUS A;  2CNP A;  2LMT A;  4CFR A;  3BOW A;  2KQY A;  1CFD A;  1J1E A;  3LL8 B;  4GUK A;  1L2O C;  1PSR A;  1XA5 A;  1L2O B;  3PSR A;  2JT8 A;  2JNX A;  3NSI A;  4M2P A;  4PE7 A;  1CDN A;  2BE4 A;  1CMF A;  3I5H C;  1DT7 B;  1CLM A;  3I5H B;  1N65 A;  1VRK A;  4OVN F;  1K9P A;  3JTD C;  1F4Q A;  3I5F C;  4MVF A;  5JJG A;  3JTD B;  2NCP A;  3I5F B;  5DKR A;  2E30 A;  1J7Q A;  2PAS A;  1RRO A;  2L98 A;  2KFF A;  5DKN A;  3DF0 B;  2F2O A;  1AJ5 A;  3DVJ A;  1FW4 A;  3KPX A;  2KHN A;  5GQQ C;  4OKH A;  2AUC A;  1TCF A;  2ZN8 A;  4MZK A;  4YBH B;  1K95 A;  1ALV A;  2I18 A;  3EVU A;  4P2Y B;  1WRK A;  1K90 D;  4C0K A;  5AFP A;  1B8R A;  5CSN A;  3DD4 A;  1F55 A;  2R2I A;  2K7C A;  4YI8 A;  2KI6 C;  1M45 A;  2Y5I A;  2LHI A;  1TNP A;  4PE0 A;  5F6T A;  2ZRT A;  4TNC A;  3GK2 A;  2CCM A;  2K7O A;  1C7W A;  4ORC B;  2H2K A;  1BG1 A;  1BMO A;  2MA2 A;  3CGA A;  4MN0 A;  1GQM A;  1EL4 A;  1XVJ A;  1X02 A;  2M7N A;  1YTZ C;  1UUR A;  3OX5 A;  1E8A A;  2LP3 A;  2NZ0 A;  1QVI Z;  5I2L A;  1Y1X A;  1MXE A;  4AQJ A;  5CSF A;  2WCE A;  1QAT A;  1B9A A;  1SPY A;  5AXI A;  4NDD A;  1RJV A;  4WQ2 A;  1OZS A;  4UPG A;  2PSR A;  1M63 B;  2JWW A;  1A03 A;  4I5L B;  5HLO A;  1BLQ A;  1BT6 A;  2L5X B;  1MQ1 A;  1MUX A;  1NCX A;  1QLS A;  1WDC C;  4ICB A;  4YI9 A;  1OSA A;  3TDZ A;  1WDC B;  1ZUZ A;  3LLE A;  1H4B A;  2K61 A;  2L4I A;  1HT9 A;  3FWC A;  5HLV A;  2HET A;  1SCM C;  2LAN A;  4GGF A;  1BJF A;  3CR4 X;  1SCM B;  3SG6 A;  3NXA A;  3CS1 A;  1NCZ A;  2L2E A;  2BCA A;  3EK4 A;  4M2Q A;  1W7J B;  1A2X A;  4F0Z B;  4MSP A;  4OCI A;  1DJG A;  1NPQ A;  2K7D A;  2M49 B;  4AOM A;  1XK4 A;  1IRJ A;  1QV1 A;  2O5G A;  2Q91 A;  3FIA A;  2PRU A;  2JZI A;  4I5J A;  1J7P A;  2G2B A;  3DVE A;  1JC2 A;  2M7L A;  4D1E A;  2LLU A;  2CXJ A;  1YUR A;  1ODB A;  1S6C A;  2MLE C;  4PDZ A;  2OTG C;  2OTG B;  3SG4 A;  1YX8 A;  4PE4 A;  2JUL A;  2ZNE A;  1TOP A;  2L4H A;  2M97 A;  2KGR A;  1CB1 A;  1PVB A;  2F3Y A;  4A4C A;  3DVM A;  2LVJ A;  5ER5 A;  3WHT B;  1J7O A;  1UHK A;  3O6B A;  2KAY A;  1F54 A;  4GBA A;  1K2H A;  4C0L A;  4YGB B;  1CDL A;  3JVT C;  3JVT B;  2LVV A;  3O2P A;  4HRH A;  1OOJ A;  3E3R A;  2F33 A;  2LCP A;  1YVH A;  1M39 A;  4PAL A;  1BU3 A;  2JPT A;  1AVS A;  1TNX A;  1QLK A;  2LM5 A;  3NSL A;  2KQ6 A;  2LC5 A;  2SAS A;  1K96 A;  2DOQ A;  1JFK A;  2KBM A;  1CNP A;  4QJ5 B;  1C07 A;  1SRA A;  1DTL A;  3HX4 A;  1DJX A;  2D8N A;  4GFT A;  1KSO A;  1QV0 A;  3BUN B;  3PAL A;  1A29 A;  1IWQ A;  2TN4 A;  4JPZ B;  3OX6 A;  1S6J A;  2NXQ A;  3F45 A;  4N1F A;  5PAL A;  1U5I B;  2BKI B;  4I5N B;  5HKW A;  1B7T Z;  3IQO A;  1OMR A;  3EKH A;  1LKJ A;  4JQ0 D;  2I7A A;  3KHE A;  3D0Y A;  4MZJ A;  4CLN A;  4XJK B;  1V1G A;  2LV7 A;  5IBW A;  1XFX O;  2LVI A;  3VGO A;  1MHO A;  1PVA A;  4WQ3 A;  4XYN A;  2KSP A;  2H61 C;  1XFW O;  5J3X A;  2M3W A;  1YVL A;  5B8I B;  1XFU O;  1TNW A;  1LIN A;  1NX3 A;  3C1V A;  3EK8 A;  1M46 A;  1KCY A;  2V53 A;  4GNK B;  3CLN A;  1ZOT B;  2JXL A;  4U8D A;  2CBL A;  3SG2 A;  2GGM A;  2MAZ A;  1IQ3 A;  1DF0 B;  1K94 A;  1KK7 Z;  2JTZ A;  1S6I A;  1NSH A;  1REC A;  2I94 A;  2K8M B;  3QRX A;  4GGF C;  1FI5 A;  2JC2 A;  2WOS A;  3ZNI A;  2RGI A;  2COL B;  5BPJ A;  2AMI A;  1RTP 1;  2ZFD A;  1LA3 A;  2WC8 A;  2I2R E;  3BUX B;  3BYA A;  1DJZ A;  3CR2 A;  2BCB A;  4N5X A;  3IF7 A;  1DJH A;  1XK4 C;  1NYA A;  3I5I C;  3I5I B;  2HF5 A;  2Q4U A;  3TS5 C;  4GGN A;  3TS5 B;  2Y1N A;  3PFV A;  2KAV A;  1J1D A;  1CMG A;  4BY4 A;  1GGZ A;  1OQP A;  1QX5 B;  1UHI A;  1EG4 A;  2SCP A;  1Y1A A;  1TRF A;  3PN7 C;  1IKU A;  3PN7 B;  3OHM B;  4PCW A;  1R2U A;  1JUO A;  2M8U A;  4DUQ A;  2HPS A;  2NLN A;  2CTN A;  5DKQ A;  2QPT A;  3HCM A;  3AAJ A;  1MR8 A;  3BQ3 A;  3CR5 X;  4PHK A;  1SMG A;  2WOR A;  3SG7 A;  1XFZ O;  2L50 A;  3M0W A;  1DVI A;  4MBE A;  5CSI A;  4MRX A;  1JSA A;  1Q80 A;  2JOJ A;  4MRY A;  3DVK A;  1LVC D;  1IG5 A;  4IL1 A;  1S1E A;  1CLL A;  3ICB A;  5D7F A;  3RM1 A;  1TIZ A;  2ZRS A;  3VRN A;  2LE9 B;  3GK4 X;  1DMO A;  1S36 A;  1AUI B;  1QJT A;  3WXA A;  1QVI Y;  2IS9 A;  5ER4 X;  2HQ8 A;  2QAC A;  1F8H A;  1A75 A;  1AK8 A;  4MEW A;  2LLT A;  1F70 A;  3GK1 A;  5AEQ A;  1RFJ A;  2LAP A;  1Y0V H;  2OPO A;  3AKA A;  5CPV A;  1SNL A;  1PK0 D;  2EHB A;  1AJ4 A;  5I8N A;  4OR9 B;  4FQO A;  1SCV A;  5AAN A;  2VRG A;  1KSM A;  1MWN A;  1TCO B;  2KFH A;  5K89 A;  4CPV A;  1KQV A;  1SBJ A;  4DRW A;  1BR4 B;  1QTX A;  3CWG A;  2JQ6 A;  1B8C A;  1NUB A;  4N1G A;  5KSZ A;  1CM1 A;  1NX1 A;  3I5G C;  2E6W A;  4CID A;  2FCE A;  3I5G B;  1PAL A;  3BOW B;  1Y6W A;  4MLW A;  1EJ3 A;  3OB1 B;  1SK6 D;  2JT0 A;  2KI4 C;  1SW8 A;  2K2F A;  2KI4 B;  3AAK A;  1AP4 A;  4A4B A;  1G33 A;  3GOF A;  1V1F A;  4NDB A;  4YGC B;  1BOD A;  3OB2 B;  2ZND A;  3EK7 A;  3CTN A;  4YGD B;  2G9B A;  2ISD A;  1QX2 A;  4ORB B;  1ALW A;  3SJS A;  4YRU A;  3VRO A;  1R6P A;  1OMD A;  5I2O A;  1JF0 A;  1FBV A;  3D0Y B;  5TNC A;  1W7I B;  2LNK A;  2JNF A;  3TZ1 A;  4OV2 A;  3VRP A;  2FJU B;  2M1K B;  1IH0 A;  1NX2 A;  1YUU A;  1BR1 B;  1N2D A;  1MXL C;  1SL8 A;  1OZO A;  4HRG A;  4CFQ A;  1DGU A;  2KFG A;  1F4O A;  4R1E A;  2LLS A;  2BL0 C;  1JFJ A;  3O78 A;  2BL0 B;  4DIR A;  1B4C A;  1S26 D;  1Y1U A;  3WHU B;  4P5O E;  1WY9 A;  2F3Z A;  2FCD A;  2EC6 B;  2L51 A;  1CDM A;  3KF9 A;  5I2Q A;  1MF8 B;  1CFF A;  3VRQ A;  1XO5 A;  3PAT A;  1H8B A;  1NWD A;  1CFC A;  1ZMZ A;  1UWO A;  1KFU L;  2BE6 A;  1K9K A;  1KFX L;  2NCO A;  2PMY A;  5G08 A;  1TTX A;  1RWY A;  4ZCU A;  3ZWH A;  4PHM A;  1WRL A;  4M2O A;  2L0P A;  2MHH A;  3KO0 A;  3A8R A;  1QS7 A;  1J55 A;  1JWD A;  4BY5 A;  1S5G Z;  5D69 A;  1TN4 A;  1UP5 A;  1GJY A;  2LMV A;  5HKY A;  5JOL A;  3TUY C;  3MSE B;  3TUY B;  1WRZ A;  3VRR A;  4GAO A;  1IQ5 A;  4HRE E;  2BBN A;  3SG5 A;  2MLF C;  2JRF A;  1K9U A;  1KQM C;  1EXR A;  1NX0 A;  2FOT A;  1KQM B;  2LP2 A;  1JBA A;  1PSB A;  2M0R A;  1OMV A;  1SL9 A;  2P6B B;  3OP0 A;  3O4Y A;  1CDP A;  1YR5 A;  2PAL A;  1PUL A;  1AHR A;  4PHJ A;  2KDH A;  4E68 A;  2ZN9 A;  3RLZ A;  1B7T Y;  2M9G A;  4ORA B;  1SYM A;  1PRW A;  2F2P A;  4NDC A;  1K8U A;  2O60 A;  1CTR A;  3TDU A;  1KWO C;  5KTY A;  1NP8 A;  4L9M A;  1A75 B;  1KWO B;  2KYF A;  3A4U B;  1ZAC A;  2JTT A;  1B8L A;  1YRU B;  2WCB A;  2LUC A;  1UHH A;  1KK8 C;  3WNX B;  1U5I A;  1KK8 B;  2JU0 A;  3SG3 A;  2K7B A;  1SL7 A;  4QJ3 B;  4USL A;  1DJI A;  2LUX A;  3DF0 A;  1S5G Y;  4AQI A;  4JWQ A;  1J7R A;  1YUT A;  1QAS A;  2ZKM X;  4XJK A;  3NSK A;  2Y4Q A;  4YGE B;  1KFU S;  1KFX S;  2GV5 A;  2H61 A;  4MZL A;  1KK7 Y;  1CLB A;  1L7Z A;  4PE1 A;  1JF2 A;  1WLM A;  1YX7 A;  3NSO A;  4C0J A;  2BBM A;  2K2A A;  2HQW A;  2LMU A;  2JXC A;  1OE9 B;  2KYC A;  2M1U A;  3TDI A;  3KEV A;  4GPL B;  2BEC A;  2WND A;  1QX7 A;  1LA0 A;  1SY9 A;  3EVV A;  2BCX A;  1DF0 A;  4ZCV A;  2MBX A;  4Q04 A;  1IJ6 A;  2B1U A;  4NQG A;  1DJY A;  1CKK A;  1EG3 A;  2KI6 D;  4QJ4 B;  2JT3 A;  3PLF B;  2CT9 A;  1FF1 A;  1UUS A;  1XYD A;  3LK0 A;  5HYD A;  4DS7 A;  2Y1M A;  1A4P A;  2BKH B; 
#chains in the Genus database with same CATH topology
 1WLZ A;  2MJW B;  3BUW B;  1UHN A;  1BF5 A;  1SKT A;  1XFY O;  3EKJ A;  3AKB A;  2QEH A;  4WRI A;  3H4S E;  3PM8 A;  2WC5 A;  1K93 D;  2WCF A;  3BUO B;  1G4Y R;  3DXL A;  5KU1 A;  1QXP A;  5CSJ A;  1BOC A;  1QIW A;  1UHJ A;  1TUJ A;  2MRD A;  1EH2 A;  3FE8 A;  1XFV O;  1IGV A;  2K0J A;  4I5K A;  3SIA A;  1RK9 A;  3SIB A;  3N7H A;  5AER A;  1HQV A;  2OS8 C;  4DCK A;  4ETO A;  2OS8 B;  2PYQ A;  2GGZ A;  2LHL A;  2L2C A;  2LVK A;  1N0Y A;  1CFP A;  1GGW A;  3FS7 A;  3BFB A;  4PHN A;  1TNQ A;  1YRT B;  3CZT X;  4HSZ A;  3EG5 B;  1DJW A;  3R1O A;  2KNE A;  5FYX A;  1CM4 A;  2A4J A;  3IQQ A;  2KGB C;  1SR6 C;  1NCY A;  1IJ5 A;  1DGV A;  1SR6 B;  1F71 A;  3BUM B;  2AAO A;  1LXF C;  2EC6 C;  1ZFS A;  2EGD A;  2M29 A;  3BXK A;  2KOT A;  1D1O A;  1S3P A;  3BFH A;  3EVR A;  3FWB A;  3K21 A;  4FTG A;  1FI6 A;  4YGA A;  1G8I A;  2F8P A;  2KAX A;  1B1G A;  3LK1 A;  3LCP C;  1QIV A;  1M31 A;  2KBI A;  3D10 A;  4IJ7 A;  5FI2 A;  1B47 A;  2PVB A;  1NIW A;  1C7V A;  1FPW A;  3O4X A;  5HKZ A;  1YUS A;  2CNP A;  1OOH A;  2LMT A;  4CFR A;  3BOW A;  2KQY A;  1CFD A;  1J1E A;  3LL8 B;  4GUK A;  1L2O C;  1TUZ A;  1PSR A;  1XA5 A;  1L2O B;  3PSR A;  2JT8 A;  2JNX A;  3NSI A;  4M2P A;  4PE7 A;  1CDN A;  2BE4 A;  1CMF A;  3I5H C;  1DT7 B;  1CLM A;  2KLE A;  3I5H B;  1N65 A;  1VRK A;  3R1P A;  1K9P A;  4OVN F;  3JTD C;  1F4Q A;  3BJH A;  3I5F C;  3L4A A;  3JTD B;  2NCP A;  3I5F B;  4MVF A;  5DKR A;  5JJG A;  2E30 A;  3NHI A;  1J7Q A;  2PAS A;  1RRO A;  2L98 A;  2KFF A;  4INW A;  3DF0 B;  5DKN A;  2F2O A;  1AJ5 A;  3DVJ A;  1FW4 A;  3KPX A;  2KHN A;  5GQQ C;  4OKH A;  2AUC A;  1TCF A;  2ZN8 A;  4MZK A;  4YBH B;  1K95 A;  1ALV A;  2I18 A;  3EVU A;  4P2Y B;  1WRK A;  1K90 D;  4C0K A;  5AFP A;  1B8R A;  5CSN A;  3DD4 A;  1F55 A;  2R2I A;  2K7C A;  4YI8 A;  2KI6 C;  1M45 A;  2Y5I A;  3IVT A;  1TWO A;  2LHI A;  1TNP A;  4PE0 A;  5F6T A;  2ZRT A;  4TNC A;  3GK2 A;  2CCM A;  2K7O A;  1C7W A;  2KPH A;  4ORC B;  2H2K A;  1BG1 A;  1BMO A;  4JD9 A;  1OW4 A;  2MA2 A;  3OGN A;  3CGA A;  4MN0 A;  1GQM A;  1EL4 A;  1XVJ A;  3SS4 A;  1X02 A;  2M7N A;  1YTZ C;  1UUR A;  3OX5 A;  1E8A A;  2LP3 A;  2NZ0 A;  1QVI Z;  5I2L A;  1Y1X A;  1MXE A;  3QME A;  4AQJ A;  5CSF A;  2WCE A;  2FJY A;  1QAT A;  3B87 A;  1B9A A;  1SPY A;  2QDI A;  5AXI A;  4NDD A;  1RJV A;  4WQ2 A;  1OZS A;  4UPG A;  2PSR A;  2QEO A;  1M63 B;  2JWW A;  1A03 A;  4I5L B;  5HLO A;  1BLQ A;  1BT6 A;  2L5X B;  1MQ1 A;  1MUX A;  1NCX A;  1QLS A;  1WDC C;  2ERB A;  4ICB A;  1OSA A;  3TDZ A;  1WDC B;  1ZUZ A;  3LLE A;  1H4B A;  2K61 A;  3K1E A;  2L4I A;  1HT9 A;  3FWC A;  5HLV A;  2YGU A;  2HET A;  1SCM C;  2LAN A;  4GGF A;  1BJF A;  3CR4 X;  1SCM B;  3SG6 A;  3NXA A;  3CS1 A;  1DEK A;  1NCZ A;  2L2E A;  2BCA A;  3EK4 A;  4M2Q A;  1W7J B;  1A2X A;  4F0Z B;  4MSP A;  4OCI A;  1DJG A;  1NPQ A;  2JPO A;  2K7D A;  2M49 B;  4AOM A;  1XK4 A;  3DZT A;  1IRJ A;  1QV1 A;  2O5G A;  2Q91 A;  3FIA A;  2PRU A;  3FE9 A;  2JZI A;  4I5J A;  4OZD A;  1J7P A;  2G2B A;  3DVE A;  1JC2 A;  2P70 A;  2M7L A;  3B6X A;  4D1E A;  2LLU A;  2CXJ A;  1YUR A;  1ODB A;  1S6C A;  2MLE C;  4PDZ A;  2OTG C;  1SSE B;  2OTG B;  3Q8I A;  5I94 A;  3L47 A;  3D75 A;  3SG4 A;  3VB1 A;  2QEV A;  1YX8 A;  4PE4 A;  2JUL A;  2ZNE A;  1TOP A;  2L4H A;  2M97 A;  3BFA A;  2KGR A;  1CB1 A;  1PVB A;  2F3Y A;  3S0A A;  4A4C A;  3DVM A;  2LVJ A;  5ER5 A;  3WHT B;  1J7O A;  1UHK A;  3O6B A;  2KAY A;  1F54 A;  4GBA A;  1K2H A;  3B86 A;  4YGB B;  1OOI X;  4C0L A;  1CDL A;  3JVT C;  3JVT B;  2LVV A;  4FQT A;  3O2P A;  4HRH A;  1OOJ A;  3E3R A;  2F33 A;  5DIC A;  2LCP A;  1YVH A;  1M39 A;  1DC1 A;  4PAL A;  1W9Z A;  2L5Y A;  4YI9 A;  5HL1 A;  1BU3 A;  2JPT A;  1AVS A;  1TNX A;  1QLK A;  2LM5 A;  3NSL A;  2KQ6 A;  2LC5 A;  2SAS A;  1K96 A;  3SS5 A;  2DOQ A;  1JFK A;  2KBM A;  1CNP A;  4QJ5 B;  1C07 A;  1SRA A;  1DTL A;  3HX4 A;  1DJX A;  2D8N A;  4GFT A;  1KSO A;  1QV0 A;  3BUN B;  3PAL A;  1A29 A;  1IWQ A;  1XFR A;  2TN4 A;  3RZS A;  4JPZ B;  2WCM A;  3OX6 A;  1S6J A;  2NXQ A;  3F45 A;  3OBV A;  4N1F A;  5PAL A;  3S0D A;  1U5I B;  2BKI B;  4I5N B;  5HKW A;  1B7T Z;  3IQO A;  1OMR A;  3EKH A;  3PJI A;  1LKJ A;  4JQ0 D;  2GTE A;  2I7A A;  2QEB A;  3KHE A;  3D0Y A;  4MZJ A;  4CLN A;  4XJK B;  1V1G A;  2LV7 A;  3SS3 A;  5IBW A;  1XFX O;  2LVI A;  3VGO A;  1MHO A;  1PVA A;  4WQ3 A;  4XYN A;  2KSP A;  2H61 C;  1XFW O;  2WCK A;  5J3X A;  1Z2C B;  2M3W A;  1YVL A;  5B8I B;  1XFU O;  1TNW A;  1LIN A;  1NX3 A;  3C1V A;  3EK8 A;  1M46 A;  1KCY A;  2V53 A;  4GNK B;  3CLN A;  1ZOT B;  2JXL A;  4U8D A;  2CBL A;  1OOG A;  3SG2 A;  2GGM A;  2MAZ A;  1IQ3 A;  1DF0 B;  1K94 A;  1KK7 Z;  3CZ0 A;  2JTZ A;  1S6I A;  1NSH A;  1REC A;  2I94 A;  2K8M B;  3QRX A;  4GGF C;  4INX A;  1FI5 A;  2JC2 A;  2WOS A;  3ZNI A;  2RGI A;  2COL B;  5BPJ A;  2AMI A;  1RTP 1;  2WCH A;  3L4L A;  2ZFD A;  1LA3 A;  2WC8 A;  2I2R E;  3BUX B;  3BYA A;  1DJZ A;  3CR2 A;  2BCB A;  1IIO A;  4N5X A;  4F7F A;  3IF7 A;  1DJH A;  1XK4 C;  1NYA A;  3I5I C;  3I5I B;  2HF5 A;  2Q4U A;  3TS5 C;  4GGN A;  3S0F A;  3TS5 B;  2Y1N A;  3PFV A;  2KAV A;  1J1D A;  1CMG A;  4BY4 A;  1GGZ A;  1OQP A;  3CZ2 A;  1QX5 B;  1UHI A;  1EG4 A;  2SCP A;  1Y1A A;  1TRF A;  3PN7 C;  1IKU A;  3PN7 B;  3OHM B;  4PCW A;  1R2U A;  1JUO A;  2M8U A;  4DUQ A;  2HPS A;  2NLN A;  2WCL A;  2CTN A;  5DKQ A;  2QPT A;  3HCM A;  1DQE A;  1MR8 A;  3AAJ A;  3BQ3 A;  3CR5 X;  1SMG A;  4PHK A;  2WOR A;  3SG7 A;  1XFZ O;  5FI7 A;  2L50 A;  3M0W A;  1DVI A;  4MBE A;  5CSI A;  1OOF A;  4MRX A;  1JSA A;  3D78 A;  1Q80 A;  3R72 A;  2JOJ A;  4MRY A;  3D76 A;  3DVK A;  1LVC D;  1IG5 A;  4IL1 A;  1S1E A;  1CLL A;  3ICB A;  5D7F A;  3RM1 A;  1TIZ A;  2ZRS A;  3VRN A;  2LE9 B;  3GK4 X;  1DMO A;  1S36 A;  1AUI B;  1QJT A;  3WXA A;  1QVI Y;  2IS9 A;  5ER4 X;  2HQ8 A;  2QAC A;  1LS8 A;  1A75 A;  1AK8 A;  1F8H A;  4MEW A;  2LLT A;  1F70 A;  3GK1 A;  5AEQ A;  1RFJ A;  2LAP A;  1Y0V H;  2OPO A;  3AKA A;  5CPV A;  1SNL A;  1PK0 D;  2EHB A;  1AJ4 A;  5I8N A;  4OR9 B;  4FQO A;  1SCV A;  5AAN A;  2VRG A;  1KSM A;  1MWN A;  1TCO B;  2KFH A;  5K89 A;  4CPV A;  1KQV A;  1SBJ A;  4DRW A;  1Z4H A;  4JKT A;  1BR4 B;  1QTX A;  3CWG A;  2JQ6 A;  1B8C A;  1NUB A;  4N1G A;  5KSZ A;  1CM1 A;  1NX1 A;  3I5G C;  2E6W A;  4CID A;  2FCE A;  3I5G B;  1PAL A;  3BOW B;  1Y6W A;  4MLW A;  1EJ3 A;  3OB1 B;  2WCJ A;  1SK6 D;  2JT0 A;  2KI4 C;  1SW8 A;  2K2F A;  2KI4 B;  3AAK A;  2P71 A;  3CAB A;  3S0G A;  4A4B A;  1AP4 A;  1G33 A;  3GOF A;  1V1F A;  4NDB A;  3UNW A;  4YGC B;  1BOD A;  3OB2 B;  2ZND A;  3EK7 A;  3CTN A;  4YGD B;  2G9B A;  2ISD A;  1QX2 A;  4ORB B;  1ALW A;  3SJS A;  4YRU A;  2KLD A;  1R6P A;  1OMD A;  3VRO A;  1JF0 A;  1FBV A;  3D0Y B;  5TNC A;  1W7I B;  2LNK A;  2JNF A;  3TZ1 A;  4OV2 A;  3VRP A;  2FJU B;  2M1K B;  3B7A A;  3D74 A;  1IH0 A;  1NX2 A;  1YUU A;  1BR1 B;  1N2D A;  1MXL C;  1SL8 A;  1OZO A;  4HRG A;  4CFQ A;  1DGU A;  2KFG A;  5D3O A;  1F4O A;  4R1E A;  3DYE A;  2LLS A;  2BL0 C;  4KYN A;  1JFJ A;  3O78 A;  2BL0 B;  4DIR A;  1B4C A;  1S26 D;  3UO9 A;  1Y1U A;  3WHU B;  4P5O E;  1GM0 A;  1WY9 A;  3D77 A;  2F3Z A;  2FCD A;  2EC6 B;  2L51 A;  2PQL A;  2WC6 A;  2BAP A;  1CDM A;  1QWV A;  3KF9 A;  3S0E A;  5I2Q A;  1MF8 B;  1CFF A;  3VRQ A;  1XO5 A;  3PAT A;  1H8B A;  1NWD A;  1C3Y A;  1CFC A;  1ZMZ A;  1UWO A;  1KFU L;  2BE6 A;  1K9K A;  1KFX L;  2NCO A;  2PMY A;  5G08 A;  1TTX A;  1RWY A;  4ZCU A;  3ZWH A;  4PHM A;  1WRL A;  4M2O A;  2L0P A;  2MHH A;  3KO0 A;  3A8R A;  1QS7 A;  1J55 A;  1JWD A;  4BY5 A;  1S5G Z;  5D69 A;  1TN4 A;  1UP5 A;  1GJY A;  2LMV A;  5HKY A;  5EL2 A;  5JOL A;  3TUY C;  3PM2 A;  3MSE B;  3TUY B;  5I2O A;  1WRZ A;  3VRR A;  1DEL A;  1IQ5 A;  4GAO A;  2BBN A;  4HRE E;  3SG5 A;  3V2L A;  2MLF C;  2JRF A;  1K9U A;  1KQM C;  1EXR A;  1NX0 A;  1T14 A;  1KQM B;  2FOT A;  2LP2 A;  1JBA A;  5FI6 A;  1PSB A;  1C3Z A;  2M0R A;  1OMV A;  1SL9 A;  2P6B B;  3OP0 A;  3O4Y A;  1CDP A;  1YR5 A;  2PAL A;  3CDN A;  2H8V A;  1PUL A;  1AHR A;  4PHJ A;  4PT1 A;  2KDH A;  4E68 A;  2ZN9 A;  3RLZ A;  1B7T Y;  2M9G A;  4ORA B;  1SYM A;  1PRW A;  2F2P A;  3FE6 A;  4NDC A;  1K8U A;  2O60 A;  1CTR A;  3TDU A;  1KWO C;  5KTY A;  1NP8 A;  4L9M A;  1A75 B;  1KWO B;  2KYF A;  3A4U B;  1ZAC A;  2JTT A;  1B8L A;  1YRU B;  2WCB A;  2LUC A;  3NHT A;  1UHH A;  1KK8 C;  2BNX A;  3WNX B;  1U5I A;  3R1V A;  1KK8 B;  3CYZ A;  2JU0 A;  3SG3 A;  3S0B A;  2K7B A;  1SL7 A;  4QJ3 B;  4USL A;  1DJI A;  2LUX A;  3DF0 A;  1S5G Y;  4AQI A;  1ORG A;  1J7R A;  1YUT A;  1QAS A;  2ZKM X;  3B88 A;  4JWQ A;  4XJK A;  3NSK A;  2Y4Q A;  4YGE B;  1KFU S;  1KFX S;  2GV5 A;  2H61 A;  4MZL A;  1KK7 Y;  1CLB A;  1L7Z A;  4PE1 A;  1JF2 A;  1WLM A;  1YX7 A;  3NSO A;  4C0J A;  2BBM A;  2K2A A;  2HQW A;  2LMU A;  3D73 A;  2JXC A;  1OE9 B;  2KYC A;  2M1U A;  3NGV A;  3KEV A;  3TDI A;  4GPL B;  2BEC A;  2WND A;  1QX7 A;  1LA0 A;  1SY9 A;  3EVV A;  2BCX A;  1DF0 A;  4ZCV A;  2MBX A;  4Q04 A;  1IJ6 A;  2B1U A;  4NQG A;  1DJY A;  1CKK A;  1P28 A;  1EG3 A;  2KI6 D;  3CZ1 A;  3DY9 A;  4QJ4 B;  2JT3 A;  3PLF B;  2CT9 A;  1FF1 A;  1UUS A;  1XYD A;  3LK0 A;  5HYD A;  4DS7 A;  2Y1M A;  1A4P A;  2BKH B;  2K60 A; 
#chains in the Genus database with same CATH homology
 1WLZ A;  2MJW B;  3BUW B;  1UHN A;  1BF5 A;  1SKT A;  1XFY O;  3EKJ A;  3AKB A;  4WRI A;  3H4S E;  3PM8 A;  2WCF A;  1K93 D;  3BUO B;  1G4Y R;  5KU1 A;  1QXP A;  5CSJ A;  1BOC A;  1QIW A;  1UHJ A;  2MRD A;  1EH2 A;  1XFV O;  1IGV A;  2K0J A;  4I5K A;  3SIA A;  1RK9 A;  3SIB A;  5AER A;  1HQV A;  2OS8 C;  4DCK A;  4ETO A;  2OS8 B;  2GGZ A;  2LHL A;  2LVK A;  1N0Y A;  1CFP A;  1GGW A;  3FS7 A;  4PHN A;  1TNQ A;  1YRT B;  3CZT X;  4HSZ A;  1DJW A;  2KNE A;  5FYX A;  1CM4 A;  2A4J A;  3IQQ A;  2KGB C;  1SR6 C;  1NCY A;  1IJ5 A;  1DGV A;  1SR6 B;  1F71 A;  3BUM B;  2AAO A;  1LXF C;  2EC6 C;  1ZFS A;  2EGD A;  2M29 A;  3BXK A;  2KOT A;  1D1O A;  1S3P A;  3EVR A;  3FWB A;  3K21 A;  4FTG A;  1FI6 A;  4YGA A;  1G8I A;  2F8P A;  2KAX A;  1B1G A;  3LK1 A;  3LCP C;  1QIV A;  1M31 A;  2KBI A;  3D10 A;  1C7V A;  1FPW A;  1B47 A;  2PVB A;  1NIW A;  5HKZ A;  1YUS A;  2CNP A;  2LMT A;  4CFR A;  3BOW A;  2KQY A;  1CFD A;  1J1E A;  3LL8 B;  4GUK A;  1L2O C;  1PSR A;  1XA5 A;  1L2O B;  3PSR A;  2JT8 A;  2JNX A;  3NSI A;  4M2P A;  4PE7 A;  1CDN A;  2BE4 A;  1CMF A;  3I5H C;  1DT7 B;  1CLM A;  3I5H B;  1N65 A;  1VRK A;  4OVN F;  1K9P A;  3JTD C;  1F4Q A;  3I5F C;  4MVF A;  5JJG A;  3JTD B;  2NCP A;  3I5F B;  5DKR A;  2E30 A;  1J7Q A;  2PAS A;  1RRO A;  2L98 A;  2KFF A;  5DKN A;  3DF0 B;  2F2O A;  1AJ5 A;  3DVJ A;  1FW4 A;  3KPX A;  2KHN A;  5GQQ C;  4OKH A;  2AUC A;  1TCF A;  2ZN8 A;  4MZK A;  4YBH B;  1K95 A;  1ALV A;  2I18 A;  3EVU A;  4P2Y B;  1WRK A;  1K90 D;  4C0K A;  5AFP A;  1B8R A;  5CSN A;  3DD4 A;  1F55 A;  2R2I A;  2K7C A;  4YI8 A;  2KI6 C;  1M45 A;  2Y5I A;  2LHI A;  1TNP A;  4PE0 A;  5F6T A;  2ZRT A;  4TNC A;  3GK2 A;  2CCM A;  2K7O A;  1C7W A;  4ORC B;  2H2K A;  1BG1 A;  1BMO A;  2MA2 A;  3CGA A;  4MN0 A;  1GQM A;  1EL4 A;  1XVJ A;  1X02 A;  2M7N A;  1YTZ C;  1UUR A;  3OX5 A;  1E8A A;  2LP3 A;  2NZ0 A;  1QVI Z;  5I2L A;  1Y1X A;  1MXE A;  4AQJ A;  5CSF A;  2WCE A;  1QAT A;  1B9A A;  1SPY A;  5AXI A;  4NDD A;  1RJV A;  4WQ2 A;  1OZS A;  4UPG A;  2PSR A;  1M63 B;  2JWW A;  1A03 A;  4I5L B;  5HLO A;  1BLQ A;  1BT6 A;  2L5X B;  1MQ1 A;  1MUX A;  1NCX A;  1QLS A;  1WDC C;  4ICB A;  4YI9 A;  1OSA A;  3TDZ A;  1WDC B;  1ZUZ A;  3LLE A;  1H4B A;  2K61 A;  2L4I A;  1HT9 A;  3FWC A;  5HLV A;  2HET A;  1SCM C;  2LAN A;  4GGF A;  1BJF A;  3CR4 X;  1SCM B;  3SG6 A;  3NXA A;  3CS1 A;  1NCZ A;  2L2E A;  2BCA A;  3EK4 A;  4M2Q A;  1W7J B;  1A2X A;  4F0Z B;  4MSP A;  4OCI A;  1DJG A;  1NPQ A;  2K7D A;  2M49 B;  4AOM A;  1XK4 A;  1IRJ A;  1QV1 A;  2O5G A;  2Q91 A;  3FIA A;  2PRU A;  2JZI A;  4I5J A;  1J7P A;  2G2B A;  3DVE A;  1JC2 A;  2M7L A;  4D1E A;  2LLU A;  2CXJ A;  1YUR A;  1ODB A;  1S6C A;  2MLE C;  4PDZ A;  2OTG C;  2OTG B;  3SG4 A;  1YX8 A;  4PE4 A;  2JUL A;  2ZNE A;  1TOP A;  2L4H A;  2M97 A;  2KGR A;  1CB1 A;  1PVB A;  2F3Y A;  4A4C A;  3DVM A;  2LVJ A;  5ER5 A;  3WHT B;  1J7O A;  1UHK A;  3O6B A;  2KAY A;  1F54 A;  4GBA A;  1K2H A;  4C0L A;  4YGB B;  1CDL A;  3JVT C;  3JVT B;  2LVV A;  3O2P A;  4HRH A;  1OOJ A;  3E3R A;  2F33 A;  2LCP A;  1YVH A;  1M39 A;  4PAL A;  1BU3 A;  2JPT A;  1AVS A;  1TNX A;  1QLK A;  2LM5 A;  3NSL A;  2KQ6 A;  2LC5 A;  2SAS A;  1K96 A;  2DOQ A;  1JFK A;  2KBM A;  1CNP A;  4QJ5 B;  1C07 A;  1SRA A;  1DTL A;  3HX4 A;  1DJX A;  2D8N A;  4GFT A;  1KSO A;  1QV0 A;  3BUN B;  3PAL A;  1A29 A;  1IWQ A;  2TN4 A;  4JPZ B;  3OX6 A;  1S6J A;  2NXQ A;  3F45 A;  4N1F A;  5PAL A;  1U5I B;  2BKI B;  4I5N B;  5HKW A;  1B7T Z;  3IQO A;  1OMR A;  3EKH A;  1LKJ A;  4JQ0 D;  2I7A A;  3KHE A;  3D0Y A;  4MZJ A;  4CLN A;  4XJK B;  1V1G A;  2LV7 A;  5IBW A;  1XFX O;  2LVI A;  3VGO A;  1MHO A;  1PVA A;  4WQ3 A;  4XYN A;  2KSP A;  2H61 C;  1XFW O;  5J3X A;  2M3W A;  1YVL A;  5B8I B;  1XFU O;  1TNW A;  1LIN A;  1NX3 A;  3C1V A;  3EK8 A;  1M46 A;  1KCY A;  2V53 A;  4GNK B;  3CLN A;  1ZOT B;  2JXL A;  4U8D A;  2CBL A;  3SG2 A;  2GGM A;  2MAZ A;  1IQ3 A;  1DF0 B;  1K94 A;  1KK7 Z;  2JTZ A;  1S6I A;  1NSH A;  1REC A;  2I94 A;  2K8M B;  3QRX A;  4GGF C;  1FI5 A;  2JC2 A;  2WOS A;  3ZNI A;  2RGI A;  2COL B;  5BPJ A;  2AMI A;  1RTP 1;  2ZFD A;  1LA3 A;  2WC8 A;  2I2R E;  3BUX B;  3BYA A;  1DJZ A;  3CR2 A;  2BCB A;  4N5X A;  3IF7 A;  1DJH A;  1XK4 C;  1NYA A;  3I5I C;  3I5I B;  2HF5 A;  2Q4U A;  3TS5 C;  4GGN A;  3TS5 B;  2Y1N A;  3PFV A;  2KAV A;  1J1D A;  1CMG A;  4BY4 A;  1GGZ A;  1OQP A;  1QX5 B;  1UHI A;  1EG4 A;  2SCP A;  1Y1A A;  1TRF A;  3PN7 C;  1IKU A;  3PN7 B;  3OHM B;  4PCW A;  1R2U A;  1JUO A;  2M8U A;  4DUQ A;  2HPS A;  2NLN A;  2CTN A;  5DKQ A;  2QPT A;  3HCM A;  3AAJ A;  1MR8 A;  3BQ3 A;  3CR5 X;  4PHK A;  1SMG A;  2WOR A;  3SG7 A;  1XFZ O;  2L50 A;  3M0W A;  1DVI A;  4MBE A;  5CSI A;  4MRX A;  1JSA A;  1Q80 A;  2JOJ A;  4MRY A;  3DVK A;  1LVC D;  1IG5 A;  4IL1 A;  1S1E A;  1CLL A;  3ICB A;  5D7F A;  3RM1 A;  1TIZ A;  2ZRS A;  3VRN A;  2LE9 B;  3GK4 X;  1DMO A;  1S36 A;  1AUI B;  1QJT A;  3WXA A;  1QVI Y;  2IS9 A;  5ER4 X;  2HQ8 A;  2QAC A;  1F8H A;  1A75 A;  1AK8 A;  4MEW A;  2LLT A;  1F70 A;  3GK1 A;  5AEQ A;  1RFJ A;  2LAP A;  1Y0V H;  2OPO A;  3AKA A;  5CPV A;  1SNL A;  1PK0 D;  2EHB A;  1AJ4 A;  5I8N A;  4OR9 B;  4FQO A;  1SCV A;  5AAN A;  2VRG A;  1KSM A;  1MWN A;  1TCO B;  2KFH A;  5K89 A;  4CPV A;  1KQV A;  1SBJ A;  4DRW A;  1BR4 B;  1QTX A;  3CWG A;  2JQ6 A;  1B8C A;  1NUB A;  4N1G A;  5KSZ A;  1CM1 A;  1NX1 A;  3I5G C;  2E6W A;  4CID A;  2FCE A;  3I5G B;  1PAL A;  3BOW B;  1Y6W A;  4MLW A;  1EJ3 A;  3OB1 B;  1SK6 D;  2JT0 A;  2KI4 C;  1SW8 A;  2K2F A;  2KI4 B;  3AAK A;  1AP4 A;  4A4B A;  1G33 A;  3GOF A;  1V1F A;  4NDB A;  4YGC B;  1BOD A;  3OB2 B;  2ZND A;  3EK7 A;  3CTN A;  4YGD B;  2G9B A;  2ISD A;  1QX2 A;  4ORB B;  1ALW A;  3SJS A;  4YRU A;  3VRO A;  1R6P A;  1OMD A;  5I2O A;  1JF0 A;  1FBV A;  3D0Y B;  5TNC A;  1W7I B;  2LNK A;  2JNF A;  3TZ1 A;  4OV2 A;  3VRP A;  2FJU B;  2M1K B;  1IH0 A;  1NX2 A;  1YUU A;  1BR1 B;  1N2D A;  1MXL C;  1SL8 A;  1OZO A;  4HRG A;  4CFQ A;  1DGU A;  2KFG A;  1F4O A;  4R1E A;  2LLS A;  2BL0 C;  1JFJ A;  3O78 A;  2BL0 B;  4DIR A;  1B4C A;  1S26 D;  1Y1U A;  3WHU B;  4P5O E;  1WY9 A;  2F3Z A;  2FCD A;  2EC6 B;  2L51 A;  1CDM A;  3KF9 A;  5I2Q A;  1MF8 B;  1CFF A;  3VRQ A;  1XO5 A;  3PAT A;  1H8B A;  1NWD A;  1CFC A;  1ZMZ A;  1UWO A;  1KFU L;  2BE6 A;  1K9K A;  1KFX L;  2NCO A;  2PMY A;  5G08 A;  1TTX A;  1RWY A;  4ZCU A;  3ZWH A;  4PHM A;  1WRL A;  4M2O A;  2L0P A;  2MHH A;  3KO0 A;  3A8R A;  1QS7 A;  1J55 A;  1JWD A;  4BY5 A;  1S5G Z;  5D69 A;  1TN4 A;  1UP5 A;  1GJY A;  2LMV A;  5HKY A;  5JOL A;  3TUY C;  3MSE B;  3TUY B;  1WRZ A;  3VRR A;  4GAO A;  1IQ5 A;  4HRE E;  2BBN A;  3SG5 A;  2MLF C;  2JRF A;  1K9U A;  1KQM C;  1EXR A;  1NX0 A;  2FOT A;  1KQM B;  2LP2 A;  1JBA A;  1PSB A;  2M0R A;  1OMV A;  1SL9 A;  2P6B B;  3OP0 A;  3O4Y A;  1CDP A;  1YR5 A;  2PAL A;  1PUL A;  1AHR A;  4PHJ A;  2KDH A;  4E68 A;  2ZN9 A;  3RLZ A;  1B7T Y;  2M9G A;  4ORA B;  1SYM A;  1PRW A;  2F2P A;  4NDC A;  1K8U A;  2O60 A;  1CTR A;  3TDU A;  1KWO C;  5KTY A;  1NP8 A;  4L9M A;  1A75 B;  1KWO B;  2KYF A;  3A4U B;  1ZAC A;  2JTT A;  1B8L A;  1YRU B;  2WCB A;  2LUC A;  1UHH A;  1KK8 C;  3WNX B;  1U5I A;  1KK8 B;  2JU0 A;  3SG3 A;  2K7B A;  1SL7 A;  4QJ3 B;  4USL A;  1DJI A;  2LUX A;  3DF0 A;  1S5G Y;  4AQI A;  4JWQ A;  1J7R A;  1YUT A;  1QAS A;  2ZKM X;  4XJK A;  3NSK A;  2Y4Q A;  4YGE B;  1KFU S;  1KFX S;  2GV5 A;  2H61 A;  4MZL A;  1KK7 Y;  1CLB A;  1L7Z A;  4PE1 A;  1JF2 A;  1WLM A;  1YX7 A;  3NSO A;  4C0J A;  2BBM A;  2K2A A;  2HQW A;  2LMU A;  2JXC A;  1OE9 B;  2KYC A;  2M1U A;  3TDI A;  3KEV A;  4GPL B;  2BEC A;  2WND A;  1QX7 A;  1LA0 A;  1SY9 A;  3EVV A;  2BCX A;  1DF0 A;  4ZCV A;  2MBX A;  4Q04 A;  1IJ6 A;  2B1U A;  4NQG A;  1DJY A;  1CKK A;  1EG3 A;  2KI6 D;  4QJ4 B;  2JT3 A;  3PLF B;  2CT9 A;  1FF1 A;  1UUS A;  1XYD A;  3LK0 A;  5HYD A;  4DS7 A;  2Y1M A;  1A4P A;  2BKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...