1EH2A

Structure of the second eps15 homology domain of human eps15, nmr, 20 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding
molecule keywords EPS15
publication title Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1998-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1eh2A00
3BUWB 4GNKB 1QX7A 5AFPA 4XYNA 1XFWO 1S1EA 4GAOA 1DVIA 1DJIA 1EG3A 2M8UA 3DD4A 2JULA 2KQYA 2FCDA 1V1FA 2NZ0A 3HX4A 1N65A 2LANA 2K7OA 4D1EA 3OX5A 1NSHA 2E6WA 4M2PA 1M45A 5I2OA 4PHMA 2O5GA 3CR4X 2BL0B 4MEWA 4R1EA 2LNKA 1TNPA 5AERA 1CFPA 4NDBA 1CMGA 1KWOB 1AK8A 1BU3A 1UHIA 3RM1A 1R6PA 4YBHB 5KSZA 2LV7A 1IQ3A 2CT9A 1JBAA 1CM1A 1WY9A 2QACA 2ZN9A 2H61C 5JOLA 1XYDA 2ZKMX 1SR6C 1G33A 1DTLA 1FW4A 2B1UA 2COLB 4MZLA 1Q80A 1SCVA 1AUIB 1B47A 1MF8B 3EK8A 1WRLA 2LAPA 3DVMA 1NX0A 1UWOA 4I5LB 2KBIA 2KI6C 1WRKA 2CBLA 1TOPA 2HPSA 2L51A 2JQ6A 1KQVA 1MXLC 3EKHA 1H4BA 3NSIA 2KI4C 4PHKA 4E68A 3K21A 1L2OC 2MRDA 2AMIA 2LLSA 4ORCB 1S6IA 1UURA 3SIBA 2LM5A 3AKBA 1Y1AA 1KK8B 1D1OA 1CKKA 1F71A 1IH0A 5ER5A 5AXIA 4DIRA 2LLTA 4MLWA 3SIAA 1PK0D 1BT6A 1K96A 2I7AA 3GK4X 1YR5A 3OB1B 4HRHA 2JRFA 4WRIA 1YRUB 1RROA 2WCBA 2JNXA 4PHNA 1UHJA 3GK2A 3PN7C 3F45A 1DF0B 1F4QA 4MBEA 1S5GZ 1LINA 3TZ1A 1XFVO 4Q04A 4ZCUA 2LE9B 1IQ5A 2L4HA 4IL1A 3EVVA 1MWNA 1DJHA 2SASA 1CTRA 5CSJA 3SG4A 3BOWB 5AEQA 5TNCA 3I5HC 1CB1A 1KFXS 3DF0B 2G9BA 1QX5B 2EC6C 1SL9A 2K61A 4YGAA 1PVBA 1SL7A 3I5FC 1JWDA 2JXCA 1NP8A 1NIWA 2CTNA 4NDCA 2NXQA 2M0RA 4YRUA 1TNQA 3NSKA 2GGZA 3BXKA 4C0LA 1BR1B 2LP3A 1UHKA 2OPOA 4CLNA 1RWYA 1K9PA 3LLEA 1S36A 1FPWA 1S5GY 1QIVA 1ZFSA 3TUYC 4A4BA 5F6TA 3EVRA 1BF5A 1F55A 3VRPA 4PE1A 1NX3A 3JTDB 1BR4B 2KYCA 2M29A 4M2OA 1A75A 1XVJA 1B8LA 1DJZA 2CNPA 4PALA 1A29A 2ZRSA 1KK8C 3AAJA 3OP0A 4C0KA 3LK0A 1ALWA 1KSOA 2BKIB 2WORA 1XK4A 3CZTX 1J55A 2PMYA 5D7FA 1N2DA 3TDZA 2Y1MA 2FJUB 2ISDA 1FI5A 3PLFB 3EVUA 1AHRA 3KEVA 4YI8A 4CIDA 2I2RE 4MZJA 4XJKB 3PSRA 3WNXB 2AAOA 2JT3A 1NPQA 4N1FA 1YRTB 4FQOA 1B1GA 1F4OA 2LHLA 3JVTB 1DJYA 3TS5C 1YX7A 1WDCC 2BBMA 3CTNA 5HKWA 2WC8A 1DJXA 1SPYA 4PE0A 1J7OA 2BCBA 1CLBA 2FCEA 5I8NA 1QLSA 1B8CA 1K90D 2L2EA 5B8IB 1WRZA 5BPJA 1QS7A 2LP2A 3I5IB 1Y1XA 4QJ4B 2LLUA 1EH2A 4C0JA 2OTGB 1LA3A 2KAVA 2KGRA 2V53A 3I5GB 4MRYA 1CLLA 1Y0VH 2BE4A 4ZCVA 1SMGA 2BECA 3KPXA 2MJWB 3RLZA 1V1GA 1K8UA 4OVNF 2MA2A 1SCMB 1RECA 2JT0A 4N5XA 1YUUA 1XFYO 3QRXA 4ORAB 5JJGA 1FF1A 2NLNA 3KF9A 2KAXA 1DJWA 1XFXO 3A4UB 5CPVA 2BCAA 1M46A 5HLVA 2F8PA 1XFUO 2M1KB 1GGZA 1S3PA 3CLNA 2LMUA 2K7BA 4MZKA 1IG5A 3JTDC 3SG6A 2JU0A 1TNXA 3HCMA 1XK4C 5DKQA 1BOCA 1IRJA 1K9KA 5HKYA 1ALVA 2TN4A 1B9AA 2JWWA 3DVJA 1BLQA 2LC5A 2MLFC 2L0PA 2ZFDA 3FS7A 1QLKA 3OB2B 1U5IB 4MN0A 2ZNDA 2P6BB 2KNEA 4GUKA 4CFQA 3PM8A 1R2UA 3KHEA 1JF2A 1QJTA 2ZNEA 1B7TY 1OMDA 5CSNA 1KK7Y 1KCYA 4YGDB 1G4YR 4UPGA 1QV0A 4PDZA 1JUOA 1B4CA 4PE7A 1J7PA 2I18A 3SJSA 1QVIY 1LKJA 1QASA 2HF5A 5FYXA 1PSBA 4DCKA 4DUQA 1NCYA 1C7WA 4JPZB 1DJGA 5D69A 2OS8B 2ZRTA 1CMFA 5PALA 1K2HA 1TIZA 3E3RA 1DF0A 3CWGA 3D0YB 2BL0C 2E30A 3BQ3A 1WLZA 1RFJA 2JNFA 1CDPA 2JZIA 2M1UA 3VROA 1KQMB 2OTGC 1KWOC 4AOMA 1QX2A 2Y5IA 3BOWA 1G8IA 1AJ4A 2LUCA 3IQQA 3LL8B 4GFTA 4USLA 3WXAA 3TDUA 1CLMA 4GGNA 1S6CA 1LA0A 4GPLB 1OZOA 4YI9A 4QJ3B 1W7JB 3FIAA 1JFJA 1GGWA 2AUCA 3DF0A 1C07A 1QIWA 2KFHA 1RJVA 3IF7A 1K94A 5I2LA 2JOJA 1DGUA 1SW8A 1CFDA 2R2IA 3LK1A 1VRKA 2F2OA 4GBAA 3VRQA 2PRUA 1YTZC 3C1VA 1M39A 4DS7A 2LMVA 3PFVA 1YURA 1EXRA 4MRXA 2L98A 2HQ8A 4NQGA 1J7RA 1GQMA 2I94A 2JTTA 1C7VA 1PVAA 1YVLA 4OKHA 4OR9B 3SG2A 1SRAA 4OV2A 1ZMZA 5CSFA 1NUBA 2M97A 1IJ5A 2KYFA 1CFCA 1NYAA 2KFGA 3ZWHA 1SR6B 1SY9A 2IS9A 2LVKA 4FTGA 1QXPA 1TTXA 1YX8A 2KSPA 4WQ2A 3OX6A 1TRFA 1PRWA 3BUMB 2Q4UA 1ZACA 3VRNA 3AKAA 2GV5A 3M0WA 2F3YA 1L2OB 3FWCA 4PHJA 2PVBA 4XJKA 3MSEB 2MBXA 1MQ1A 1QV1A 2OS8C 1SBJA 4WQ3A 2KAYA 2JPTA 1PSRA 4I5JA 1GJYA 4F0ZB 3BUXB 4HRGA 3SG7A 1F70A 1J7QA 1JC2A 3NXAA 1XFZO 1ZUZA 2PASA 1F8HA 1LVCD 3DVKA 4L9MA 5GQQC 1MR8A 3SG3A 4A4CA 3VRRA 1BJFA 1HT9A 2LUXA 2M7NA 1TN4A 3CR5X 2QPTA 1NCZA 1UP5A 1SKTA 1FBVA 3SG5A 4YGCB 4MVFA 2FOTA 1K9UA 2GGMA 2BCXA 2F33A 1SNLA 3BUOB 4HSZA 3PN7B 2BE6A 1B7TZ 1KFXL 2MLEC 1ODBA 1KK7Z 1MUXA 1Y1UA 1E8AA 3EK7A 4PCWA 1UUSA 2VRGA 1A4PA 2KFFA 1J1DA 5I2QA 4JQ0D 5IBWA 2KOTA 2EGDA 2L5XB 3A8RA 1QVIZ 2F3ZA 2Y4QA 1J1EA 3TDIA 1M31A 1OQPA 1CDLA 3O78A 1XA5A 1Y6WA 2H2KA 3I5HB 1CNPA 4MSPA 4BY4A 2EC6B 1BODA 3WHTB 1KFUL 3I5FB 1HQVA 4P2YB 1TCFA 5KTYA 4NDDA 2KBMA 4QJ5B 1TCOB 1UHNA 2KQ6A 2WCEA 1SYMA 3IQOA 4CPVA 1IJ6A 2LVIA 2M49B 1JF0A 5HLOA 5HYDA 2F2PA 1A03A 2HETA 2JT8A 1U5IA 1X02A 1DT7B 1K95A 3TUYB 3H4SE 1YUSA 1W7IB 5ER4X 4YGEB 4GGFC 2Y1NA 3JVTC 3CR2A 2A4JA 3NSOA 1FI6A 1EJ3A 1S6JA 2JC2A 2RGIA 4PE4A 1SL8A 3DVEA 1NWDA 1M63B 5DKRA 4DRWA 2EHBA 1QATA 2LCPA 1TNWA 2K2FA 2M9GA 3I5IC 2KGBC 1NX2A 4HREE 2LVJA 1OE9B 3OHMB 1DMOA 2BKHB 1YUTA 1F54A 2NCPA 1NX1A 2KHNA 3D10A 1OSAA 2O60A 3D0YA 1EL4A 3I5GC 3LCPC 1OMRA 1UHHA 2K7CA 3EKJA 4JWQA 4AQJA 4CFRA 1IGVA 2K7DA 2BBNA 1H8BA 3AAKA 1SCMC 1IWQA 2K0JA 2LHIA 3O6BA 1RTP1 1CFFA 1QTXA 2PALA 2MHHA 2LMTA 3CS1A 3TS5B 1AP4A 1WDCB 2D8NA 1KSMA 5G08A 3PALA 1CM4A 3GK1A 3GOFA 4OCIA 4TNCA 2G2BA 2CXJA 1YVHA 3VGOA 1L7ZA 2WNDA 2ZN8A 1BG1A 2WCFA 1LXFC 1JFKA 4N1GA 2L4IA 1PULA 1JSAA 2M7LA 1CDNA 3O4YA 1K93D 3FWBA 1OOJA 1B8RA 1SK6D 5HKZA 2PSRA 3BYAA 5AANA 3CGAA 1OMVA 1NCXA 3O2PA 3PATA 4U8DA 2Q91A 1KFUS 1MHOA 1XO5A 1N0YA 2CCMA 2H61A 1OZSA 1A75B 2WOSA 3WHUB 3EK4A 1DGVA 4I5KA 4ICBA 1AJ5A 2K2AA 2DOQA 4AQIA 2MAZA 3KO0A 2JXLA 1RK9A 2K8MB 5DKNA 1BMOA 2JTZA 4ETOA 3ICBA 1AVSA 2LVVA 2KI4B 2L50A 1EG4A 2SCPA 3ZNIA 3NSLA 4YGBB 2KDHA 4ORBB 4M2QA 1S26D 2HQWA 5CSIA 4GGFA 1WLMA 2NCOA 4I5NB 3BUNB 4BY5A 5J3XA 1MXEA 1IKUA 1PALA 5KU1A 2KI6D 1KQMC 5K89A 1CDMA 4P5OE 1A2XA 2M3WA 1ZOTB
chains in the Genus database with same CATH superfamily
3BUWB 4GNKB 1QX7A 5AFPA 4XYNA 1XFWO 2WCMA 1S1EA 4GAOA 1DVIA 4JD9A 1DJIA 1EG3A 2M8UA 3DD4A 2JULA 2KQYA 1XFRA 2FCDA 1V1FA 2NZ0A 3FE6A 3R1PA 3HX4A 1N65A 2LANA 2K7OA 4D1EA 3OX5A 1NSHA 2E6WA 2FJYA 4M2PA 1M45A 5I2OA 1OW4A 4PHMA 2O5GA 3CR4X 2BL0B 4MEWA 4R1EA 2LNKA 1TNPA 5AERA 1CFPA 4NDBA 1CMGA 1KWOB 3BFBA 1AK8A 2BAPA 1BU3A 3K1EA 1UHIA 3RM1A 1R6PA 4YBHB 5KSZA 2LV7A 1IQ3A 2CT9A 1JBAA 1CM1A 1WY9A 2QACA 2ZN9A 2H61C 5JOLA 1XYDA 2ZKMX 1SR6C 3Q8IA 1G33A 1DTLA 1FW4A 2B1UA 2COLB 4MZLA 4FQTA 1Q80A 1SCVA 1AUIB 1B47A 1MF8B 3EK8A 1WRLA 2LAPA 2P71A 3DVMA 1NX0A 1UWOA 4I5LB 5FI7A 3D75A 2QEBA 2KBIA 2KI6C 1WRKA 2CBLA 1TOPA 2HPSA 2L51A 2JQ6A 1KQVA 1MXLC 3EKHA 1H4BA 3NSIA 2KI4C 4PHKA 4E68A 3K21A 1L2OC 2MRDA 2AMIA 2LLSA 4ORCB 1S6IA 5FI6A 1UURA 3SIBA 2LM5A 3AKBA 1Y1AA 1KK8B 1D1OA 1CKKA 3OGNA 1F71A 1IH0A 5ER5A 3CDNA 5AXIA 3S0BA 4DIRA 2LLTA 4MLWA 3SIAA 1PK0D 1BT6A 1T14A 3NGVA 1K96A 3PM2A 5EL2A 2I7AA 3GK4X 1YR5A 3OB1B 4PCWA 2K60A 4HRHA 2WCJA 3SS3A 2JRFA 4WRIA 1YRUB 1RROA 2WCBA 2JNXA 4PHNA 1UHJA 3GK2A 3PN7C 3F45A 1DF0B 1F4QA 3B88A 4MBEA 1S5GZ 1LINA 3TZ1A 1XFVO 2H8VA 4Q04A 4ZCUA 2LE9B 1IQ5A 2L4HA 4IL1A 3EVVA 1MWNA 1DJHA 2SASA 1CTRA 5CSJA 3SG4A 3BOWB 3B87A 1TUJA 5AEQA 5TNCA 3I5HC 1CB1A 1KFXS 3DF0B 3DYEA 2G9BA 1QX5B 2EC6C 1SL9A 2K61A 2KPHA 1PVBA 4YGAA 1SL7A 3I5FC 1JWDA 3B7AA 2JXCA 1NP8A 1NIWA 2CTNA 4NDCA 2NXQA 2M0RA 4YRUA 1TNQA 3NSKA 2GGZA 3BXKA 4C0LA 3RZSA 3S0DA 1BR1B 2LP3A 1UHKA 2OPOA 3D77A 1RWYA 4IJ7A 4CLNA 1K9PA 3LLEA 1S36A 2QEHA 3BFAA 1FPWA 1S5GY 1QIVA 1ZFSA 3TUYC 4A4BA 5F6TA 3EVRA 1BF5A 1OOHA 3SS4A 3VRPA 1F55A 4PE1A 1NX3A 3JTDB 1BR4B 2KYCA 2M29A 4M2OA 1A75A 1XVJA 1B8LA 1DJZA 2CNPA 4PALA 1A29A 1OOIX 2ZRSA 1KK8C 3AAJA 3OP0A 3SS5A 3LK0A 2L5YA 4C0KA 1ALWA 1KSOA 2BKIB 2WORA 1P28A 1XK4A 3CZTX 1J55A 2PMYA 5D7FA 3NHIA 3FE8A 1N2DA 3EG5B 3TDZA 2Y1MA 2FJUB 5FI2A 2ISDA 3PLFB 1FI5A 3EVUA 1AHRA 3KEVA 4YI8A 4CIDA 2I2RE 4MZJA 4XJKB 3PSRA 3WNXB 2AAOA 2JT3A 1NPQA 4N1FA 3CZ0A 1YRTB 4FQOA 1B1GA 2WCKA 1F4OA 2LHLA 3JVTB 1DJYA 3TS5C 1YX7A 1WDCC 3B6XA 2BBMA 3CTNA 3N7HA 2WC8A 1DJXA 1SPYA 2KLEA 4PE0A 2BCBA 5HKWA 1J7OA 2FCEA 5I8NA 1QLSA 1B8CA 1K90D 2L2EA 5B8IB 1DQEA 1WRZA 5BPJA 1QS7A 2LP2A 3CABA 3I5IB 1Y1XA 3S0EA 4QJ4B 4OZDA 3D74A 3S0FA 2LLUA 1EH2A 4C0JA 2OTGB 1LA3A 2KAVA 2KGRA 2P70A 2V53A 3I5GB 4MRYA 1CLLA 1Y0VH 2BE4A 1ORGA 4ZCVA 1SMGA 2BECA 3KPXA 2MJWB 3RLZA 1V1GA 1K8UA 4OVNF 3B86A 2MA2A 1SCMB 1RECA 2QDIA 2JT0A 4N5XA 1YUUA 1XFYO 3QRXA 4ORAB 5D3OA 5JJGA 1FF1A 2NLNA 3KF9A 2KAXA 1DJWA 1XFXO 3A4UB 3OBVA 4F7FA 5CPVA 2BCAA 1M46A 5HLVA 3UO9A 1TWOA 2F8PA 1XFUO 2M1KB 1GGZA 1S3PA 3CLNA 2LMUA 2K7BA 4MZKA 1IG5A 3JTDC 3SG6A 2JU0A 1TNXA 3HCMA 1XK4C 1CLBA 5DKQA 1BOCA 1IRJA 1K9KA 5HKYA 1ALVA 2TN4A 1B9AA 1W9ZA 2JWWA 3DVJA 1BLQA 2LC5A 1DEKA 2MLFC 2L0PA 2ZFDA 2WC5A 1QLKA 3FS7A 3OB2B 1U5IB 4MN0A 2ZNDA 2P6BB 2KNEA 4GUKA 4CFQA 3PM8A 1R2UA 3KHEA 1JF2A 1QJTA 2ZNEA 1B7TY 1OMDA 5CSNA 1KK7Y 1KCYA 4YGDB 1G4YR 4UPGA 1QV0A 4PDZA 1JUOA 1B4CA 4PE7A 1J7PA 2I18A 3SJSA 1QVIY 1LKJA 1QASA 2HF5A 3S0AA 5FYXA 1PSBA 4DCKA 1OOGA 4DUQA 1NCYA 1C7WA 4JPZB 1DJGA 5D69A 2OS8B 2ZRTA 1CMFA 5PALA 1K2HA 1TIZA 3R1OA 3E3RA 1DF0A 3CWGA 3BFHA 3D0YB 2BL0C 2E30A 3BQ3A 2BNXA 1WLZA 1RFJA 2JNFA 1CDPA 2JZIA 2M1UA 3VROA 1KQMB 2OTGC 1KWOC 4AOMA 1QX2A 2Y5IA 3D78A 3BOWA 1G8IA 1AJ4A 2LUCA 3IQQA 3LL8B 3R72A 4GFTA 4USLA 3WXAA 3TDUA 1CLMA 4GGNA 1S6CA 1LA0A 4GPLB 1OZOA 4YI9A 4QJ3B 1W7JB 3FIAA 1JFJA 1GGWA 2AUCA 3DF0A 1C07A 1QIWA 2KFHA 1RJVA 3IF7A 1K94A 2YGUA 5I2LA 2JOJA 1DGUA 1SW8A 1CFDA 2R2IA 3LK1A 1VRKA 2F2OA 4GBAA 3VRQA 2PRUA 1DELA 1YTZC 1M39A 3C1VA 4DS7A 2LMVA 3PFVA 1YURA 1EXRA 1Z4HA 3FE9A 4MRXA 2L98A 2HQ8A 4NQGA 1J7RA 1GQMA 2I94A 2JTTA 1C7VA 1PVAA 1YVLA 4OKHA 4OR9B 3SG2A 1SRAA 4OV2A 1ZMZA 5CSFA 1NUBA 2M97A 1IJ5A 2KYFA 1CFCA 1NYAA 2KFGA 3ZWHA 1SR6B 1SY9A 2IS9A 2LVKA 4FTGA 1QXPA 1TTXA 1YX8A 2PQLA 2KSPA 4WQ2A 3OX6A 1TRFA 1PRWA 3BUMB 2Q4UA 1ZACA 3VRNA 3AKAA 2GV5A 3M0WA 2F3YA 3QMEA 1L2OB 3FWCA 4PHJA 2PVBA 4XJKA 3MSEB 3D76A 2MBXA 1MQ1A 1QV1A 2OS8C 1SBJA 4WQ3A 3VB1A 5I94A 2KAYA 2JPTA 1PSRA 4I5JA 1GJYA 4F0ZB 3BUXB 4HRGA 3SG7A 1F70A 1J7QA 2L2CA 3NXAA 1XFZO 1ZUZA 1JC2A 2PASA 1F8HA 1LVCD 3CZ2A 3DVKA 4L9MA 3DXLA 5GQQC 1MR8A 3SG3A 4A4CA 3CZ1A 3VRRA 1BJFA 3UNWA 1HT9A 2LUXA 2M7NA 3L4LA 1TN4A 3CR5X 3NHTA 2QPTA 3V2LA 1NCZA 1UP5A 1SKTA 1C3ZA 1FBVA 3SG5A 4YGCB 4MVFA 2FOTA 1K9UA 2GGMA 2GTEA 2BCXA 2F33A 1SNLA 3BUOB 4HSZA 3PN7B 1B7TZ 1KFXL 2BE6A 2MLEC 1ODBA 1KK7Z 1MUXA 1Y1UA 1E8AA 3DZTA 3EK7A 1UUSA 2VRGA 1A4PA 2KFFA 1J1DA 5I2QA 4JQ0D 5IBWA 2KOTA 2EGDA 2L5XB 3A8RA 1QVIZ 2F3ZA 2Y4QA 1J1EA 2JPOA 3TDIA 1M31A 1OQPA 1CDLA 1OOFA 1XA5A 2WC6A 1Y6WA 2WCHA 2H2KA 3I5HB 3O78A 1CNPA 4MSPA 4BY4A 2EC6B 1BODA 1TUZA 3WHTB 1KFUL 1QWVA 3I5FB 1HQVA 4P2YB 1TCFA 5KTYA 4NDDA 2KBMA 4QJ5B 1TCOB 1UHNA 2KQ6A 2WCEA 1SYMA 3IQOA 4CPVA 1IJ6A 2LVIA 2M49B 1JF0A 5HLOA 5HYDA 2F2PA 1A03A 2HETA 2JT8A 1U5IA 1X02A 1DT7B 1K95A 3TUYB 3H4SE 1YUSA 1W7IB 5ER4X 4YGEB 4GGFC 2Y1NA 3JVTC 3CR2A 2A4JA 3NSOA 1Z2CB 3R1VA 1FI6A 1EJ3A 1S6JA 2JC2A 2RGIA 4PE4A 1SL8A 3DVEA 1NWDA 3S0GA 1M63B 3PJIA 5DKRA 5DICA 4DRWA 2EHBA 1QATA 2LCPA 1TNWA 2K2FA 2M9GA 3I5IC 2KGBC 1NX2A 4HREE 2LVJA 1OE9B 3OHMB 1DMOA 2BKHB 2WCLA 4PT1A 1YUTA 1GM0A 1F54A 2NCPA 1NX1A 2KHNA 3DY9A 3D10A 1OSAA 2O60A 3D0YA 1EL4A 3I5GC 3LCPC 1OMRA 1UHHA 2K7CA 3EKJA 4JWQA 4AQJA 4CFRA 1IGVA 2K7DA 2BBNA 4INWA 1H8BA 3AAKA 1SCMC 1IWQA 2K0JA 2LHIA 3O6BA 1RTP1 1CFFA 1QTXA 2PALA 2ERBA 2MHHA 2LMTA 2QEOA 3CS1A 3TS5B 1AP4A 1WDCB 2D8NA 1KSMA 5G08A 3PALA 3O4XA 1CM4A 3GK1A 3GOFA 4OCIA 4TNCA 2PYQA 2G2BA 2CXJA 1YVHA 3VGOA 1L7ZA 2WNDA 2ZN8A 1BG1A 1C3YA 2WCFA 1SSEB 1LXFC 1JFKA 4N1GA 2KLDA 2L4IA 1PULA 1JSAA 2QEVA 2M7LA 1CDNA 3O4YA 3CYZA 1K93D 3FWBA 1OOJA 1B8RA 1SK6D 5HKZA 2PSRA 3BYAA 4KYNA 3L4AA 5AANA 1LS8A 3CGAA 1OMVA 1NCXA 3O2PA 3PATA 4U8DA 2Q91A 1KFUS 1MHOA 1XO5A 1N0YA 2CCMA 2H61A 4INXA 1OZSA 1A75B 2WOSA 3WHUB 3EK4A 1DGVA 4I5KA 4ICBA 1AJ5A 2K2AA 2DOQA 3IVTA 3BJHA 4AQIA 2MAZA 3D73A 2JXLA 1RK9A 2K8MB 3KO0A 1BMOA 2JTZA 4JKTA 3ICBA 1AVSA 5DKNA 4ETOA 2LVVA 2KI4B 2L50A 1EG4A 1DC1A 2SCPA 3ZNIA 3NSLA 4YGBB 2KDHA 4ORBB 4M2QA 1S26D 2HQWA 3L47A 5CSIA 4GGFA 1IIOA 1WLMA 2NCOA 4I5NB 3BUNB 4BY5A 5J3XA 1MXEA 1IKUA 1PALA 5KU1A 2KI6D 1KQMC 5K89A 1CDMA 4P5OE 5HL1A 1A2XA 2M3WA 1ZOTB
chains in the Genus database with same CATH topology
3BUWB 4GNKB 1QX7A 5AFPA 4XYNA 1XFWO 1S1EA 4GAOA 1DVIA 1DJIA 1EG3A 2M8UA 3DD4A 2JULA 2KQYA 2FCDA 1V1FA 2NZ0A 3HX4A 1N65A 2LANA 2K7OA 4D1EA 3OX5A 1NSHA 2E6WA 4M2PA 1M45A 5I2OA 4PHMA 2O5GA 3CR4X 2BL0B 4MEWA 4R1EA 2LNKA 1TNPA 5AERA 1CFPA 4NDBA 1CMGA 1KWOB 1AK8A 1BU3A 1UHIA 3RM1A 1R6PA 4YBHB 5KSZA 2LV7A 1IQ3A 2CT9A 1JBAA 1CM1A 1WY9A 2QACA 2ZN9A 2H61C 5JOLA 1XYDA 2ZKMX 1SR6C 1G33A 1DTLA 1FW4A 2B1UA 2COLB 4MZLA 1Q80A 1SCVA 1AUIB 1B47A 1MF8B 3EK8A 1WRLA 2LAPA 3DVMA 1NX0A 1UWOA 4I5LB 2KBIA 2KI6C 1WRKA 2CBLA 1TOPA 2HPSA 2L51A 2JQ6A 1KQVA 1MXLC 3EKHA 1H4BA 3NSIA 2KI4C 4PHKA 4E68A 3K21A 1L2OC 2MRDA 2AMIA 2LLSA 4ORCB 1S6IA 1UURA 3SIBA 2LM5A 3AKBA 1Y1AA 1KK8B 1D1OA 1CKKA 1F71A 1IH0A 5ER5A 5AXIA 4DIRA 2LLTA 4MLWA 3SIAA 1PK0D 1BT6A 1K96A 2I7AA 3GK4X 1YR5A 3OB1B 4HRHA 2JRFA 4WRIA 1YRUB 1RROA 2WCBA 2JNXA 4PHNA 1UHJA 3GK2A 3PN7C 3F45A 1DF0B 1F4QA 4MBEA 1S5GZ 1LINA 3TZ1A 1XFVO 4Q04A 4ZCUA 2LE9B 1IQ5A 2L4HA 4IL1A 3EVVA 1MWNA 1DJHA 2SASA 1CTRA 5CSJA 3SG4A 3BOWB 5AEQA 5TNCA 3I5HC 1CB1A 1KFXS 3DF0B 2G9BA 1QX5B 2EC6C 1SL9A 2K61A 4YGAA 1PVBA 1SL7A 3I5FC 1JWDA 2JXCA 1NP8A 1NIWA 2CTNA 4NDCA 2NXQA 2M0RA 4YRUA 1TNQA 3NSKA 2GGZA 3BXKA 4C0LA 1BR1B 2LP3A 1UHKA 2OPOA 4CLNA 1RWYA 1K9PA 3LLEA 1S36A 1FPWA 1S5GY 1QIVA 1ZFSA 3TUYC 4A4BA 5F6TA 3EVRA 1BF5A 1F55A 3VRPA 4PE1A 1NX3A 3JTDB 1BR4B 2KYCA 2M29A 4M2OA 1A75A 1XVJA 1B8LA 1DJZA 2CNPA 4PALA 1A29A 2ZRSA 1KK8C 3AAJA 3OP0A 4C0KA 3LK0A 1ALWA 1KSOA 2BKIB 2WORA 1XK4A 3CZTX 1J55A 2PMYA 5D7FA 1N2DA 3TDZA 2Y1MA 2FJUB 2ISDA 1FI5A 3PLFB 3EVUA 1AHRA 3KEVA 4YI8A 4CIDA 2I2RE 4MZJA 4XJKB 3PSRA 3WNXB 2AAOA 2JT3A 1NPQA 4N1FA 1YRTB 4FQOA 1B1GA 1F4OA 2LHLA 3JVTB 1DJYA 3TS5C 1YX7A 1WDCC 2BBMA 3CTNA 5HKWA 2WC8A 1DJXA 1SPYA 4PE0A 1J7OA 2BCBA 1CLBA 2FCEA 5I8NA 1QLSA 1B8CA 1K90D 2L2EA 5B8IB 1WRZA 5BPJA 1QS7A 2LP2A 3I5IB 1Y1XA 4QJ4B 2LLUA 1EH2A 4C0JA 2OTGB 1LA3A 2KAVA 2KGRA 2V53A 3I5GB 4MRYA 1CLLA 1Y0VH 2BE4A 4ZCVA 1SMGA 2BECA 3KPXA 2MJWB 3RLZA 1V1GA 1K8UA 4OVNF 2MA2A 1SCMB 1RECA 2JT0A 4N5XA 1YUUA 1XFYO 3QRXA 4ORAB 5JJGA 1FF1A 2NLNA 3KF9A 2KAXA 1DJWA 1XFXO 3A4UB 5CPVA 2BCAA 1M46A 5HLVA 2F8PA 1XFUO 2M1KB 1GGZA 1S3PA 3CLNA 2LMUA 2K7BA 4MZKA 1IG5A 3JTDC 3SG6A 2JU0A 1TNXA 3HCMA 1XK4C 5DKQA 1BOCA 1IRJA 1K9KA 5HKYA 1ALVA 2TN4A 1B9AA 2JWWA 3DVJA 1BLQA 2LC5A 2MLFC 2L0PA 2ZFDA 3FS7A 1QLKA 3OB2B 1U5IB 4MN0A 2ZNDA 2P6BB 2KNEA 4GUKA 4CFQA 3PM8A 1R2UA 3KHEA 1JF2A 1QJTA 2ZNEA 1B7TY 1OMDA 5CSNA 1KK7Y 1KCYA 4YGDB 1G4YR 4UPGA 1QV0A 4PDZA 1JUOA 1B4CA 4PE7A 1J7PA 2I18A 3SJSA 1QVIY 1LKJA 1QASA 2HF5A 5FYXA 1PSBA 4DCKA 4DUQA 1NCYA 1C7WA 4JPZB 1DJGA 5D69A 2OS8B 2ZRTA 1CMFA 5PALA 1K2HA 1TIZA 3E3RA 1DF0A 3CWGA 3D0YB 2BL0C 2E30A 3BQ3A 1WLZA 1RFJA 2JNFA 1CDPA 2JZIA 2M1UA 3VROA 1KQMB 2OTGC 1KWOC 4AOMA 1QX2A 2Y5IA 3BOWA 1G8IA 1AJ4A 2LUCA 3IQQA 3LL8B 4GFTA 4USLA 3WXAA 3TDUA 1CLMA 4GGNA 1S6CA 1LA0A 4GPLB 1OZOA 4YI9A 4QJ3B 1W7JB 3FIAA 1JFJA 1GGWA 2AUCA 3DF0A 1C07A 1QIWA 2KFHA 1RJVA 3IF7A 1K94A 5I2LA 2JOJA 1DGUA 1SW8A 1CFDA 2R2IA 3LK1A 1VRKA 2F2OA 4GBAA 3VRQA 2PRUA 1YTZC 3C1VA 1M39A 4DS7A 2LMVA 3PFVA 1YURA 1EXRA 4MRXA 2L98A 2HQ8A 4NQGA 1J7RA 1GQMA 2I94A 2JTTA 1C7VA 1PVAA 1YVLA 4OKHA 4OR9B 3SG2A 1SRAA 4OV2A 1ZMZA 5CSFA 1NUBA 2M97A 1IJ5A 2KYFA 1CFCA 1NYAA 2KFGA 3ZWHA 1SR6B 1SY9A 2IS9A 2LVKA 4FTGA 1QXPA 1TTXA 1YX8A 2KSPA 4WQ2A 3OX6A 1TRFA 1PRWA 3BUMB 2Q4UA 1ZACA 3VRNA 3AKAA 2GV5A 3M0WA 2F3YA 1L2OB 3FWCA 4PHJA 2PVBA 4XJKA 3MSEB 2MBXA 1MQ1A 1QV1A 2OS8C 1SBJA 4WQ3A 2KAYA 2JPTA 1PSRA 4I5JA 1GJYA 4F0ZB 3BUXB 4HRGA 3SG7A 1F70A 1J7QA 1JC2A 3NXAA 1XFZO 1ZUZA 2PASA 1F8HA 1LVCD 3DVKA 4L9MA 5GQQC 1MR8A 3SG3A 4A4CA 3VRRA 1BJFA 1HT9A 2LUXA 2M7NA 1TN4A 3CR5X 2QPTA 1NCZA 1UP5A 1SKTA 1FBVA 3SG5A 4YGCB 4MVFA 2FOTA 1K9UA 2GGMA 2BCXA 2F33A 1SNLA 3BUOB 4HSZA 3PN7B 2BE6A 1B7TZ 1KFXL 2MLEC 1ODBA 1KK7Z 1MUXA 1Y1UA 1E8AA 3EK7A 4PCWA 1UUSA 2VRGA 1A4PA 2KFFA 1J1DA 5I2QA 4JQ0D 5IBWA 2KOTA 2EGDA 2L5XB 3A8RA 1QVIZ 2F3ZA 2Y4QA 1J1EA 3TDIA 1M31A 1OQPA 1CDLA 3O78A 1XA5A 1Y6WA 2H2KA 3I5HB 1CNPA 4MSPA 4BY4A 2EC6B 1BODA 3WHTB 1KFUL 3I5FB 1HQVA 4P2YB 1TCFA 5KTYA 4NDDA 2KBMA 4QJ5B 1TCOB 1UHNA 2KQ6A 2WCEA 1SYMA 3IQOA 4CPVA 1IJ6A 2LVIA 2M49B 1JF0A 5HLOA 5HYDA 2F2PA 1A03A 2HETA 2JT8A 1U5IA 1X02A 1DT7B 1K95A 3TUYB 3H4SE 1YUSA 1W7IB 5ER4X 4YGEB 4GGFC 2Y1NA 3JVTC 3CR2A 2A4JA 3NSOA 1FI6A 1EJ3A 1S6JA 2JC2A 2RGIA 4PE4A 1SL8A 3DVEA 1NWDA 1M63B 5DKRA 4DRWA 2EHBA 1QATA 2LCPA 1TNWA 2K2FA 2M9GA 3I5IC 2KGBC 1NX2A 4HREE 2LVJA 1OE9B 3OHMB 1DMOA 2BKHB 1YUTA 1F54A 2NCPA 1NX1A 2KHNA 3D10A 1OSAA 2O60A 3D0YA 1EL4A 3I5GC 3LCPC 1OMRA 1UHHA 2K7CA 3EKJA 4JWQA 4AQJA 4CFRA 1IGVA 2K7DA 2BBNA 1H8BA 3AAKA 1SCMC 1IWQA 2K0JA 2LHIA 3O6BA 1RTP1 1CFFA 1QTXA 2PALA 2MHHA 2LMTA 3CS1A 3TS5B 1AP4A 1WDCB 2D8NA 1KSMA 5G08A 3PALA 1CM4A 3GK1A 3GOFA 4OCIA 4TNCA 2G2BA 2CXJA 1YVHA 3VGOA 1L7ZA 2WNDA 2ZN8A 1BG1A 2WCFA 1LXFC 1JFKA 4N1GA 2L4IA 1PULA 1JSAA 2M7LA 1CDNA 3O4YA 1K93D 3FWBA 1OOJA 1B8RA 1SK6D 5HKZA 2PSRA 3BYAA 5AANA 3CGAA 1OMVA 1NCXA 3O2PA 3PATA 4U8DA 2Q91A 1KFUS 1MHOA 1XO5A 1N0YA 2CCMA 2H61A 1OZSA 1A75B 2WOSA 3WHUB 3EK4A 1DGVA 4I5KA 4ICBA 1AJ5A 2K2AA 2DOQA 4AQIA 2MAZA 3KO0A 2JXLA 1RK9A 2K8MB 5DKNA 1BMOA 2JTZA 4ETOA 3ICBA 1AVSA 2LVVA 2KI4B 2L50A 1EG4A 2SCPA 3ZNIA 3NSLA 4YGBB 2KDHA 4ORBB 4M2QA 1S26D 2HQWA 5CSIA 4GGFA 1WLMA 2NCOA 4I5NB 3BUNB 4BY5A 5J3XA 1MXEA 1IKUA 1PALA 5KU1A 2KI6D 1KQMC 5K89A 1CDMA 4P5OE 1A2XA 2M3WA 1ZOTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUW B;  4GNK B;  1QX7 A;  5AFP A;  4XYN A;  1XFW O;  1S1E A;  4GAO A;  1DVI A;  1DJI A;  1EG3 A;  2M8U A;  3DD4 A;  2JUL A;  2KQY A;  2FCD A;  1V1F A;  2NZ0 A;  3HX4 A;  1N65 A;  2LAN A;  2K7O A;  4D1E A;  3OX5 A;  1NSH A;  2E6W A;  4M2P A;  1M45 A;  5I2O A;  4PHM A;  2O5G A;  3CR4 X;  2BL0 B;  4MEW A;  4R1E A;  2LNK A;  1TNP A;  5AER A;  1CFP A;  4NDB A;  1CMG A;  1KWO B;  1AK8 A;  1BU3 A;  1UHI A;  3RM1 A;  1R6P A;  4YBH B;  5KSZ A;  2LV7 A;  1IQ3 A;  2CT9 A;  1JBA A;  1CM1 A;  1WY9 A;  2QAC A;  2ZN9 A;  2H61 C;  5JOL A;  1XYD A;  2ZKM X;  1SR6 C;  1G33 A;  1DTL A;  1FW4 A;  2B1U A;  2COL B;  4MZL A;  1Q80 A;  1SCV A;  1AUI B;  1B47 A;  1MF8 B;  3EK8 A;  1WRL A;  2LAP A;  3DVM A;  1NX0 A;  1UWO A;  4I5L B;  2KBI A;  2KI6 C;  1WRK A;  2CBL A;  1TOP A;  2HPS A;  2L51 A;  2JQ6 A;  1KQV A;  1MXL C;  3EKH A;  1H4B A;  3NSI A;  2KI4 C;  4PHK A;  4E68 A;  3K21 A;  1L2O C;  2MRD A;  2AMI A;  2LLS A;  4ORC B;  1S6I A;  1UUR A;  3SIB A;  2LM5 A;  3AKB A;  1Y1A A;  1KK8 B;  1D1O A;  1CKK A;  1F71 A;  1IH0 A;  5ER5 A;  5AXI A;  4DIR A;  2LLT A;  4MLW A;  3SIA A;  1PK0 D;  1BT6 A;  1K96 A;  2I7A A;  3GK4 X;  1YR5 A;  3OB1 B;  4HRH A;  2JRF A;  4WRI A;  1YRU B;  1RRO A;  2WCB A;  2JNX A;  4PHN A;  1UHJ A;  3GK2 A;  3PN7 C;  3F45 A;  1DF0 B;  1F4Q A;  4MBE A;  1S5G Z;  1LIN A;  3TZ1 A;  1XFV O;  4Q04 A;  4ZCU A;  2LE9 B;  1IQ5 A;  2L4H A;  4IL1 A;  3EVV A;  1MWN A;  1DJH A;  2SAS A;  1CTR A;  5CSJ A;  3SG4 A;  3BOW B;  5AEQ A;  5TNC A;  3I5H C;  1CB1 A;  1KFX S;  3DF0 B;  2G9B A;  1QX5 B;  2EC6 C;  1SL9 A;  2K61 A;  4YGA A;  1PVB A;  1SL7 A;  3I5F C;  1JWD A;  2JXC A;  1NP8 A;  1NIW A;  2CTN A;  4NDC A;  2NXQ A;  2M0R A;  4YRU A;  1TNQ A;  3NSK A;  2GGZ A;  3BXK A;  4C0L A;  1BR1 B;  2LP3 A;  1UHK A;  2OPO A;  4CLN A;  1RWY A;  1K9P A;  3LLE A;  1S36 A;  1FPW A;  1S5G Y;  1QIV A;  1ZFS A;  3TUY C;  4A4B A;  5F6T A;  3EVR A;  1BF5 A;  1F55 A;  3VRP A;  4PE1 A;  1NX3 A;  3JTD B;  1BR4 B;  2KYC A;  2M29 A;  4M2O A;  1A75 A;  1XVJ A;  1B8L A;  1DJZ A;  2CNP A;  4PAL A;  1A29 A;  2ZRS A;  1KK8 C;  3AAJ A;  3OP0 A;  4C0K A;  3LK0 A;  1ALW A;  1KSO A;  2BKI B;  2WOR A;  1XK4 A;  3CZT X;  1J55 A;  2PMY A;  5D7F A;  1N2D A;  3TDZ A;  2Y1M A;  2FJU B;  2ISD A;  1FI5 A;  3PLF B;  3EVU A;  1AHR A;  3KEV A;  4YI8 A;  4CID A;  2I2R E;  4MZJ A;  4XJK B;  3PSR A;  3WNX B;  2AAO A;  2JT3 A;  1NPQ A;  4N1F A;  1YRT B;  4FQO A;  1B1G A;  1F4O A;  2LHL A;  3JVT B;  1DJY A;  3TS5 C;  1YX7 A;  1WDC C;  2BBM A;  3CTN A;  5HKW A;  2WC8 A;  1DJX A;  1SPY A;  4PE0 A;  1J7O A;  2BCB A;  1CLB A;  2FCE A;  5I8N A;  1QLS A;  1B8C A;  1K90 D;  2L2E A;  5B8I B;  1WRZ A;  5BPJ A;  1QS7 A;  2LP2 A;  3I5I B;  1Y1X A;  4QJ4 B;  2LLU A;  1EH2 A;  4C0J A;  2OTG B;  1LA3 A;  2KAV A;  2KGR A;  2V53 A;  3I5G B;  4MRY A;  1CLL A;  1Y0V H;  2BE4 A;  4ZCV A;  1SMG A;  2BEC A;  3KPX A;  2MJW B;  3RLZ A;  1V1G A;  1K8U A;  4OVN F;  2MA2 A;  1SCM B;  1REC A;  2JT0 A;  4N5X A;  1YUU A;  1XFY O;  3QRX A;  4ORA B;  5JJG A;  1FF1 A;  2NLN A;  3KF9 A;  2KAX A;  1DJW A;  1XFX O;  3A4U B;  5CPV A;  2BCA A;  1M46 A;  5HLV A;  2F8P A;  1XFU O;  2M1K B;  1GGZ A;  1S3P A;  3CLN A;  2LMU A;  2K7B A;  4MZK A;  1IG5 A;  3JTD C;  3SG6 A;  2JU0 A;  1TNX A;  3HCM A;  1XK4 C;  5DKQ A;  1BOC A;  1IRJ A;  1K9K A;  5HKY A;  1ALV A;  2TN4 A;  1B9A A;  2JWW A;  3DVJ A;  1BLQ A;  2LC5 A;  2MLF C;  2L0P A;  2ZFD A;  3FS7 A;  1QLK A;  3OB2 B;  1U5I B;  4MN0 A;  2ZND A;  2P6B B;  2KNE A;  4GUK A;  4CFQ A;  3PM8 A;  1R2U A;  3KHE A;  1JF2 A;  1QJT A;  2ZNE A;  1B7T Y;  1OMD A;  5CSN A;  1KK7 Y;  1KCY A;  4YGD B;  1G4Y R;  4UPG A;  1QV0 A;  4PDZ A;  1JUO A;  1B4C A;  4PE7 A;  1J7P A;  2I18 A;  3SJS A;  1QVI Y;  1LKJ A;  1QAS A;  2HF5 A;  5FYX A;  1PSB A;  4DCK A;  4DUQ A;  1NCY A;  1C7W A;  4JPZ B;  1DJG A;  5D69 A;  2OS8 B;  2ZRT A;  1CMF A;  5PAL A;  1K2H A;  1TIZ A;  3E3R A;  1DF0 A;  3CWG A;  3D0Y B;  2BL0 C;  2E30 A;  3BQ3 A;  1WLZ A;  1RFJ A;  2JNF A;  1CDP A;  2JZI A;  2M1U A;  3VRO A;  1KQM B;  2OTG C;  1KWO C;  4AOM A;  1QX2 A;  2Y5I A;  3BOW A;  1G8I A;  1AJ4 A;  2LUC A;  3IQQ A;  3LL8 B;  4GFT A;  4USL A;  3WXA A;  3TDU A;  1CLM A;  4GGN A;  1S6C A;  1LA0 A;  4GPL B;  1OZO A;  4YI9 A;  4QJ3 B;  1W7J B;  3FIA A;  1JFJ A;  1GGW A;  2AUC A;  3DF0 A;  1C07 A;  1QIW A;  2KFH A;  1RJV A;  3IF7 A;  1K94 A;  5I2L A;  2JOJ A;  1DGU A;  1SW8 A;  1CFD A;  2R2I A;  3LK1 A;  1VRK A;  2F2O A;  4GBA A;  3VRQ A;  2PRU A;  1YTZ C;  3C1V A;  1M39 A;  4DS7 A;  2LMV A;  3PFV A;  1YUR A;  1EXR A;  4MRX A;  2L98 A;  2HQ8 A;  4NQG A;  1J7R A;  1GQM A;  2I94 A;  2JTT A;  1C7V A;  1PVA A;  1YVL A;  4OKH A;  4OR9 B;  3SG2 A;  1SRA A;  4OV2 A;  1ZMZ A;  5CSF A;  1NUB A;  2M97 A;  1IJ5 A;  2KYF A;  1CFC A;  1NYA A;  2KFG A;  3ZWH A;  1SR6 B;  1SY9 A;  2IS9 A;  2LVK A;  4FTG A;  1QXP A;  1TTX A;  1YX8 A;  2KSP A;  4WQ2 A;  3OX6 A;  1TRF A;  1PRW A;  3BUM B;  2Q4U A;  1ZAC A;  3VRN A;  3AKA A;  2GV5 A;  3M0W A;  2F3Y A;  1L2O B;  3FWC A;  4PHJ A;  2PVB A;  4XJK A;  3MSE B;  2MBX A;  1MQ1 A;  1QV1 A;  2OS8 C;  1SBJ A;  4WQ3 A;  2KAY A;  2JPT A;  1PSR A;  4I5J A;  1GJY A;  4F0Z B;  3BUX B;  4HRG A;  3SG7 A;  1F70 A;  1J7Q A;  1JC2 A;  3NXA A;  1XFZ O;  1ZUZ A;  2PAS A;  1F8H A;  1LVC D;  3DVK A;  4L9M A;  5GQQ C;  1MR8 A;  3SG3 A;  4A4C A;  3VRR A;  1BJF A;  1HT9 A;  2LUX A;  2M7N A;  1TN4 A;  3CR5 X;  2QPT A;  1NCZ A;  1UP5 A;  1SKT A;  1FBV A;  3SG5 A;  4YGC B;  4MVF A;  2FOT A;  1K9U A;  2GGM A;  2BCX A;  2F33 A;  1SNL A;  3BUO B;  4HSZ A;  3PN7 B;  2BE6 A;  1B7T Z;  1KFX L;  2MLE C;  1ODB A;  1KK7 Z;  1MUX A;  1Y1U A;  1E8A A;  3EK7 A;  4PCW A;  1UUS A;  2VRG A;  1A4P A;  2KFF A;  1J1D A;  5I2Q A;  4JQ0 D;  5IBW A;  2KOT A;  2EGD A;  2L5X B;  3A8R A;  1QVI Z;  2F3Z A;  2Y4Q A;  1J1E A;  3TDI A;  1M31 A;  1OQP A;  1CDL A;  3O78 A;  1XA5 A;  1Y6W A;  2H2K A;  3I5H B;  1CNP A;  4MSP A;  4BY4 A;  2EC6 B;  1BOD A;  3WHT B;  1KFU L;  3I5F B;  1HQV A;  4P2Y B;  1TCF A;  5KTY A;  4NDD A;  2KBM A;  4QJ5 B;  1TCO B;  1UHN A;  2KQ6 A;  2WCE A;  1SYM A;  3IQO A;  4CPV A;  1IJ6 A;  2LVI A;  2M49 B;  1JF0 A;  5HLO A;  5HYD A;  2F2P A;  1A03 A;  2HET A;  2JT8 A;  1U5I A;  1X02 A;  1DT7 B;  1K95 A;  3TUY B;  3H4S E;  1YUS A;  1W7I B;  5ER4 X;  4YGE B;  4GGF C;  2Y1N A;  3JVT C;  3CR2 A;  2A4J A;  3NSO A;  1FI6 A;  1EJ3 A;  1S6J A;  2JC2 A;  2RGI A;  4PE4 A;  1SL8 A;  3DVE A;  1NWD A;  1M63 B;  5DKR A;  4DRW A;  2EHB A;  1QAT A;  2LCP A;  1TNW A;  2K2F A;  2M9G A;  3I5I C;  2KGB C;  1NX2 A;  4HRE E;  2LVJ A;  1OE9 B;  3OHM B;  1DMO A;  2BKH B;  1YUT A;  1F54 A;  2NCP A;  1NX1 A;  2KHN A;  3D10 A;  1OSA A;  2O60 A;  3D0Y A;  1EL4 A;  3I5G C;  3LCP C;  1OMR A;  1UHH A;  2K7C A;  3EKJ A;  4JWQ A;  4AQJ A;  4CFR A;  1IGV A;  2K7D A;  2BBN A;  1H8B A;  3AAK A;  1SCM C;  1IWQ A;  2K0J A;  2LHI A;  3O6B A;  1RTP 1;  1CFF A;  1QTX A;  2PAL A;  2MHH A;  2LMT A;  3CS1 A;  3TS5 B;  1AP4 A;  1WDC B;  2D8N A;  1KSM A;  5G08 A;  3PAL A;  1CM4 A;  3GK1 A;  3GOF A;  4OCI A;  4TNC A;  2G2B A;  2CXJ A;  1YVH A;  3VGO A;  1L7Z A;  2WND A;  2ZN8 A;  1BG1 A;  2WCF A;  1LXF C;  1JFK A;  4N1G A;  2L4I A;  1PUL A;  1JSA A;  2M7L A;  1CDN A;  3O4Y A;  1K93 D;  3FWB A;  1OOJ A;  1B8R A;  1SK6 D;  5HKZ A;  2PSR A;  3BYA A;  5AAN A;  3CGA A;  1OMV A;  1NCX A;  3O2P A;  3PAT A;  4U8D A;  2Q91 A;  1KFU S;  1MHO A;  1XO5 A;  1N0Y A;  2CCM A;  2H61 A;  1OZS A;  1A75 B;  2WOS A;  3WHU B;  3EK4 A;  1DGV A;  4I5K A;  4ICB A;  1AJ5 A;  2K2A A;  2DOQ A;  4AQI A;  2MAZ A;  3KO0 A;  2JXL A;  1RK9 A;  2K8M B;  5DKN A;  1BMO A;  2JTZ A;  4ETO A;  3ICB A;  1AVS A;  2LVV A;  2KI4 B;  2L50 A;  1EG4 A;  2SCP A;  3ZNI A;  3NSL A;  4YGB B;  2KDH A;  4ORB B;  4M2Q A;  1S26 D;  2HQW A;  5CSI A;  4GGF A;  1WLM A;  2NCO A;  4I5N B;  3BUN B;  4BY5 A;  5J3X A;  1MXE A;  1IKU A;  1PAL A;  5KU1 A;  2KI6 D;  1KQM C;  5K89 A;  1CDM A;  4P5O E;  1A2X A;  2M3W A;  1ZOT B; 
#chains in the Genus database with same CATH topology
 3BUW B;  4GNK B;  1QX7 A;  5AFP A;  4XYN A;  1XFW O;  2WCM A;  1S1E A;  4GAO A;  1DVI A;  4JD9 A;  1DJI A;  1EG3 A;  2M8U A;  3DD4 A;  2JUL A;  2KQY A;  1XFR A;  2FCD A;  1V1F A;  2NZ0 A;  3FE6 A;  3R1P A;  3HX4 A;  1N65 A;  2LAN A;  2K7O A;  4D1E A;  3OX5 A;  1NSH A;  2E6W A;  2FJY A;  4M2P A;  1M45 A;  5I2O A;  1OW4 A;  4PHM A;  2O5G A;  3CR4 X;  2BL0 B;  4MEW A;  4R1E A;  2LNK A;  1TNP A;  5AER A;  1CFP A;  4NDB A;  1CMG A;  1KWO B;  3BFB A;  1AK8 A;  2BAP A;  1BU3 A;  3K1E A;  1UHI A;  3RM1 A;  1R6P A;  4YBH B;  5KSZ A;  2LV7 A;  1IQ3 A;  2CT9 A;  1JBA A;  1CM1 A;  1WY9 A;  2QAC A;  2ZN9 A;  2H61 C;  5JOL A;  1XYD A;  2ZKM X;  1SR6 C;  3Q8I A;  1G33 A;  1DTL A;  1FW4 A;  2B1U A;  2COL B;  4MZL A;  4FQT A;  1Q80 A;  1SCV A;  1AUI B;  1B47 A;  1MF8 B;  3EK8 A;  1WRL A;  2LAP A;  2P71 A;  3DVM A;  1NX0 A;  1UWO A;  4I5L B;  5FI7 A;  3D75 A;  2QEB A;  2KBI A;  2KI6 C;  1WRK A;  2CBL A;  1TOP A;  2HPS A;  2L51 A;  2JQ6 A;  1KQV A;  1MXL C;  3EKH A;  1H4B A;  3NSI A;  2KI4 C;  4PHK A;  4E68 A;  3K21 A;  1L2O C;  2MRD A;  2AMI A;  2LLS A;  4ORC B;  1S6I A;  5FI6 A;  1UUR A;  3SIB A;  2LM5 A;  3AKB A;  1Y1A A;  1KK8 B;  1D1O A;  1CKK A;  3OGN A;  1F71 A;  1IH0 A;  5ER5 A;  3CDN A;  5AXI A;  3S0B A;  4DIR A;  2LLT A;  4MLW A;  3SIA A;  1PK0 D;  1BT6 A;  1T14 A;  3NGV A;  1K96 A;  3PM2 A;  5EL2 A;  2I7A A;  3GK4 X;  1YR5 A;  3OB1 B;  4PCW A;  2K60 A;  4HRH A;  2WCJ A;  3SS3 A;  2JRF A;  4WRI A;  1YRU B;  1RRO A;  2WCB A;  2JNX A;  4PHN A;  1UHJ A;  3GK2 A;  3PN7 C;  3F45 A;  1DF0 B;  1F4Q A;  3B88 A;  4MBE A;  1S5G Z;  1LIN A;  3TZ1 A;  1XFV O;  2H8V A;  4Q04 A;  4ZCU A;  2LE9 B;  1IQ5 A;  2L4H A;  4IL1 A;  3EVV A;  1MWN A;  1DJH A;  2SAS A;  1CTR A;  5CSJ A;  3SG4 A;  3BOW B;  3B87 A;  1TUJ A;  5AEQ A;  5TNC A;  3I5H C;  1CB1 A;  1KFX S;  3DF0 B;  3DYE A;  2G9B A;  1QX5 B;  2EC6 C;  1SL9 A;  2K61 A;  2KPH A;  1PVB A;  4YGA A;  1SL7 A;  3I5F C;  1JWD A;  3B7A A;  2JXC A;  1NP8 A;  1NIW A;  2CTN A;  4NDC A;  2NXQ A;  2M0R A;  4YRU A;  1TNQ A;  3NSK A;  2GGZ A;  3BXK A;  4C0L A;  3RZS A;  3S0D A;  1BR1 B;  2LP3 A;  1UHK A;  2OPO A;  3D77 A;  1RWY A;  4IJ7 A;  4CLN A;  1K9P A;  3LLE A;  1S36 A;  2QEH A;  3BFA A;  1FPW A;  1S5G Y;  1QIV A;  1ZFS A;  3TUY C;  4A4B A;  5F6T A;  3EVR A;  1BF5 A;  1OOH A;  3SS4 A;  3VRP A;  1F55 A;  4PE1 A;  1NX3 A;  3JTD B;  1BR4 B;  2KYC A;  2M29 A;  4M2O A;  1A75 A;  1XVJ A;  1B8L A;  1DJZ A;  2CNP A;  4PAL A;  1A29 A;  1OOI X;  2ZRS A;  1KK8 C;  3AAJ A;  3OP0 A;  3SS5 A;  3LK0 A;  2L5Y A;  4C0K A;  1ALW A;  1KSO A;  2BKI B;  2WOR A;  1P28 A;  1XK4 A;  3CZT X;  1J55 A;  2PMY A;  5D7F A;  3NHI A;  3FE8 A;  1N2D A;  3EG5 B;  3TDZ A;  2Y1M A;  2FJU B;  5FI2 A;  2ISD A;  3PLF B;  1FI5 A;  3EVU A;  1AHR A;  3KEV A;  4YI8 A;  4CID A;  2I2R E;  4MZJ A;  4XJK B;  3PSR A;  3WNX B;  2AAO A;  2JT3 A;  1NPQ A;  4N1F A;  3CZ0 A;  1YRT B;  4FQO A;  1B1G A;  2WCK A;  1F4O A;  2LHL A;  3JVT B;  1DJY A;  3TS5 C;  1YX7 A;  1WDC C;  3B6X A;  2BBM A;  3CTN A;  3N7H A;  2WC8 A;  1DJX A;  1SPY A;  2KLE A;  4PE0 A;  2BCB A;  5HKW A;  1J7O A;  2FCE A;  5I8N A;  1QLS A;  1B8C A;  1K90 D;  2L2E A;  5B8I B;  1DQE A;  1WRZ A;  5BPJ A;  1QS7 A;  2LP2 A;  3CAB A;  3I5I B;  1Y1X A;  3S0E A;  4QJ4 B;  4OZD A;  3D74 A;  3S0F A;  2LLU A;  1EH2 A;  4C0J A;  2OTG B;  1LA3 A;  2KAV A;  2KGR A;  2P70 A;  2V53 A;  3I5G B;  4MRY A;  1CLL A;  1Y0V H;  2BE4 A;  1ORG A;  4ZCV A;  1SMG A;  2BEC A;  3KPX A;  2MJW B;  3RLZ A;  1V1G A;  1K8U A;  4OVN F;  3B86 A;  2MA2 A;  1SCM B;  1REC A;  2QDI A;  2JT0 A;  4N5X A;  1YUU A;  1XFY O;  3QRX A;  4ORA B;  5D3O A;  5JJG A;  1FF1 A;  2NLN A;  3KF9 A;  2KAX A;  1DJW A;  1XFX O;  3A4U B;  3OBV A;  4F7F A;  5CPV A;  2BCA A;  1M46 A;  5HLV A;  3UO9 A;  1TWO A;  2F8P A;  1XFU O;  2M1K B;  1GGZ A;  1S3P A;  3CLN A;  2LMU A;  2K7B A;  4MZK A;  1IG5 A;  3JTD C;  3SG6 A;  2JU0 A;  1TNX A;  3HCM A;  1XK4 C;  1CLB A;  5DKQ A;  1BOC A;  1IRJ A;  1K9K A;  5HKY A;  1ALV A;  2TN4 A;  1B9A A;  1W9Z A;  2JWW A;  3DVJ A;  1BLQ A;  2LC5 A;  1DEK A;  2MLF C;  2L0P A;  2ZFD A;  2WC5 A;  1QLK A;  3FS7 A;  3OB2 B;  1U5I B;  4MN0 A;  2ZND A;  2P6B B;  2KNE A;  4GUK A;  4CFQ A;  3PM8 A;  1R2U A;  3KHE A;  1JF2 A;  1QJT A;  2ZNE A;  1B7T Y;  1OMD A;  5CSN A;  1KK7 Y;  1KCY A;  4YGD B;  1G4Y R;  4UPG A;  1QV0 A;  4PDZ A;  1JUO A;  1B4C A;  4PE7 A;  1J7P A;  2I18 A;  3SJS A;  1QVI Y;  1LKJ A;  1QAS A;  2HF5 A;  3S0A A;  5FYX A;  1PSB A;  4DCK A;  1OOG A;  4DUQ A;  1NCY A;  1C7W A;  4JPZ B;  1DJG A;  5D69 A;  2OS8 B;  2ZRT A;  1CMF A;  5PAL A;  1K2H A;  1TIZ A;  3R1O A;  3E3R A;  1DF0 A;  3CWG A;  3BFH A;  3D0Y B;  2BL0 C;  2E30 A;  3BQ3 A;  2BNX A;  1WLZ A;  1RFJ A;  2JNF A;  1CDP A;  2JZI A;  2M1U A;  3VRO A;  1KQM B;  2OTG C;  1KWO C;  4AOM A;  1QX2 A;  2Y5I A;  3D78 A;  3BOW A;  1G8I A;  1AJ4 A;  2LUC A;  3IQQ A;  3LL8 B;  3R72 A;  4GFT A;  4USL A;  3WXA A;  3TDU A;  1CLM A;  4GGN A;  1S6C A;  1LA0 A;  4GPL B;  1OZO A;  4YI9 A;  4QJ3 B;  1W7J B;  3FIA A;  1JFJ A;  1GGW A;  2AUC A;  3DF0 A;  1C07 A;  1QIW A;  2KFH A;  1RJV A;  3IF7 A;  1K94 A;  2YGU A;  5I2L A;  2JOJ A;  1DGU A;  1SW8 A;  1CFD A;  2R2I A;  3LK1 A;  1VRK A;  2F2O A;  4GBA A;  3VRQ A;  2PRU A;  1DEL A;  1YTZ C;  1M39 A;  3C1V A;  4DS7 A;  2LMV A;  3PFV A;  1YUR A;  1EXR A;  1Z4H A;  3FE9 A;  4MRX A;  2L98 A;  2HQ8 A;  4NQG A;  1J7R A;  1GQM A;  2I94 A;  2JTT A;  1C7V A;  1PVA A;  1YVL A;  4OKH A;  4OR9 B;  3SG2 A;  1SRA A;  4OV2 A;  1ZMZ A;  5CSF A;  1NUB A;  2M97 A;  1IJ5 A;  2KYF A;  1CFC A;  1NYA A;  2KFG A;  3ZWH A;  1SR6 B;  1SY9 A;  2IS9 A;  2LVK A;  4FTG A;  1QXP A;  1TTX A;  1YX8 A;  2PQL A;  2KSP A;  4WQ2 A;  3OX6 A;  1TRF A;  1PRW A;  3BUM B;  2Q4U A;  1ZAC A;  3VRN A;  3AKA A;  2GV5 A;  3M0W A;  2F3Y A;  3QME A;  1L2O B;  3FWC A;  4PHJ A;  2PVB A;  4XJK A;  3MSE B;  3D76 A;  2MBX A;  1MQ1 A;  1QV1 A;  2OS8 C;  1SBJ A;  4WQ3 A;  3VB1 A;  5I94 A;  2KAY A;  2JPT A;  1PSR A;  4I5J A;  1GJY A;  4F0Z B;  3BUX B;  4HRG A;  3SG7 A;  1F70 A;  1J7Q A;  2L2C A;  3NXA A;  1XFZ O;  1ZUZ A;  1JC2 A;  2PAS A;  1F8H A;  1LVC D;  3CZ2 A;  3DVK A;  4L9M A;  3DXL A;  5GQQ C;  1MR8 A;  3SG3 A;  4A4C A;  3CZ1 A;  3VRR A;  1BJF A;  3UNW A;  1HT9 A;  2LUX A;  2M7N A;  3L4L A;  1TN4 A;  3CR5 X;  3NHT A;  2QPT A;  3V2L A;  1NCZ A;  1UP5 A;  1SKT A;  1C3Z A;  1FBV A;  3SG5 A;  4YGC B;  4MVF A;  2FOT A;  1K9U A;  2GGM A;  2GTE A;  2BCX A;  2F33 A;  1SNL A;  3BUO B;  4HSZ A;  3PN7 B;  1B7T Z;  1KFX L;  2BE6 A;  2MLE C;  1ODB A;  1KK7 Z;  1MUX A;  1Y1U A;  1E8A A;  3DZT A;  3EK7 A;  1UUS A;  2VRG A;  1A4P A;  2KFF A;  1J1D A;  5I2Q A;  4JQ0 D;  5IBW A;  2KOT A;  2EGD A;  2L5X B;  3A8R A;  1QVI Z;  2F3Z A;  2Y4Q A;  1J1E A;  2JPO A;  3TDI A;  1M31 A;  1OQP A;  1CDL A;  1OOF A;  1XA5 A;  2WC6 A;  1Y6W A;  2WCH A;  2H2K A;  3I5H B;  3O78 A;  1CNP A;  4MSP A;  4BY4 A;  2EC6 B;  1BOD A;  1TUZ A;  3WHT B;  1KFU L;  1QWV A;  3I5F B;  1HQV A;  4P2Y B;  1TCF A;  5KTY A;  4NDD A;  2KBM A;  4QJ5 B;  1TCO B;  1UHN A;  2KQ6 A;  2WCE A;  1SYM A;  3IQO A;  4CPV A;  1IJ6 A;  2LVI A;  2M49 B;  1JF0 A;  5HLO A;  5HYD A;  2F2P A;  1A03 A;  2HET A;  2JT8 A;  1U5I A;  1X02 A;  1DT7 B;  1K95 A;  3TUY B;  3H4S E;  1YUS A;  1W7I B;  5ER4 X;  4YGE B;  4GGF C;  2Y1N A;  3JVT C;  3CR2 A;  2A4J A;  3NSO A;  1Z2C B;  3R1V A;  1FI6 A;  1EJ3 A;  1S6J A;  2JC2 A;  2RGI A;  4PE4 A;  1SL8 A;  3DVE A;  1NWD A;  3S0G A;  1M63 B;  3PJI A;  5DKR A;  5DIC A;  4DRW A;  2EHB A;  1QAT A;  2LCP A;  1TNW A;  2K2F A;  2M9G A;  3I5I C;  2KGB C;  1NX2 A;  4HRE E;  2LVJ A;  1OE9 B;  3OHM B;  1DMO A;  2BKH B;  2WCL A;  4PT1 A;  1YUT A;  1GM0 A;  1F54 A;  2NCP A;  1NX1 A;  2KHN A;  3DY9 A;  3D10 A;  1OSA A;  2O60 A;  3D0Y A;  1EL4 A;  3I5G C;  3LCP C;  1OMR A;  1UHH A;  2K7C A;  3EKJ A;  4JWQ A;  4AQJ A;  4CFR A;  1IGV A;  2K7D A;  2BBN A;  4INW A;  1H8B A;  3AAK A;  1SCM C;  1IWQ A;  2K0J A;  2LHI A;  3O6B A;  1RTP 1;  1CFF A;  1QTX A;  2PAL A;  2ERB A;  2MHH A;  2LMT A;  2QEO A;  3CS1 A;  3TS5 B;  1AP4 A;  1WDC B;  2D8N A;  1KSM A;  5G08 A;  3PAL A;  3O4X A;  1CM4 A;  3GK1 A;  3GOF A;  4OCI A;  4TNC A;  2PYQ A;  2G2B A;  2CXJ A;  1YVH A;  3VGO A;  1L7Z A;  2WND A;  2ZN8 A;  1BG1 A;  1C3Y A;  2WCF A;  1SSE B;  1LXF C;  1JFK A;  4N1G A;  2KLD A;  2L4I A;  1PUL A;  1JSA A;  2QEV A;  2M7L A;  1CDN A;  3O4Y A;  3CYZ A;  1K93 D;  3FWB A;  1OOJ A;  1B8R A;  1SK6 D;  5HKZ A;  2PSR A;  3BYA A;  4KYN A;  3L4A A;  5AAN A;  1LS8 A;  3CGA A;  1OMV A;  1NCX A;  3O2P A;  3PAT A;  4U8D A;  2Q91 A;  1KFU S;  1MHO A;  1XO5 A;  1N0Y A;  2CCM A;  2H61 A;  4INX A;  1OZS A;  1A75 B;  2WOS A;  3WHU B;  3EK4 A;  1DGV A;  4I5K A;  4ICB A;  1AJ5 A;  2K2A A;  2DOQ A;  3IVT A;  3BJH A;  4AQI A;  2MAZ A;  3D73 A;  2JXL A;  1RK9 A;  2K8M B;  3KO0 A;  1BMO A;  2JTZ A;  4JKT A;  3ICB A;  1AVS A;  5DKN A;  4ETO A;  2LVV A;  2KI4 B;  2L50 A;  1EG4 A;  1DC1 A;  2SCP A;  3ZNI A;  3NSL A;  4YGB B;  2KDH A;  4ORB B;  4M2Q A;  1S26 D;  2HQW A;  3L47 A;  5CSI A;  4GGF A;  1IIO A;  1WLM A;  2NCO A;  4I5N B;  3BUN B;  4BY5 A;  5J3X A;  1MXE A;  1IKU A;  1PAL A;  5KU1 A;  2KI6 D;  1KQM C;  5K89 A;  1CDM A;  4P5O E;  5HL1 A;  1A2X A;  2M3W A;  1ZOT B; 
#chains in the Genus database with same CATH homology
 3BUW B;  4GNK B;  1QX7 A;  5AFP A;  4XYN A;  1XFW O;  1S1E A;  4GAO A;  1DVI A;  1DJI A;  1EG3 A;  2M8U A;  3DD4 A;  2JUL A;  2KQY A;  2FCD A;  1V1F A;  2NZ0 A;  3HX4 A;  1N65 A;  2LAN A;  2K7O A;  4D1E A;  3OX5 A;  1NSH A;  2E6W A;  4M2P A;  1M45 A;  5I2O A;  4PHM A;  2O5G A;  3CR4 X;  2BL0 B;  4MEW A;  4R1E A;  2LNK A;  1TNP A;  5AER A;  1CFP A;  4NDB A;  1CMG A;  1KWO B;  1AK8 A;  1BU3 A;  1UHI A;  3RM1 A;  1R6P A;  4YBH B;  5KSZ A;  2LV7 A;  1IQ3 A;  2CT9 A;  1JBA A;  1CM1 A;  1WY9 A;  2QAC A;  2ZN9 A;  2H61 C;  5JOL A;  1XYD A;  2ZKM X;  1SR6 C;  1G33 A;  1DTL A;  1FW4 A;  2B1U A;  2COL B;  4MZL A;  1Q80 A;  1SCV A;  1AUI B;  1B47 A;  1MF8 B;  3EK8 A;  1WRL A;  2LAP A;  3DVM A;  1NX0 A;  1UWO A;  4I5L B;  2KBI A;  2KI6 C;  1WRK A;  2CBL A;  1TOP A;  2HPS A;  2L51 A;  2JQ6 A;  1KQV A;  1MXL C;  3EKH A;  1H4B A;  3NSI A;  2KI4 C;  4PHK A;  4E68 A;  3K21 A;  1L2O C;  2MRD A;  2AMI A;  2LLS A;  4ORC B;  1S6I A;  1UUR A;  3SIB A;  2LM5 A;  3AKB A;  1Y1A A;  1KK8 B;  1D1O A;  1CKK A;  1F71 A;  1IH0 A;  5ER5 A;  5AXI A;  4DIR A;  2LLT A;  4MLW A;  3SIA A;  1PK0 D;  1BT6 A;  1K96 A;  2I7A A;  3GK4 X;  1YR5 A;  3OB1 B;  4HRH A;  2JRF A;  4WRI A;  1YRU B;  1RRO A;  2WCB A;  2JNX A;  4PHN A;  1UHJ A;  3GK2 A;  3PN7 C;  3F45 A;  1DF0 B;  1F4Q A;  4MBE A;  1S5G Z;  1LIN A;  3TZ1 A;  1XFV O;  4Q04 A;  4ZCU A;  2LE9 B;  1IQ5 A;  2L4H A;  4IL1 A;  3EVV A;  1MWN A;  1DJH A;  2SAS A;  1CTR A;  5CSJ A;  3SG4 A;  3BOW B;  5AEQ A;  5TNC A;  3I5H C;  1CB1 A;  1KFX S;  3DF0 B;  2G9B A;  1QX5 B;  2EC6 C;  1SL9 A;  2K61 A;  4YGA A;  1PVB A;  1SL7 A;  3I5F C;  1JWD A;  2JXC A;  1NP8 A;  1NIW A;  2CTN A;  4NDC A;  2NXQ A;  2M0R A;  4YRU A;  1TNQ A;  3NSK A;  2GGZ A;  3BXK A;  4C0L A;  1BR1 B;  2LP3 A;  1UHK A;  2OPO A;  4CLN A;  1RWY A;  1K9P A;  3LLE A;  1S36 A;  1FPW A;  1S5G Y;  1QIV A;  1ZFS A;  3TUY C;  4A4B A;  5F6T A;  3EVR A;  1BF5 A;  1F55 A;  3VRP A;  4PE1 A;  1NX3 A;  3JTD B;  1BR4 B;  2KYC A;  2M29 A;  4M2O A;  1A75 A;  1XVJ A;  1B8L A;  1DJZ A;  2CNP A;  4PAL A;  1A29 A;  2ZRS A;  1KK8 C;  3AAJ A;  3OP0 A;  4C0K A;  3LK0 A;  1ALW A;  1KSO A;  2BKI B;  2WOR A;  1XK4 A;  3CZT X;  1J55 A;  2PMY A;  5D7F A;  1N2D A;  3TDZ A;  2Y1M A;  2FJU B;  2ISD A;  1FI5 A;  3PLF B;  3EVU A;  1AHR A;  3KEV A;  4YI8 A;  4CID A;  2I2R E;  4MZJ A;  4XJK B;  3PSR A;  3WNX B;  2AAO A;  2JT3 A;  1NPQ A;  4N1F A;  1YRT B;  4FQO A;  1B1G A;  1F4O A;  2LHL A;  3JVT B;  1DJY A;  3TS5 C;  1YX7 A;  1WDC C;  2BBM A;  3CTN A;  5HKW A;  2WC8 A;  1DJX A;  1SPY A;  4PE0 A;  1J7O A;  2BCB A;  1CLB A;  2FCE A;  5I8N A;  1QLS A;  1B8C A;  1K90 D;  2L2E A;  5B8I B;  1WRZ A;  5BPJ A;  1QS7 A;  2LP2 A;  3I5I B;  1Y1X A;  4QJ4 B;  2LLU A;  1EH2 A;  4C0J A;  2OTG B;  1LA3 A;  2KAV A;  2KGR A;  2V53 A;  3I5G B;  4MRY A;  1CLL A;  1Y0V H;  2BE4 A;  4ZCV A;  1SMG A;  2BEC A;  3KPX A;  2MJW B;  3RLZ A;  1V1G A;  1K8U A;  4OVN F;  2MA2 A;  1SCM B;  1REC A;  2JT0 A;  4N5X A;  1YUU A;  1XFY O;  3QRX A;  4ORA B;  5JJG A;  1FF1 A;  2NLN A;  3KF9 A;  2KAX A;  1DJW A;  1XFX O;  3A4U B;  5CPV A;  2BCA A;  1M46 A;  5HLV A;  2F8P A;  1XFU O;  2M1K B;  1GGZ A;  1S3P A;  3CLN A;  2LMU A;  2K7B A;  4MZK A;  1IG5 A;  3JTD C;  3SG6 A;  2JU0 A;  1TNX A;  3HCM A;  1XK4 C;  5DKQ A;  1BOC A;  1IRJ A;  1K9K A;  5HKY A;  1ALV A;  2TN4 A;  1B9A A;  2JWW A;  3DVJ A;  1BLQ A;  2LC5 A;  2MLF C;  2L0P A;  2ZFD A;  3FS7 A;  1QLK A;  3OB2 B;  1U5I B;  4MN0 A;  2ZND A;  2P6B B;  2KNE A;  4GUK A;  4CFQ A;  3PM8 A;  1R2U A;  3KHE A;  1JF2 A;  1QJT A;  2ZNE A;  1B7T Y;  1OMD A;  5CSN A;  1KK7 Y;  1KCY A;  4YGD B;  1G4Y R;  4UPG A;  1QV0 A;  4PDZ A;  1JUO A;  1B4C A;  4PE7 A;  1J7P A;  2I18 A;  3SJS A;  1QVI Y;  1LKJ A;  1QAS A;  2HF5 A;  5FYX A;  1PSB A;  4DCK A;  4DUQ A;  1NCY A;  1C7W A;  4JPZ B;  1DJG A;  5D69 A;  2OS8 B;  2ZRT A;  1CMF A;  5PAL A;  1K2H A;  1TIZ A;  3E3R A;  1DF0 A;  3CWG A;  3D0Y B;  2BL0 C;  2E30 A;  3BQ3 A;  1WLZ A;  1RFJ A;  2JNF A;  1CDP A;  2JZI A;  2M1U A;  3VRO A;  1KQM B;  2OTG C;  1KWO C;  4AOM A;  1QX2 A;  2Y5I A;  3BOW A;  1G8I A;  1AJ4 A;  2LUC A;  3IQQ A;  3LL8 B;  4GFT A;  4USL A;  3WXA A;  3TDU A;  1CLM A;  4GGN A;  1S6C A;  1LA0 A;  4GPL B;  1OZO A;  4YI9 A;  4QJ3 B;  1W7J B;  3FIA A;  1JFJ A;  1GGW A;  2AUC A;  3DF0 A;  1C07 A;  1QIW A;  2KFH A;  1RJV A;  3IF7 A;  1K94 A;  5I2L A;  2JOJ A;  1DGU A;  1SW8 A;  1CFD A;  2R2I A;  3LK1 A;  1VRK A;  2F2O A;  4GBA A;  3VRQ A;  2PRU A;  1YTZ C;  3C1V A;  1M39 A;  4DS7 A;  2LMV A;  3PFV A;  1YUR A;  1EXR A;  4MRX A;  2L98 A;  2HQ8 A;  4NQG A;  1J7R A;  1GQM A;  2I94 A;  2JTT A;  1C7V A;  1PVA A;  1YVL A;  4OKH A;  4OR9 B;  3SG2 A;  1SRA A;  4OV2 A;  1ZMZ A;  5CSF A;  1NUB A;  2M97 A;  1IJ5 A;  2KYF A;  1CFC A;  1NYA A;  2KFG A;  3ZWH A;  1SR6 B;  1SY9 A;  2IS9 A;  2LVK A;  4FTG A;  1QXP A;  1TTX A;  1YX8 A;  2KSP A;  4WQ2 A;  3OX6 A;  1TRF A;  1PRW A;  3BUM B;  2Q4U A;  1ZAC A;  3VRN A;  3AKA A;  2GV5 A;  3M0W A;  2F3Y A;  1L2O B;  3FWC A;  4PHJ A;  2PVB A;  4XJK A;  3MSE B;  2MBX A;  1MQ1 A;  1QV1 A;  2OS8 C;  1SBJ A;  4WQ3 A;  2KAY A;  2JPT A;  1PSR A;  4I5J A;  1GJY A;  4F0Z B;  3BUX B;  4HRG A;  3SG7 A;  1F70 A;  1J7Q A;  1JC2 A;  3NXA A;  1XFZ O;  1ZUZ A;  2PAS A;  1F8H A;  1LVC D;  3DVK A;  4L9M A;  5GQQ C;  1MR8 A;  3SG3 A;  4A4C A;  3VRR A;  1BJF A;  1HT9 A;  2LUX A;  2M7N A;  1TN4 A;  3CR5 X;  2QPT A;  1NCZ A;  1UP5 A;  1SKT A;  1FBV A;  3SG5 A;  4YGC B;  4MVF A;  2FOT A;  1K9U A;  2GGM A;  2BCX A;  2F33 A;  1SNL A;  3BUO B;  4HSZ A;  3PN7 B;  2BE6 A;  1B7T Z;  1KFX L;  2MLE C;  1ODB A;  1KK7 Z;  1MUX A;  1Y1U A;  1E8A A;  3EK7 A;  4PCW A;  1UUS A;  2VRG A;  1A4P A;  2KFF A;  1J1D A;  5I2Q A;  4JQ0 D;  5IBW A;  2KOT A;  2EGD A;  2L5X B;  3A8R A;  1QVI Z;  2F3Z A;  2Y4Q A;  1J1E A;  3TDI A;  1M31 A;  1OQP A;  1CDL A;  3O78 A;  1XA5 A;  1Y6W A;  2H2K A;  3I5H B;  1CNP A;  4MSP A;  4BY4 A;  2EC6 B;  1BOD A;  3WHT B;  1KFU L;  3I5F B;  1HQV A;  4P2Y B;  1TCF A;  5KTY A;  4NDD A;  2KBM A;  4QJ5 B;  1TCO B;  1UHN A;  2KQ6 A;  2WCE A;  1SYM A;  3IQO A;  4CPV A;  1IJ6 A;  2LVI A;  2M49 B;  1JF0 A;  5HLO A;  5HYD A;  2F2P A;  1A03 A;  2HET A;  2JT8 A;  1U5I A;  1X02 A;  1DT7 B;  1K95 A;  3TUY B;  3H4S E;  1YUS A;  1W7I B;  5ER4 X;  4YGE B;  4GGF C;  2Y1N A;  3JVT C;  3CR2 A;  2A4J A;  3NSO A;  1FI6 A;  1EJ3 A;  1S6J A;  2JC2 A;  2RGI A;  4PE4 A;  1SL8 A;  3DVE A;  1NWD A;  1M63 B;  5DKR A;  4DRW A;  2EHB A;  1QAT A;  2LCP A;  1TNW A;  2K2F A;  2M9G A;  3I5I C;  2KGB C;  1NX2 A;  4HRE E;  2LVJ A;  1OE9 B;  3OHM B;  1DMO A;  2BKH B;  1YUT A;  1F54 A;  2NCP A;  1NX1 A;  2KHN A;  3D10 A;  1OSA A;  2O60 A;  3D0Y A;  1EL4 A;  3I5G C;  3LCP C;  1OMR A;  1UHH A;  2K7C A;  3EKJ A;  4JWQ A;  4AQJ A;  4CFR A;  1IGV A;  2K7D A;  2BBN A;  1H8B A;  3AAK A;  1SCM C;  1IWQ A;  2K0J A;  2LHI A;  3O6B A;  1RTP 1;  1CFF A;  1QTX A;  2PAL A;  2MHH A;  2LMT A;  3CS1 A;  3TS5 B;  1AP4 A;  1WDC B;  2D8N A;  1KSM A;  5G08 A;  3PAL A;  1CM4 A;  3GK1 A;  3GOF A;  4OCI A;  4TNC A;  2G2B A;  2CXJ A;  1YVH A;  3VGO A;  1L7Z A;  2WND A;  2ZN8 A;  1BG1 A;  2WCF A;  1LXF C;  1JFK A;  4N1G A;  2L4I A;  1PUL A;  1JSA A;  2M7L A;  1CDN A;  3O4Y A;  1K93 D;  3FWB A;  1OOJ A;  1B8R A;  1SK6 D;  5HKZ A;  2PSR A;  3BYA A;  5AAN A;  3CGA A;  1OMV A;  1NCX A;  3O2P A;  3PAT A;  4U8D A;  2Q91 A;  1KFU S;  1MHO A;  1XO5 A;  1N0Y A;  2CCM A;  2H61 A;  1OZS A;  1A75 B;  2WOS A;  3WHU B;  3EK4 A;  1DGV A;  4I5K A;  4ICB A;  1AJ5 A;  2K2A A;  2DOQ A;  4AQI A;  2MAZ A;  3KO0 A;  2JXL A;  1RK9 A;  2K8M B;  5DKN A;  1BMO A;  2JTZ A;  4ETO A;  3ICB A;  1AVS A;  2LVV A;  2KI4 B;  2L50 A;  1EG4 A;  2SCP A;  3ZNI A;  3NSL A;  4YGB B;  2KDH A;  4ORB B;  4M2Q A;  1S26 D;  2HQW A;  5CSI A;  4GGF A;  1WLM A;  2NCO A;  4I5N B;  3BUN B;  4BY5 A;  5J3X A;  1MXE A;  1IKU A;  1PAL A;  5KU1 A;  2KI6 D;  1KQM C;  5K89 A;  1CDM A;  4P5O E;  1A2X A;  2M3W A;  1ZOT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...