1F54A

Solution structure of the apo n-terminal domain of yeast calmodulin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f54A00
1CLLA 1WLMA 1ZFSA 1CLBA 1QXPA 2SCPA 1B9AA 1VRKA 4PCWA 2G2BA 2PVBA 2WC8A 3BUXB 3M0WA 1CDLA 1NP8A 2M8UA 2ZKMX 1NIWA 4ETOA 3FIAA 1WRLA 4NDCA 4M2QA 1DGVA 4QJ4B 1U5IA 3PN7B 2BECA 3I5GC 4YI8A 1Y1XA 1L2OC 1MXLC 2KAVA 3JVTC 1B8RA 3D0YA 2I7AA 1DVIA 1QV1A 1F55A 2JTTA 1Q80A 1S36A 2F3ZA 2JULA 3D10A 2CT9A 4GBAA 1YUSA 1SNLA 3EK4A 1MWNA 4CFQA 2COLB 2F8PA 1M63B 2KFFA 4GGFC 1TNPA 1M45A 2CTNA 4YGBB 1CFPA 5I2LA 2NCOA 2JWWA 3K21A 1CFCA 4D1EA 5K89A 1DJYA 1QVIY 1KQVA 3CR4X 5HKYA 1KFUL 3I5HC 1C7VA 4PE7A 1LA0A 2KI4B 1KK7Z 1ZOTB 1YVHA 1TNWA 2GGZA 3I5FB 3IF7A 3ZWHA 1KFXL 2KAXA 1K9PA 2LMUA 5CSFA 1F8HA 1TN4A 2K7CA 2MBXA 1DJHA 1CTRA 4MN0A 1XFUO 2K7BA 2F33A 1UURA 4PHNA 4PE0A 3GK2A 2BL0C 1V1FA 1OSAA 2LM5A 3WNXB 1K95A 2VRGA 2LMVA 3AAKA 4MLWA 2JT8A 4UPGA 2JNFA 4P5OE 1QX7A 3I5GB 3NXAA 4DCKA 1L7ZA 3JVTB 3VGOA 2JQ6A 1NCXA 2ZNDA 4M2PA 3TDIA 2Y1NA 1WRZA 1ZUZA 3OB2B 3CZTX 4N1GA 1Y6WA 1CM4A 1BT6A 2JXLA 1SRAA 2H2KA 4WQ2A 1S5GZ 3BUWB 1B7TY 2QACA 2M7LA 4YGEB 1KSOA 2PASA 1M39A 5CPVA 2PMYA 4A4CA 4CPVA 2JT3A 1CDNA 1K96A 1NX2A 2WCEA 4MZJA 4MRXA 2KYCA 2WNDA 1S6CA 5JOLA 4P2YB 3WXAA 1DT7B 1AJ4A 3BYAA 1K90D 1CMFA 1WDCB 1JUOA 1OZOA 1QTXA 3LK1A 3A8RA 1KQMC 1K93D 2BCAA 3NSKA 3NSLA 4ICBA 4PE4A 3CR2A 1YUUA 1NYAA 2H61C 2KGBC 3O2PA 4C0LA 3RLZA 2LV7A 1LA3A 2I94A 3F45A 3SG3A 1CDPA 2L51A 1K8UA 2K8MB 2BL0B 2CCMA 3MSEB 1BODA 2MHHA 4F0ZB 1SW8A 3CTNA 1XK4C 2Y1MA 2NLNA 1N2DA 4IL1A 3EK7A 1IGVA 3OB1B 5HYDA 3CS1A 2KYFA 1G4YR 2QPTA 5DKRA 4QJ3B 3KPXA 1CDMA 4GUKA 1J7QA 1F71A 2AUCA 2HETA 2JXCA 3C1VA 1TNXA 5HKWA 1EG3A 1EL4A 3WHTB 1QV0A 1NCYA 4PHMA 4JWQA 2M1KB 4YGCB 2D8NA 1AUIB 1QX5B 2E30A 1NSHA 2LVIA 2MLFC 4PDZA 2BKIB 1EH2A 1PSBA 1UHIA 2L4IA 1FBVA 3BUNB 4YI9A 1SCMC 1U5IB 1HT9A 1ZMZA 3DVKA 3SG4A 4E68A 1E8AA 1KQMB 3JTDB 1H4BA 2FCDA 3D0YB 3DVEA 1JFKA 2JZIA 1HQVA 1S6IA 5BPJA 1IJ5A 4YRUA 2H61A 1FF1A 2EC6C 2PALA 1NCZA 5PALA 1RROA 1SCVA 2BE6A 2OS8B 1KK8B 1TRFA 1YX7A 5AEQA 5TNCA 3CGAA 4ORCB 4YGDB 2EGDA 3ZNIA 3H4SE 3OP0A 3O78A 3EKJA 2LLTA 5AANA 2KDHA 1NX3A 2L4HA 3EVRA 1LINA 1WRKA 2AMIA 5FYXA 4MRYA 1XK4A 4PE1A 2KBMA 1WLZA 1JC2A 1KSMA 2ZFDA 1OMVA 1EXRA 1SR6C 1F54A 5AERA 3SIBA 3SG2A 3VRPA 5GQQC 3DVMA 4CLNA 1CFFA 1X02A 2OPOA 2LVVA 2K0JA 3SJSA 2HF5A 1QS7A 2L5XB 3BXKA 2JU0A 4JPZB 1J1DA 1LKJA 1FI5A 2JC2A 2MA2A 1MXEA 1QVIZ 1NPQA 4R1EA 1IQ5A 1EJ3A 1SPYA 2BBMA 5JJGA 1IG5A 2BCXA 1SKTA 3VROA 2ZNEA 1SCMB 1D1OA 2LC5A 2KOTA 1GQMA 4PHKA 3FS7A 1XA5A 1GGZA 2GV5A 4OR9B 2BKHB 4N5XA 5ER4X 1DJZA 2K7DA 1QASA 3DVJA 1L2OB 5HKZA 5B8IB 3OHMB 4AOMA 5ER5A 1AP4A 2HQWA 1AHRA 5AXIA 1R2UA 3HCMA 4L9MA 2B1UA 2GGMA 2LLUA 1N0YA 1MQ1A 1PSRA 1QIWA 1BG1A 3LLEA 4HREE 1UHHA 1A75B 1J55A 3CLNA 4DUQA 1F70A 1BU3A 2RGIA 2EHBA 1ODBA 3SG5A 1A75A 2I18A 3OX5A 4TNCA 2JNXA 2L2EA 4XYNA 5CSJA 1S6JA 2KQ6A 1SR6B 2F2OA 3I5HB 4OV2A 2LUXA 4AQJA 4AQIA 5I2OA 1CMGA 1SK6D 1GJYA 4GFTA 1DGUA 3TDUA 1EG4A 5DKQA 1A2XA 4GAOA 3VRNA 4BY5A 1XVJA 1LXFC 5HLOA 1JSAA 4DS7A 1JFJA 1MF8B 2G9BA 2LLSA 4MSPA 2Y4QA 2JPTA 5G08A 1CNPA 5HLVA 1YURA 1B7TZ 1A29A 2BCBA 4CFRA 2LCPA 4MEWA 5IBWA 2NZ0A 2LHIA 4WQ3A 4HSZA 4U8DA 1QATA 1YTZC 1JWDA 2MRDA 1B47A 1SL7A 1DJGA 3AAJA 4JQ0D 1IRJA 2KAYA 1IH0A 1TCOB 2KI6D 1B4CA 1BR1B 2M1UA 1PALA 2MLEC 1K94A 1YUTA 3WHUB 5CSIA 3TUYC 1QLKA 1DJXA 1A4PA 1SMGA 1NX1A 4MBEA 4BY4A 1W7IB 1R6PA 1SY9A 4GNKB 3BQ3A 1W7JB 1M46A 2Q91A 4C0KA 2LNKA 2ZN9A 5I2QA 1OQPA 2LVJA 3KF9A 1IJ6A 2AAOA 1RJVA 1H8BA 4MVFA 2BE4A 4NQGA 2CBLA 1ZACA 3O6BA 4GPLB 4ORBB 2I2RE 2KFHA 1FI6A 1K9KA 1FPWA 2MJWB 3LCPC 3PM8A 1KWOC 4HRHA 1LVCD 1XFZO 4I5KA 1OMDA 4GGNA 3IQOA 1JF0A 1SBJA 4XJKA 2ISDA 1CFDA 2FJUB 1IQ3A 1B1GA 1F4QA 1PRWA 1AVSA 2LP3A 1XFYO 3PFVA 4I5JA 1JF2A 2A4JA 3DD4A 1CM1A 3BOWB 4N1FA 3BOWA 2LVKA 1FW4A 1YX8A 5KTYA 2WOSA 1DJWA 2F2PA 2K7OA 4HRGA 1BR4B 3SIAA 3LL8B 2KNEA 2OTGC 1J7RA 2KFGA 1A03A 2SASA 2NXQA 1DJIA 5D69A 4DRWA 1BMOA 4PHJA 3FWBA 1XO5A 1Y0VH 1S3PA 2L0PA 3ICBA 2ZN8A 3PALA 1TOPA 3PATA 1ALVA 3GK4X 3PLFB 1UP5A 1XFWO 2FOTA 2KBIA 4I5LB 5CSNA 1SYMA 4ORAB 1KK7Y 2F3YA 2KGRA 3I5IC 3EVVA 2Y5IA 3TUYB 3A4UB 2LHLA 3LK0A 1UHKA 1AJ5A 2JOJA 2WCFA 3SG6A 1Y1UA 1QJTA 3DF0B 1J7PA 1DMOA 2Q4UA 1PULA 3DF0A 1TTXA 2M0RA 4C0JA 2R2IA 2M9GA 3TS5C 2HQ8A 1S1EA 2TN4A 5F6TA 1S26D 1UHJA 2JRFA 2LAPA 1SL9A 4NDBA 3EVUA 2E6WA 2PRUA 3HX4A 2KI6C 1UWOA 1KWOB 1G8IA 1WDCC 4PALA 4MZKA 1YRTB 2K2FA 3NSIA 4DIRA 4I5NB 3GK1A 2LMTA 2CNPA 1BJFA 1PVAA 4USLA 5KU1A 1BF5A 2EC6B 1V1GA 4WRIA 1TNQA 4ZCVA 2M7NA 1OE9B 2O60A 3QRXA 3SG7A 1CLMA 4FTGA 1TIZA 2K2AA 1BOCA 5DKNA 1S5GY 4OCIA 5AFPA 1NUBA 1GGWA 2OTGB 1F4OA 2HPSA 1J7OA 2LANA 4NDDA 2LE9B 4A4BA 1RFJA 2M97A 2BBNA 1MR8A 1TCFA 3CWGA 2K61A 1K9UA 1Y1AA 3CR5X 1IWQA 1PK0D 2P6BB 3EK8A 4Q04A 1XFVO 3VRRA 4OVNF 3AKBA 3I5IB 4FQOA 1M31A 2V53A 2ZRSA 1RECA 1MUXA 4ZCUA 4YGAA 2LP2A 5J3XA 2PSRA 1OZSA 2KQYA 1YRUB 3E3RA 2M49B 4GGFA 2MAZA 3TS5B 1QX2A 1YR5A 2L50A 1PVBA 1QIVA 2DOQA 2FCEA 2JTZA 3BUOB 4M2OA 1CB1A 1QLSA 1WY9A 1BLQA 3KEVA 1OMRA 3PSRA 1RWYA 3OX6A 3EKHA 2ZRTA 1KFUS 1C7WA 3PN7C 3JTDC 1XYDA 3BUMB 4QJ5B 1J1EA 3O4YA 4YBHB 1B8LA 1UHNA 1KFXS 5I8NA 2WCBA 2JT0A 2LUCA 3IQQA 2OS8C 1KK8C 2WORA 4MZLA 3RM1A 2KSPA 2KHNA 4OKHA 2IS9A 2NCPA 3NSOA 1MHOA 1ALWA 1UUSA 1RTP1 1KCYA 1B8CA 5KSZA 3VRQA 3TZ1A 1K2HA 4CIDA 3KHEA 1AK8A 2CXJA 1RK9A 1NX0A 3TDZA 1YVLA 1JBAA 1DTLA 1G33A 2M29A 1SL8A 3FWCA 1IKUA 1XFXO 1CKKA 1DF0B 1N65A 2M3WA 1OOJA 2KI4C 4XJKB 2L98A 1DF0A 3I5FC 3KO0A 1C07A 3GOFA 3AKAA 2O5GA 1NWDA 5D7FA
chains in the Genus database with same CATH superfamily
1CLLA 1WLMA 1ZFSA 1CLBA 1QXPA 2SCPA 1B9AA 1VRKA 4PCWA 2G2BA 2PVBA 2WC8A 3BUXB 3M0WA 3FE9A 1CDLA 1NP8A 2M8UA 2ZKMX 1NIWA 4JKTA 4ETOA 3FIAA 1WRLA 4NDCA 4M2QA 1DGVA 4QJ4B 1U5IA 3D73A 3PN7B 2BECA 3I5GC 4YI8A 5EL2A 1Y1XA 1L2OC 1MXLC 2KAVA 3JVTC 1B8RA 3D0YA 2I7AA 1DVIA 1QV1A 1TUZA 1F55A 2JTTA 1Q80A 2WCHA 1S36A 2F3ZA 2JULA 3D10A 2CT9A 4GBAA 1YUSA 3K1EA 1SNLA 3EK4A 1MWNA 4CFQA 2COLB 2F8PA 1M63B 2KFFA 4GGFC 1TNPA 1M45A 2CTNA 4OZDA 4YGBB 1CFPA 2P70A 2NCOA 5I2LA 2JWWA 3K21A 1CFCA 4D1EA 5K89A 1DJYA 1QVIY 1KQVA 3CR4X 5HKYA 1KFUL 3I5HC 2PQLA 1C7VA 4PE7A 1LA0A 2KI4B 1ZOTB 1KK7Z 1YVHA 1TNWA 2GGZA 3I5FB 3IF7A 3ZWHA 1XFRA 1KFXL 2KAXA 1K9PA 2LMUA 5CSFA 1F8HA 1TN4A 2K7CA 2P71A 2MBXA 1DJHA 1CTRA 4MN0A 1XFUO 2K7BA 2F33A 4PT1A 1UURA 4PHNA 4PE0A 3GK2A 2BL0C 1V1FA 1OSAA 2LM5A 3WNXB 1K95A 2VRGA 2LMVA 3AAKA 4MLWA 2JT8A 4UPGA 2JNFA 4P5OE 1QX7A 3I5GB 3NXAA 4DCKA 2L2CA 1L7ZA 3JVTB 3VGOA 2JQ6A 1NCXA 2ZNDA 4M2PA 3TDIA 2Y1NA 1WRZA 1ZUZA 3OB2B 3CZTX 4N1GA 1Y6WA 1CM4A 1BT6A 2JXLA 1SRAA 2H2KA 4WQ2A 1S5GZ 1DEKA 3S0BA 3BUWB 1B7TY 2QACA 2M7LA 4YGEB 1KSOA 4JD9A 3SS4A 2PASA 1M39A 5FI7A 5CPVA 2PMYA 4A4CA 4CPVA 2JT3A 1QWVA 1CDNA 1K96A 1NX2A 2WCEA 3R1VA 4MZJA 4MRXA 2KYCA 2WNDA 1S6CA 5JOLA 4P2YB 3UNWA 3WXAA 1DT7B 1AJ4A 3BYAA 3R1PA 1K90D 1CMFA 1WDCB 1JUOA 1OZOA 1QTXA 3LK1A 3A8RA 1KQMC 1K93D 2BCAA 2KPHA 3NSKA 3NSLA 4ICBA 4PE4A 1DC1A 3CR2A 1YUUA 1NYAA 2H61C 2KGBC 3O2PA 4C0LA 3RLZA 2LV7A 1LA3A 2I94A 3F45A 3SG3A 1CDPA 2QEBA 2L51A 1K8UA 2WCKA 2K8MB 2BL0B 2CCMA 3MSEB 1BODA 4KYNA 2QEVA 2MHHA 4F0ZB 1SW8A 3DZTA 3CTNA 1XK4C 2Y1MA 2NLNA 1N2DA 4IL1A 3EK7A 1IGVA 3OB1B 3EG5B 5HYDA 3S0DA 3CS1A 4INWA 2KYFA 1G4YR 2QPTA 5DKRA 4QJ3B 3KPXA 3DXLA 5FI2A 1CDMA 4GUKA 1J7QA 1F71A 2AUCA 3SS3A 3BFBA 2HETA 2JXCA 3C1VA 1TNXA 3L4AA 5HKWA 1EG3A 1EL4A 3WHTB 1QV0A 1NCYA 4PHMA 4JWQA 2M1KB 4YGCB 4FQTA 2D8NA 1AUIB 1QX5B 2E30A 1NSHA 2LVIA 3PJIA 2MLFC 4PDZA 2BKIB 1EH2A 1PSBA 1UHIA 2L4IA 1FBVA 3BUNB 3D75A 4YI9A 1C3YA 1SCMC 1U5IB 1HT9A 2QDIA 1ZMZA 3DVKA 3SG4A 4E68A 1E8AA 1KQMB 3JTDB 1H4BA 2FCDA 3D0YB 3DVEA 1JFKA 2JZIA 2K60A 1HQVA 1S6IA 5BPJA 1T14A 1IJ5A 4YRUA 2H61A 1FF1A 2EC6C 2PALA 1NCZA 5PALA 1RROA 1SCVA 2BE6A 2OS8B 1KK8B 1TRFA 1YX7A 5AEQA 5TNCA 3CGAA 4ORCB 4YGDB 2EGDA 3ZNIA 3H4SE 3OP0A 3O78A 3CDNA 3EKJA 2LLTA 5AANA 2KDHA 1NX3A 2L4HA 3EVRA 1LINA 1WRKA 2AMIA 3NHIA 5FYXA 4MRYA 1XK4A 4PE1A 2KBMA 1WLZA 1JC2A 1KSMA 2ZFDA 1OMVA 1EXRA 1OOFA 1SR6C 1F54A 5AERA 3SS5A 3SIBA 3SG2A 2WCLA 3VRPA 3FE6A 5GQQC 3DVMA 4CLNA 1CFFA 1X02A 2OPOA 3B7AA 2LVVA 1TWOA 2K0JA 3SJSA 2HF5A 1QS7A 2L5XB 3BXKA 2JU0A 4JPZB 1J1DA 1LKJA 1FI5A 2JC2A 2MA2A 3L4LA 1MXEA 4INXA 1QVIZ 5D3OA 1NPQA 4R1EA 1IQ5A 3IVTA 1EJ3A 1SPYA 2BBMA 3V2LA 5JJGA 1IG5A 2BCXA 1SKTA 3VROA 2ZNEA 1SCMB 1SSEB 3OGNA 1D1OA 2LC5A 2KOTA 1GQMA 4PHKA 3FS7A 1XA5A 1GGZA 2GV5A 4OR9B 2BKHB 4N5XA 5ER4X 1DJZA 2K7DA 1QASA 3DVJA 3S0GA 1L2OB 2O5GA 3B6XA 5HKZA 1LS8A 5B8IB 3OHMB 4AOMA 5ER5A 1AP4A 2HQWA 1AHRA 5AXIA 1R2UA 3HCMA 4L9MA 2B1UA 3D77A 2GGMA 2LLUA 1N0YA 1MQ1A 1PSRA 1QIWA 1BG1A 3LLEA 4HREE 5I94A 1UHHA 1A75B 1J55A 3CLNA 4DUQA 1F70A 1BU3A 2RGIA 2EHBA 1ODBA 3SG5A 1A75A 2I18A 3OX5A 4TNCA 2JNXA 2L2EA 4XYNA 5CSJA 1S6JA 2KQ6A 1SR6B 2F2OA 3I5HB 4OV2A 2LUXA 4AQJA 4AQIA 5I2OA 1CMGA 1SK6D 1GJYA 4GFTA 3S0EA 1DGUA 3TDUA 1EG4A 5DKQA 1A2XA 4GAOA 3BFAA 3VRNA 4BY5A 1XVJA 1LXFC 5HLOA 1JSAA 4DS7A 1JFJA 1MF8B 2G9BA 2LLSA 4MSPA 4F7FA 2Y4QA 2JPTA 5G08A 1CNPA 5DICA 1YURA 5HLVA 1B7TZ 1A29A 2BCBA 4CFRA 2LCPA 4MEWA 5IBWA 2NZ0A 2LHIA 3FE8A 4WQ3A 4HSZA 4U8DA 2ERBA 1QATA 1YTZC 3B88A 3PM2A 3R1OA 2MRDA 1JWDA 1B47A 3Q8IA 1SL7A 1DJGA 3DY9A 3AAJA 1GM0A 4JQ0D 1IRJA 2KAYA 3DYEA 1IH0A 1TCOB 1OOGA 2KI6D 1B4CA 2KLDA 3BJHA 1BR1B 2M1UA 1PALA 2MLEC 1K94A 1YUTA 3O4XA 3WHUB 5CSIA 3TUYC 1QLKA 2WC5A 1DJXA 1A4PA 1SMGA 1NX1A 4MBEA 4BY4A 2GTEA 1W7IB 2WCMA 1R6PA 1SY9A 4GNKB 3BQ3A 1W7JB 1M46A 2Q91A 4C0KA 2LNKA 2ZN9A 5I2QA 1OQPA 2LVJA 3KF9A 1IJ6A 2AAOA 1RJVA 1H8BA 4MVFA 2BE4A 4NQGA 2CBLA 1ZACA 3CABA 3O6BA 4GPLB 4ORBB 4IJ7A 2L5YA 2I2RE 2KFHA 1FI6A 1K9KA 1FPWA 2MJWB 3LCPC 3PM8A 1KWOC 4HRHA 1LVCD 1OOHA 1XFZO 4I5KA 1OMDA 2QEOA 4GGNA 3IQOA 1JF0A 1SBJA 4XJKA 2ISDA 1CFDA 2FJUB 1IQ3A 1B1GA 1F4QA 1W9ZA 1PRWA 1AVSA 2LP3A 1XFYO 3PFVA 4I5JA 1JF2A 2A4JA 3DD4A 1CM1A 3BOWB 4N1FA 3BOWA 2LVKA 1OW4A 1FW4A 1YX8A 2BAPA 5KTYA 2FJYA 2WOSA 2BNXA 1DJWA 2F2PA 2K7OA 3B86A 4HRGA 1BR4B 3SIAA 3LL8B 2KNEA 2OTGC 3CZ1A 1J7RA 2KFGA 1A03A 2SASA 2NXQA 1DJIA 5D69A 4DRWA 1BMOA 4PHJA 3FWBA 1XO5A 1Y0VH 1S3PA 2L0PA 3ICBA 2ZN8A 3L47A 1TOPA 3PALA 3PATA 1ALVA 3GK4X 3UO9A 3PLFB 1UP5A 1XFWO 2FOTA 2KBIA 4I5LB 5CSNA 1SYMA 4ORAB 1KK7Y 2F3YA 2KGRA 3I5IC 3EVVA 2Y5IA 3TUYB 3VB1A 2KLEA 3A4UB 2LHLA 3LK0A 1UHKA 1AJ5A 2JOJA 2WCFA 1C3ZA 3D76A 3SG6A 1Y1UA 3S0AA 1QJTA 3DF0B 1J7PA 1DMOA 2Q4UA 1PULA 3DF0A 1TTXA 2M0RA 4C0JA 2R2IA 2M9GA 3TS5C 2HQ8A 1S1EA 2TN4A 5F6TA 1S26D 1UHJA 2JRFA 2LAPA 3CZ2A 1SL9A 4NDBA 3EVUA 3D78A 2E6WA 1TUJA 2PRUA 3HX4A 2KI6C 1UWOA 1KWOB 1G8IA 1WDCC 4PALA 4MZKA 1YRTB 2K2FA 3NSIA 4DIRA 4I5NB 3GK1A 2LMTA 1DELA 2CNPA 1BJFA 1PVAA 4USLA 5KU1A 1BF5A 2EC6B 1V1GA 1OOIX 4WRIA 1TNQA 4ZCVA 2M7NA 1OE9B 2O60A 3QRXA 3N7HA 3SG7A 1CLMA 4FTGA 1TIZA 2K2AA 1BOCA 5DKNA 2JPOA 2QEHA 1S5GY 4OCIA 5AFPA 1NUBA 1GGWA 3CZ0A 2OTGB 1F4OA 1DQEA 2HPSA 1J7OA 2LANA 4NDDA 2LE9B 4A4BA 1RFJA 2M97A 3S0FA 2BBNA 1MR8A 1TCFA 3CWGA 2K61A 1K9UA 1ORGA 1Y1AA 3CR5X 1IWQA 1PK0D 2P6BB 3EK8A 4Q04A 1XFVO 3VRRA 4OVNF 3AKBA 3NGVA 3D74A 3I5IB 3R72A 4FQOA 1M31A 2V53A 2ZRSA 1RECA 1MUXA 3B87A 4ZCUA 4YGAA 2LP2A 5J3XA 3QMEA 2PSRA 1OZSA 2KQYA 1YRUB 3E3RA 2M49B 4GGFA 2MAZA 3TS5B 1QX2A 1YR5A 2L50A 1PVBA 1QIVA 2DOQA 2FCEA 2JTZA 3BUOB 4M2OA 1CB1A 3OBVA 1QLSA 1WY9A 1BLQA 3KEVA 1OMRA 3PSRA 1IIOA 1RWYA 2YGUA 3OX6A 3EKHA 2ZRTA 1KFUS 1C7WA 3PN7C 3JTDC 1XYDA 3BUMB 4QJ5B 1J1EA 5FI6A 3O4YA 4YBHB 1B8LA 1UHNA 1KFXS 5I8NA 2WCBA 2JT0A 2LUCA 3IQQA 5HL1A 2OS8C 1KK8C 2WORA 4MZLA 3RM1A 2KSPA 2KHNA 4OKHA 2IS9A 2NCPA 3CYZA 3NSOA 1MHOA 1ALWA 1UUSA 1RTP1 1KCYA 1B8CA 5KSZA 2WC6A 3VRQA 3TZ1A 1K2HA 4CIDA 3KHEA 1AK8A 2CXJA 1RK9A 1NX0A 3TDZA 1YVLA 1JBAA 1DTLA 1G33A 2M29A 1SL8A 3FWCA 1IKUA 1XFXO 1CKKA 1Z4HA 1DF0B 1N65A 2M3WA 1OOJA 3NHTA 2KI4C 4XJKB 2L98A 1DF0A 3I5FC 3BFHA 2PYQA 3KO0A 1C07A 2H8VA 3GOFA 3AKAA 3RZSA 2WCJA 1P28A 1Z2CB 1NWDA 5D7FA
chains in the Genus database with same CATH topology
1CLLA 1WLMA 1ZFSA 1CLBA 1QXPA 2SCPA 1B9AA 1VRKA 4PCWA 2G2BA 2PVBA 2WC8A 3BUXB 3M0WA 1CDLA 1NP8A 2M8UA 2ZKMX 1NIWA 4ETOA 3FIAA 1WRLA 4NDCA 4M2QA 1DGVA 4QJ4B 1U5IA 3PN7B 2BECA 3I5GC 4YI8A 1Y1XA 1L2OC 1MXLC 2KAVA 3JVTC 1B8RA 3D0YA 2I7AA 1DVIA 1QV1A 1F55A 2JTTA 1Q80A 1S36A 2F3ZA 2JULA 3D10A 2CT9A 4GBAA 1YUSA 1SNLA 3EK4A 1MWNA 4CFQA 2COLB 2F8PA 1M63B 2KFFA 4GGFC 1TNPA 1M45A 2CTNA 4YGBB 1CFPA 5I2LA 2NCOA 2JWWA 3K21A 1CFCA 4D1EA 5K89A 1DJYA 1QVIY 1KQVA 3CR4X 5HKYA 1KFUL 3I5HC 1C7VA 4PE7A 1LA0A 2KI4B 1KK7Z 1ZOTB 1YVHA 1TNWA 2GGZA 3I5FB 3IF7A 3ZWHA 1KFXL 2KAXA 1K9PA 2LMUA 5CSFA 1F8HA 1TN4A 2K7CA 2MBXA 1DJHA 1CTRA 4MN0A 1XFUO 2K7BA 2F33A 1UURA 4PHNA 4PE0A 3GK2A 2BL0C 1V1FA 1OSAA 2LM5A 3WNXB 1K95A 2VRGA 2LMVA 3AAKA 4MLWA 2JT8A 4UPGA 2JNFA 4P5OE 1QX7A 3I5GB 3NXAA 4DCKA 1L7ZA 3JVTB 3VGOA 2JQ6A 1NCXA 2ZNDA 4M2PA 3TDIA 2Y1NA 1WRZA 1ZUZA 3OB2B 3CZTX 4N1GA 1Y6WA 1CM4A 1BT6A 2JXLA 1SRAA 2H2KA 4WQ2A 1S5GZ 3BUWB 1B7TY 2QACA 2M7LA 4YGEB 1KSOA 2PASA 1M39A 5CPVA 2PMYA 4A4CA 4CPVA 2JT3A 1CDNA 1K96A 1NX2A 2WCEA 4MZJA 4MRXA 2KYCA 2WNDA 1S6CA 5JOLA 4P2YB 3WXAA 1DT7B 1AJ4A 3BYAA 1K90D 1CMFA 1WDCB 1JUOA 1OZOA 1QTXA 3LK1A 3A8RA 1KQMC 1K93D 2BCAA 3NSKA 3NSLA 4ICBA 4PE4A 3CR2A 1YUUA 1NYAA 2H61C 2KGBC 3O2PA 4C0LA 3RLZA 2LV7A 1LA3A 2I94A 3F45A 3SG3A 1CDPA 2L51A 1K8UA 2K8MB 2BL0B 2CCMA 3MSEB 1BODA 2MHHA 4F0ZB 1SW8A 3CTNA 1XK4C 2Y1MA 2NLNA 1N2DA 4IL1A 3EK7A 1IGVA 3OB1B 5HYDA 3CS1A 2KYFA 1G4YR 2QPTA 5DKRA 4QJ3B 3KPXA 1CDMA 4GUKA 1J7QA 1F71A 2AUCA 2HETA 2JXCA 3C1VA 1TNXA 5HKWA 1EG3A 1EL4A 3WHTB 1QV0A 1NCYA 4PHMA 4JWQA 2M1KB 4YGCB 2D8NA 1AUIB 1QX5B 2E30A 1NSHA 2LVIA 2MLFC 4PDZA 2BKIB 1EH2A 1PSBA 1UHIA 2L4IA 1FBVA 3BUNB 4YI9A 1SCMC 1U5IB 1HT9A 1ZMZA 3DVKA 3SG4A 4E68A 1E8AA 1KQMB 3JTDB 1H4BA 2FCDA 3D0YB 3DVEA 1JFKA 2JZIA 1HQVA 1S6IA 5BPJA 1IJ5A 4YRUA 2H61A 1FF1A 2EC6C 2PALA 1NCZA 5PALA 1RROA 1SCVA 2BE6A 2OS8B 1KK8B 1TRFA 1YX7A 5AEQA 5TNCA 3CGAA 4ORCB 4YGDB 2EGDA 3ZNIA 3H4SE 3OP0A 3O78A 3EKJA 2LLTA 5AANA 2KDHA 1NX3A 2L4HA 3EVRA 1LINA 1WRKA 2AMIA 5FYXA 4MRYA 1XK4A 4PE1A 2KBMA 1WLZA 1JC2A 1KSMA 2ZFDA 1OMVA 1EXRA 1SR6C 1F54A 5AERA 3SIBA 3SG2A 3VRPA 5GQQC 3DVMA 4CLNA 1CFFA 1X02A 2OPOA 2LVVA 2K0JA 3SJSA 2HF5A 1QS7A 2L5XB 3BXKA 2JU0A 4JPZB 1J1DA 1LKJA 1FI5A 2JC2A 2MA2A 1MXEA 1QVIZ 1NPQA 4R1EA 1IQ5A 1EJ3A 1SPYA 2BBMA 5JJGA 1IG5A 2BCXA 1SKTA 3VROA 2ZNEA 1SCMB 1D1OA 2LC5A 2KOTA 1GQMA 4PHKA 3FS7A 1XA5A 1GGZA 2GV5A 4OR9B 2BKHB 4N5XA 5ER4X 1DJZA 2K7DA 1QASA 3DVJA 1L2OB 5HKZA 5B8IB 3OHMB 4AOMA 5ER5A 1AP4A 2HQWA 1AHRA 5AXIA 1R2UA 3HCMA 4L9MA 2B1UA 2GGMA 2LLUA 1N0YA 1MQ1A 1PSRA 1QIWA 1BG1A 3LLEA 4HREE 1UHHA 1A75B 1J55A 3CLNA 4DUQA 1F70A 1BU3A 2RGIA 2EHBA 1ODBA 3SG5A 1A75A 2I18A 3OX5A 4TNCA 2JNXA 2L2EA 4XYNA 5CSJA 1S6JA 2KQ6A 1SR6B 2F2OA 3I5HB 4OV2A 2LUXA 4AQJA 4AQIA 5I2OA 1CMGA 1SK6D 1GJYA 4GFTA 1DGUA 3TDUA 1EG4A 5DKQA 1A2XA 4GAOA 3VRNA 4BY5A 1XVJA 1LXFC 5HLOA 1JSAA 4DS7A 1JFJA 1MF8B 2G9BA 2LLSA 4MSPA 2Y4QA 2JPTA 5G08A 1CNPA 5HLVA 1YURA 1B7TZ 1A29A 2BCBA 4CFRA 2LCPA 4MEWA 5IBWA 2NZ0A 2LHIA 4WQ3A 4HSZA 4U8DA 1QATA 1YTZC 1JWDA 2MRDA 1B47A 1SL7A 1DJGA 3AAJA 4JQ0D 1IRJA 2KAYA 1IH0A 1TCOB 2KI6D 1B4CA 1BR1B 2M1UA 1PALA 2MLEC 1K94A 1YUTA 3WHUB 5CSIA 3TUYC 1QLKA 1DJXA 1A4PA 1SMGA 1NX1A 4MBEA 4BY4A 1W7IB 1R6PA 1SY9A 4GNKB 3BQ3A 1W7JB 1M46A 2Q91A 4C0KA 2LNKA 2ZN9A 5I2QA 1OQPA 2LVJA 3KF9A 1IJ6A 2AAOA 1RJVA 1H8BA 4MVFA 2BE4A 4NQGA 2CBLA 1ZACA 3O6BA 4GPLB 4ORBB 2I2RE 2KFHA 1FI6A 1K9KA 1FPWA 2MJWB 3LCPC 3PM8A 1KWOC 4HRHA 1LVCD 1XFZO 4I5KA 1OMDA 4GGNA 3IQOA 1JF0A 1SBJA 4XJKA 2ISDA 1CFDA 2FJUB 1IQ3A 1B1GA 1F4QA 1PRWA 1AVSA 2LP3A 1XFYO 3PFVA 4I5JA 1JF2A 2A4JA 3DD4A 1CM1A 3BOWB 4N1FA 3BOWA 2LVKA 1FW4A 1YX8A 5KTYA 2WOSA 1DJWA 2F2PA 2K7OA 4HRGA 1BR4B 3SIAA 3LL8B 2KNEA 2OTGC 1J7RA 2KFGA 1A03A 2SASA 2NXQA 1DJIA 5D69A 4DRWA 1BMOA 4PHJA 3FWBA 1XO5A 1Y0VH 1S3PA 2L0PA 3ICBA 2ZN8A 3PALA 1TOPA 3PATA 1ALVA 3GK4X 3PLFB 1UP5A 1XFWO 2FOTA 2KBIA 4I5LB 5CSNA 1SYMA 4ORAB 1KK7Y 2F3YA 2KGRA 3I5IC 3EVVA 2Y5IA 3TUYB 3A4UB 2LHLA 3LK0A 1UHKA 1AJ5A 2JOJA 2WCFA 3SG6A 1Y1UA 1QJTA 3DF0B 1J7PA 1DMOA 2Q4UA 1PULA 3DF0A 1TTXA 2M0RA 4C0JA 2R2IA 2M9GA 3TS5C 2HQ8A 1S1EA 2TN4A 5F6TA 1S26D 1UHJA 2JRFA 2LAPA 1SL9A 4NDBA 3EVUA 2E6WA 2PRUA 3HX4A 2KI6C 1UWOA 1KWOB 1G8IA 1WDCC 4PALA 4MZKA 1YRTB 2K2FA 3NSIA 4DIRA 4I5NB 3GK1A 2LMTA 2CNPA 1BJFA 1PVAA 4USLA 5KU1A 1BF5A 2EC6B 1V1GA 4WRIA 1TNQA 4ZCVA 2M7NA 1OE9B 2O60A 3QRXA 3SG7A 1CLMA 4FTGA 1TIZA 2K2AA 1BOCA 5DKNA 1S5GY 4OCIA 5AFPA 1NUBA 1GGWA 2OTGB 1F4OA 2HPSA 1J7OA 2LANA 4NDDA 2LE9B 4A4BA 1RFJA 2M97A 2BBNA 1MR8A 1TCFA 3CWGA 2K61A 1K9UA 1Y1AA 3CR5X 1IWQA 1PK0D 2P6BB 3EK8A 4Q04A 1XFVO 3VRRA 4OVNF 3AKBA 3I5IB 4FQOA 1M31A 2V53A 2ZRSA 1RECA 1MUXA 4ZCUA 4YGAA 2LP2A 5J3XA 2PSRA 1OZSA 2KQYA 1YRUB 3E3RA 2M49B 4GGFA 2MAZA 3TS5B 1QX2A 1YR5A 2L50A 1PVBA 1QIVA 2DOQA 2FCEA 2JTZA 3BUOB 4M2OA 1CB1A 1QLSA 1WY9A 1BLQA 3KEVA 1OMRA 3PSRA 1RWYA 3OX6A 3EKHA 2ZRTA 1KFUS 1C7WA 3PN7C 3JTDC 1XYDA 3BUMB 4QJ5B 1J1EA 3O4YA 4YBHB 1B8LA 1UHNA 1KFXS 5I8NA 2WCBA 2JT0A 2LUCA 3IQQA 2OS8C 1KK8C 2WORA 4MZLA 3RM1A 2KSPA 2KHNA 4OKHA 2IS9A 2NCPA 3NSOA 1MHOA 1ALWA 1UUSA 1RTP1 1KCYA 1B8CA 5KSZA 3VRQA 3TZ1A 1K2HA 4CIDA 3KHEA 1AK8A 2CXJA 1RK9A 1NX0A 3TDZA 1YVLA 1JBAA 1DTLA 1G33A 2M29A 1SL8A 3FWCA 1IKUA 1XFXO 1CKKA 1DF0B 1N65A 2M3WA 1OOJA 2KI4C 4XJKB 2L98A 1DF0A 3I5FC 3KO0A 1C07A 3GOFA 3AKAA 2O5GA 1NWDA 5D7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CLL A;  1WLM A;  1ZFS A;  1CLB A;  1QXP A;  2SCP A;  1B9A A;  1VRK A;  4PCW A;  2G2B A;  2PVB A;  2WC8 A;  3BUX B;  3M0W A;  1CDL A;  1NP8 A;  2M8U A;  2ZKM X;  1NIW A;  4ETO A;  3FIA A;  1WRL A;  4NDC A;  4M2Q A;  1DGV A;  4QJ4 B;  1U5I A;  3PN7 B;  2BEC A;  3I5G C;  4YI8 A;  1Y1X A;  1L2O C;  1MXL C;  2KAV A;  3JVT C;  1B8R A;  3D0Y A;  2I7A A;  1DVI A;  1QV1 A;  1F55 A;  2JTT A;  1Q80 A;  1S36 A;  2F3Z A;  2JUL A;  3D10 A;  2CT9 A;  4GBA A;  1YUS A;  1SNL A;  3EK4 A;  1MWN A;  4CFQ A;  2COL B;  2F8P A;  1M63 B;  2KFF A;  4GGF C;  1TNP A;  1M45 A;  2CTN A;  4YGB B;  1CFP A;  5I2L A;  2NCO A;  2JWW A;  3K21 A;  1CFC A;  4D1E A;  5K89 A;  1DJY A;  1QVI Y;  1KQV A;  3CR4 X;  5HKY A;  1KFU L;  3I5H C;  1C7V A;  4PE7 A;  1LA0 A;  2KI4 B;  1KK7 Z;  1ZOT B;  1YVH A;  1TNW A;  2GGZ A;  3I5F B;  3IF7 A;  3ZWH A;  1KFX L;  2KAX A;  1K9P A;  2LMU A;  5CSF A;  1F8H A;  1TN4 A;  2K7C A;  2MBX A;  1DJH A;  1CTR A;  4MN0 A;  1XFU O;  2K7B A;  2F33 A;  1UUR A;  4PHN A;  4PE0 A;  3GK2 A;  2BL0 C;  1V1F A;  1OSA A;  2LM5 A;  3WNX B;  1K95 A;  2VRG A;  2LMV A;  3AAK A;  4MLW A;  2JT8 A;  4UPG A;  2JNF A;  4P5O E;  1QX7 A;  3I5G B;  3NXA A;  4DCK A;  1L7Z A;  3JVT B;  3VGO A;  2JQ6 A;  1NCX A;  2ZND A;  4M2P A;  3TDI A;  2Y1N A;  1WRZ A;  1ZUZ A;  3OB2 B;  3CZT X;  4N1G A;  1Y6W A;  1CM4 A;  1BT6 A;  2JXL A;  1SRA A;  2H2K A;  4WQ2 A;  1S5G Z;  3BUW B;  1B7T Y;  2QAC A;  2M7L A;  4YGE B;  1KSO A;  2PAS A;  1M39 A;  5CPV A;  2PMY A;  4A4C A;  4CPV A;  2JT3 A;  1CDN A;  1K96 A;  1NX2 A;  2WCE A;  4MZJ A;  4MRX A;  2KYC A;  2WND A;  1S6C A;  5JOL A;  4P2Y B;  3WXA A;  1DT7 B;  1AJ4 A;  3BYA A;  1K90 D;  1CMF A;  1WDC B;  1JUO A;  1OZO A;  1QTX A;  3LK1 A;  3A8R A;  1KQM C;  1K93 D;  2BCA A;  3NSK A;  3NSL A;  4ICB A;  4PE4 A;  3CR2 A;  1YUU A;  1NYA A;  2H61 C;  2KGB C;  3O2P A;  4C0L A;  3RLZ A;  2LV7 A;  1LA3 A;  2I94 A;  3F45 A;  3SG3 A;  1CDP A;  2L51 A;  1K8U A;  2K8M B;  2BL0 B;  2CCM A;  3MSE B;  1BOD A;  2MHH A;  4F0Z B;  1SW8 A;  3CTN A;  1XK4 C;  2Y1M A;  2NLN A;  1N2D A;  4IL1 A;  3EK7 A;  1IGV A;  3OB1 B;  5HYD A;  3CS1 A;  2KYF A;  1G4Y R;  2QPT A;  5DKR A;  4QJ3 B;  3KPX A;  1CDM A;  4GUK A;  1J7Q A;  1F71 A;  2AUC A;  2HET A;  2JXC A;  3C1V A;  1TNX A;  5HKW A;  1EG3 A;  1EL4 A;  3WHT B;  1QV0 A;  1NCY A;  4PHM A;  4JWQ A;  2M1K B;  4YGC B;  2D8N A;  1AUI B;  1QX5 B;  2E30 A;  1NSH A;  2LVI A;  2MLF C;  4PDZ A;  2BKI B;  1EH2 A;  1PSB A;  1UHI A;  2L4I A;  1FBV A;  3BUN B;  4YI9 A;  1SCM C;  1U5I B;  1HT9 A;  1ZMZ A;  3DVK A;  3SG4 A;  4E68 A;  1E8A A;  1KQM B;  3JTD B;  1H4B A;  2FCD A;  3D0Y B;  3DVE A;  1JFK A;  2JZI A;  1HQV A;  1S6I A;  5BPJ A;  1IJ5 A;  4YRU A;  2H61 A;  1FF1 A;  2EC6 C;  2PAL A;  1NCZ A;  5PAL A;  1RRO A;  1SCV A;  2BE6 A;  2OS8 B;  1KK8 B;  1TRF A;  1YX7 A;  5AEQ A;  5TNC A;  3CGA A;  4ORC B;  4YGD B;  2EGD A;  3ZNI A;  3H4S E;  3OP0 A;  3O78 A;  3EKJ A;  2LLT A;  5AAN A;  2KDH A;  1NX3 A;  2L4H A;  3EVR A;  1LIN A;  1WRK A;  2AMI A;  5FYX A;  4MRY A;  1XK4 A;  4PE1 A;  2KBM A;  1WLZ A;  1JC2 A;  1KSM A;  2ZFD A;  1OMV A;  1EXR A;  1SR6 C;  1F54 A;  5AER A;  3SIB A;  3SG2 A;  3VRP A;  5GQQ C;  3DVM A;  4CLN A;  1CFF A;  1X02 A;  2OPO A;  2LVV A;  2K0J A;  3SJS A;  2HF5 A;  1QS7 A;  2L5X B;  3BXK A;  2JU0 A;  4JPZ B;  1J1D A;  1LKJ A;  1FI5 A;  2JC2 A;  2MA2 A;  1MXE A;  1QVI Z;  1NPQ A;  4R1E A;  1IQ5 A;  1EJ3 A;  1SPY A;  2BBM A;  5JJG A;  1IG5 A;  2BCX A;  1SKT A;  3VRO A;  2ZNE A;  1SCM B;  1D1O A;  2LC5 A;  2KOT A;  1GQM A;  4PHK A;  3FS7 A;  1XA5 A;  1GGZ A;  2GV5 A;  4OR9 B;  2BKH B;  4N5X A;  5ER4 X;  1DJZ A;  2K7D A;  1QAS A;  3DVJ A;  1L2O B;  5HKZ A;  5B8I B;  3OHM B;  4AOM A;  5ER5 A;  1AP4 A;  2HQW A;  1AHR A;  5AXI A;  1R2U A;  3HCM A;  4L9M A;  2B1U A;  2GGM A;  2LLU A;  1N0Y A;  1MQ1 A;  1PSR A;  1QIW A;  1BG1 A;  3LLE A;  4HRE E;  1UHH A;  1A75 B;  1J55 A;  3CLN A;  4DUQ A;  1F70 A;  1BU3 A;  2RGI A;  2EHB A;  1ODB A;  3SG5 A;  1A75 A;  2I18 A;  3OX5 A;  4TNC A;  2JNX A;  2L2E A;  4XYN A;  5CSJ A;  1S6J A;  2KQ6 A;  1SR6 B;  2F2O A;  3I5H B;  4OV2 A;  2LUX A;  4AQJ A;  4AQI A;  5I2O A;  1CMG A;  1SK6 D;  1GJY A;  4GFT A;  1DGU A;  3TDU A;  1EG4 A;  5DKQ A;  1A2X A;  4GAO A;  3VRN A;  4BY5 A;  1XVJ A;  1LXF C;  5HLO A;  1JSA A;  4DS7 A;  1JFJ A;  1MF8 B;  2G9B A;  2LLS A;  4MSP A;  2Y4Q A;  2JPT A;  5G08 A;  1CNP A;  5HLV A;  1YUR A;  1B7T Z;  1A29 A;  2BCB A;  4CFR A;  2LCP A;  4MEW A;  5IBW A;  2NZ0 A;  2LHI A;  4WQ3 A;  4HSZ A;  4U8D A;  1QAT A;  1YTZ C;  1JWD A;  2MRD A;  1B47 A;  1SL7 A;  1DJG A;  3AAJ A;  4JQ0 D;  1IRJ A;  2KAY A;  1IH0 A;  1TCO B;  2KI6 D;  1B4C A;  1BR1 B;  2M1U A;  1PAL A;  2MLE C;  1K94 A;  1YUT A;  3WHU B;  5CSI A;  3TUY C;  1QLK A;  1DJX A;  1A4P A;  1SMG A;  1NX1 A;  4MBE A;  4BY4 A;  1W7I B;  1R6P A;  1SY9 A;  4GNK B;  3BQ3 A;  1W7J B;  1M46 A;  2Q91 A;  4C0K A;  2LNK A;  2ZN9 A;  5I2Q A;  1OQP A;  2LVJ A;  3KF9 A;  1IJ6 A;  2AAO A;  1RJV A;  1H8B A;  4MVF A;  2BE4 A;  4NQG A;  2CBL A;  1ZAC A;  3O6B A;  4GPL B;  4ORB B;  2I2R E;  2KFH A;  1FI6 A;  1K9K A;  1FPW A;  2MJW B;  3LCP C;  3PM8 A;  1KWO C;  4HRH A;  1LVC D;  1XFZ O;  4I5K A;  1OMD A;  4GGN A;  3IQO A;  1JF0 A;  1SBJ A;  4XJK A;  2ISD A;  1CFD A;  2FJU B;  1IQ3 A;  1B1G A;  1F4Q A;  1PRW A;  1AVS A;  2LP3 A;  1XFY O;  3PFV A;  4I5J A;  1JF2 A;  2A4J A;  3DD4 A;  1CM1 A;  3BOW B;  4N1F A;  3BOW A;  2LVK A;  1FW4 A;  1YX8 A;  5KTY A;  2WOS A;  1DJW A;  2F2P A;  2K7O A;  4HRG A;  1BR4 B;  3SIA A;  3LL8 B;  2KNE A;  2OTG C;  1J7R A;  2KFG A;  1A03 A;  2SAS A;  2NXQ A;  1DJI A;  5D69 A;  4DRW A;  1BMO A;  4PHJ A;  3FWB A;  1XO5 A;  1Y0V H;  1S3P A;  2L0P A;  3ICB A;  2ZN8 A;  3PAL A;  1TOP A;  3PAT A;  1ALV A;  3GK4 X;  3PLF B;  1UP5 A;  1XFW O;  2FOT A;  2KBI A;  4I5L B;  5CSN A;  1SYM A;  4ORA B;  1KK7 Y;  2F3Y A;  2KGR A;  3I5I C;  3EVV A;  2Y5I A;  3TUY B;  3A4U B;  2LHL A;  3LK0 A;  1UHK A;  1AJ5 A;  2JOJ A;  2WCF A;  3SG6 A;  1Y1U A;  1QJT A;  3DF0 B;  1J7P A;  1DMO A;  2Q4U A;  1PUL A;  3DF0 A;  1TTX A;  2M0R A;  4C0J A;  2R2I A;  2M9G A;  3TS5 C;  2HQ8 A;  1S1E A;  2TN4 A;  5F6T A;  1S26 D;  1UHJ A;  2JRF A;  2LAP A;  1SL9 A;  4NDB A;  3EVU A;  2E6W A;  2PRU A;  3HX4 A;  2KI6 C;  1UWO A;  1KWO B;  1G8I A;  1WDC C;  4PAL A;  4MZK A;  1YRT B;  2K2F A;  3NSI A;  4DIR A;  4I5N B;  3GK1 A;  2LMT A;  2CNP A;  1BJF A;  1PVA A;  4USL A;  5KU1 A;  1BF5 A;  2EC6 B;  1V1G A;  4WRI A;  1TNQ A;  4ZCV A;  2M7N A;  1OE9 B;  2O60 A;  3QRX A;  3SG7 A;  1CLM A;  4FTG A;  1TIZ A;  2K2A A;  1BOC A;  5DKN A;  1S5G Y;  4OCI A;  5AFP A;  1NUB A;  1GGW A;  2OTG B;  1F4O A;  2HPS A;  1J7O A;  2LAN A;  4NDD A;  2LE9 B;  4A4B A;  1RFJ A;  2M97 A;  2BBN A;  1MR8 A;  1TCF A;  3CWG A;  2K61 A;  1K9U A;  1Y1A A;  3CR5 X;  1IWQ A;  1PK0 D;  2P6B B;  3EK8 A;  4Q04 A;  1XFV O;  3VRR A;  4OVN F;  3AKB A;  3I5I B;  4FQO A;  1M31 A;  2V53 A;  2ZRS A;  1REC A;  1MUX A;  4ZCU A;  4YGA A;  2LP2 A;  5J3X A;  2PSR A;  1OZS A;  2KQY A;  1YRU B;  3E3R A;  2M49 B;  4GGF A;  2MAZ A;  3TS5 B;  1QX2 A;  1YR5 A;  2L50 A;  1PVB A;  1QIV A;  2DOQ A;  2FCE A;  2JTZ A;  3BUO B;  4M2O A;  1CB1 A;  1QLS A;  1WY9 A;  1BLQ A;  3KEV A;  1OMR A;  3PSR A;  1RWY A;  3OX6 A;  3EKH A;  2ZRT A;  1KFU S;  1C7W A;  3PN7 C;  3JTD C;  1XYD A;  3BUM B;  4QJ5 B;  1J1E A;  3O4Y A;  4YBH B;  1B8L A;  1UHN A;  1KFX S;  5I8N A;  2WCB A;  2JT0 A;  2LUC A;  3IQQ A;  2OS8 C;  1KK8 C;  2WOR A;  4MZL A;  3RM1 A;  2KSP A;  2KHN A;  4OKH A;  2IS9 A;  2NCP A;  3NSO A;  1MHO A;  1ALW A;  1UUS A;  1RTP 1;  1KCY A;  1B8C A;  5KSZ A;  3VRQ A;  3TZ1 A;  1K2H A;  4CID A;  3KHE A;  1AK8 A;  2CXJ A;  1RK9 A;  1NX0 A;  3TDZ A;  1YVL A;  1JBA A;  1DTL A;  1G33 A;  2M29 A;  1SL8 A;  3FWC A;  1IKU A;  1XFX O;  1CKK A;  1DF0 B;  1N65 A;  2M3W A;  1OOJ A;  2KI4 C;  4XJK B;  2L98 A;  1DF0 A;  3I5F C;  3KO0 A;  1C07 A;  3GOF A;  3AKA A;  2O5G A;  1NWD A;  5D7F A; 
#chains in the Genus database with same CATH topology
 1CLL A;  1WLM A;  1ZFS A;  1CLB A;  1QXP A;  2SCP A;  1B9A A;  1VRK A;  4PCW A;  2G2B A;  2PVB A;  2WC8 A;  3BUX B;  3M0W A;  3FE9 A;  1CDL A;  1NP8 A;  2M8U A;  2ZKM X;  1NIW A;  4JKT A;  4ETO A;  3FIA A;  1WRL A;  4NDC A;  4M2Q A;  1DGV A;  4QJ4 B;  1U5I A;  3D73 A;  3PN7 B;  2BEC A;  3I5G C;  4YI8 A;  5EL2 A;  1Y1X A;  1L2O C;  1MXL C;  2KAV A;  3JVT C;  1B8R A;  3D0Y A;  2I7A A;  1DVI A;  1QV1 A;  1TUZ A;  1F55 A;  2JTT A;  1Q80 A;  2WCH A;  1S36 A;  2F3Z A;  2JUL A;  3D10 A;  2CT9 A;  4GBA A;  1YUS A;  3K1E A;  1SNL A;  3EK4 A;  1MWN A;  4CFQ A;  2COL B;  2F8P A;  1M63 B;  2KFF A;  4GGF C;  1TNP A;  1M45 A;  2CTN A;  4OZD A;  4YGB B;  1CFP A;  2P70 A;  2NCO A;  5I2L A;  2JWW A;  3K21 A;  1CFC A;  4D1E A;  5K89 A;  1DJY A;  1QVI Y;  1KQV A;  3CR4 X;  5HKY A;  1KFU L;  3I5H C;  2PQL A;  1C7V A;  4PE7 A;  1LA0 A;  2KI4 B;  1ZOT B;  1KK7 Z;  1YVH A;  1TNW A;  2GGZ A;  3I5F B;  3IF7 A;  3ZWH A;  1XFR A;  1KFX L;  2KAX A;  1K9P A;  2LMU A;  5CSF A;  1F8H A;  1TN4 A;  2K7C A;  2P71 A;  2MBX A;  1DJH A;  1CTR A;  4MN0 A;  1XFU O;  2K7B A;  2F33 A;  4PT1 A;  1UUR A;  4PHN A;  4PE0 A;  3GK2 A;  2BL0 C;  1V1F A;  1OSA A;  2LM5 A;  3WNX B;  1K95 A;  2VRG A;  2LMV A;  3AAK A;  4MLW A;  2JT8 A;  4UPG A;  2JNF A;  4P5O E;  1QX7 A;  3I5G B;  3NXA A;  4DCK A;  2L2C A;  1L7Z A;  3JVT B;  3VGO A;  2JQ6 A;  1NCX A;  2ZND A;  4M2P A;  3TDI A;  2Y1N A;  1WRZ A;  1ZUZ A;  3OB2 B;  3CZT X;  4N1G A;  1Y6W A;  1CM4 A;  1BT6 A;  2JXL A;  1SRA A;  2H2K A;  4WQ2 A;  1S5G Z;  1DEK A;  3S0B A;  3BUW B;  1B7T Y;  2QAC A;  2M7L A;  4YGE B;  1KSO A;  4JD9 A;  3SS4 A;  2PAS A;  1M39 A;  5FI7 A;  5CPV A;  2PMY A;  4A4C A;  4CPV A;  2JT3 A;  1QWV A;  1CDN A;  1K96 A;  1NX2 A;  2WCE A;  3R1V A;  4MZJ A;  4MRX A;  2KYC A;  2WND A;  1S6C A;  5JOL A;  4P2Y B;  3UNW A;  3WXA A;  1DT7 B;  1AJ4 A;  3BYA A;  3R1P A;  1K90 D;  1CMF A;  1WDC B;  1JUO A;  1OZO A;  1QTX A;  3LK1 A;  3A8R A;  1KQM C;  1K93 D;  2BCA A;  2KPH A;  3NSK A;  3NSL A;  4ICB A;  4PE4 A;  1DC1 A;  3CR2 A;  1YUU A;  1NYA A;  2H61 C;  2KGB C;  3O2P A;  4C0L A;  3RLZ A;  2LV7 A;  1LA3 A;  2I94 A;  3F45 A;  3SG3 A;  1CDP A;  2QEB A;  2L51 A;  1K8U A;  2WCK A;  2K8M B;  2BL0 B;  2CCM A;  3MSE B;  1BOD A;  4KYN A;  2QEV A;  2MHH A;  4F0Z B;  1SW8 A;  3DZT A;  3CTN A;  1XK4 C;  2Y1M A;  2NLN A;  1N2D A;  4IL1 A;  3EK7 A;  1IGV A;  3OB1 B;  3EG5 B;  5HYD A;  3S0D A;  3CS1 A;  4INW A;  2KYF A;  1G4Y R;  2QPT A;  5DKR A;  4QJ3 B;  3KPX A;  3DXL A;  5FI2 A;  1CDM A;  4GUK A;  1J7Q A;  1F71 A;  2AUC A;  3SS3 A;  3BFB A;  2HET A;  2JXC A;  3C1V A;  1TNX A;  3L4A A;  5HKW A;  1EG3 A;  1EL4 A;  3WHT B;  1QV0 A;  1NCY A;  4PHM A;  4JWQ A;  2M1K B;  4YGC B;  4FQT A;  2D8N A;  1AUI B;  1QX5 B;  2E30 A;  1NSH A;  2LVI A;  3PJI A;  2MLF C;  4PDZ A;  2BKI B;  1EH2 A;  1PSB A;  1UHI A;  2L4I A;  1FBV A;  3BUN B;  3D75 A;  4YI9 A;  1C3Y A;  1SCM C;  1U5I B;  1HT9 A;  2QDI A;  1ZMZ A;  3DVK A;  3SG4 A;  4E68 A;  1E8A A;  1KQM B;  3JTD B;  1H4B A;  2FCD A;  3D0Y B;  3DVE A;  1JFK A;  2JZI A;  2K60 A;  1HQV A;  1S6I A;  5BPJ A;  1T14 A;  1IJ5 A;  4YRU A;  2H61 A;  1FF1 A;  2EC6 C;  2PAL A;  1NCZ A;  5PAL A;  1RRO A;  1SCV A;  2BE6 A;  2OS8 B;  1KK8 B;  1TRF A;  1YX7 A;  5AEQ A;  5TNC A;  3CGA A;  4ORC B;  4YGD B;  2EGD A;  3ZNI A;  3H4S E;  3OP0 A;  3O78 A;  3CDN A;  3EKJ A;  2LLT A;  5AAN A;  2KDH A;  1NX3 A;  2L4H A;  3EVR A;  1LIN A;  1WRK A;  2AMI A;  3NHI A;  5FYX A;  4MRY A;  1XK4 A;  4PE1 A;  2KBM A;  1WLZ A;  1JC2 A;  1KSM A;  2ZFD A;  1OMV A;  1EXR A;  1OOF A;  1SR6 C;  1F54 A;  5AER A;  3SS5 A;  3SIB A;  3SG2 A;  2WCL A;  3VRP A;  3FE6 A;  5GQQ C;  3DVM A;  4CLN A;  1CFF A;  1X02 A;  2OPO A;  3B7A A;  2LVV A;  1TWO A;  2K0J A;  3SJS A;  2HF5 A;  1QS7 A;  2L5X B;  3BXK A;  2JU0 A;  4JPZ B;  1J1D A;  1LKJ A;  1FI5 A;  2JC2 A;  2MA2 A;  3L4L A;  1MXE A;  4INX A;  1QVI Z;  5D3O A;  1NPQ A;  4R1E A;  1IQ5 A;  3IVT A;  1EJ3 A;  1SPY A;  2BBM A;  3V2L A;  5JJG A;  1IG5 A;  2BCX A;  1SKT A;  3VRO A;  2ZNE A;  1SCM B;  1SSE B;  3OGN A;  1D1O A;  2LC5 A;  2KOT A;  1GQM A;  4PHK A;  3FS7 A;  1XA5 A;  1GGZ A;  2GV5 A;  4OR9 B;  2BKH B;  4N5X A;  5ER4 X;  1DJZ A;  2K7D A;  1QAS A;  3DVJ A;  3S0G A;  1L2O B;  2O5G A;  3B6X A;  5HKZ A;  1LS8 A;  5B8I B;  3OHM B;  4AOM A;  5ER5 A;  1AP4 A;  2HQW A;  1AHR A;  5AXI A;  1R2U A;  3HCM A;  4L9M A;  2B1U A;  3D77 A;  2GGM A;  2LLU A;  1N0Y A;  1MQ1 A;  1PSR A;  1QIW A;  1BG1 A;  3LLE A;  4HRE E;  5I94 A;  1UHH A;  1A75 B;  1J55 A;  3CLN A;  4DUQ A;  1F70 A;  1BU3 A;  2RGI A;  2EHB A;  1ODB A;  3SG5 A;  1A75 A;  2I18 A;  3OX5 A;  4TNC A;  2JNX A;  2L2E A;  4XYN A;  5CSJ A;  1S6J A;  2KQ6 A;  1SR6 B;  2F2O A;  3I5H B;  4OV2 A;  2LUX A;  4AQJ A;  4AQI A;  5I2O A;  1CMG A;  1SK6 D;  1GJY A;  4GFT A;  3S0E A;  1DGU A;  3TDU A;  1EG4 A;  5DKQ A;  1A2X A;  4GAO A;  3BFA A;  3VRN A;  4BY5 A;  1XVJ A;  1LXF C;  5HLO A;  1JSA A;  4DS7 A;  1JFJ A;  1MF8 B;  2G9B A;  2LLS A;  4MSP A;  4F7F A;  2Y4Q A;  2JPT A;  5G08 A;  1CNP A;  5DIC A;  1YUR A;  5HLV A;  1B7T Z;  1A29 A;  2BCB A;  4CFR A;  2LCP A;  4MEW A;  5IBW A;  2NZ0 A;  2LHI A;  3FE8 A;  4WQ3 A;  4HSZ A;  4U8D A;  2ERB A;  1QAT A;  1YTZ C;  3B88 A;  3PM2 A;  3R1O A;  2MRD A;  1JWD A;  1B47 A;  3Q8I A;  1SL7 A;  1DJG A;  3DY9 A;  3AAJ A;  1GM0 A;  4JQ0 D;  1IRJ A;  2KAY A;  3DYE A;  1IH0 A;  1TCO B;  1OOG A;  2KI6 D;  1B4C A;  2KLD A;  3BJH A;  1BR1 B;  2M1U A;  1PAL A;  2MLE C;  1K94 A;  1YUT A;  3O4X A;  3WHU B;  5CSI A;  3TUY C;  1QLK A;  2WC5 A;  1DJX A;  1A4P A;  1SMG A;  1NX1 A;  4MBE A;  4BY4 A;  2GTE A;  1W7I B;  2WCM A;  1R6P A;  1SY9 A;  4GNK B;  3BQ3 A;  1W7J B;  1M46 A;  2Q91 A;  4C0K A;  2LNK A;  2ZN9 A;  5I2Q A;  1OQP A;  2LVJ A;  3KF9 A;  1IJ6 A;  2AAO A;  1RJV A;  1H8B A;  4MVF A;  2BE4 A;  4NQG A;  2CBL A;  1ZAC A;  3CAB A;  3O6B A;  4GPL B;  4ORB B;  4IJ7 A;  2L5Y A;  2I2R E;  2KFH A;  1FI6 A;  1K9K A;  1FPW A;  2MJW B;  3LCP C;  3PM8 A;  1KWO C;  4HRH A;  1LVC D;  1OOH A;  1XFZ O;  4I5K A;  1OMD A;  2QEO A;  4GGN A;  3IQO A;  1JF0 A;  1SBJ A;  4XJK A;  2ISD A;  1CFD A;  2FJU B;  1IQ3 A;  1B1G A;  1F4Q A;  1W9Z A;  1PRW A;  1AVS A;  2LP3 A;  1XFY O;  3PFV A;  4I5J A;  1JF2 A;  2A4J A;  3DD4 A;  1CM1 A;  3BOW B;  4N1F A;  3BOW A;  2LVK A;  1OW4 A;  1FW4 A;  1YX8 A;  2BAP A;  5KTY A;  2FJY A;  2WOS A;  2BNX A;  1DJW A;  2F2P A;  2K7O A;  3B86 A;  4HRG A;  1BR4 B;  3SIA A;  3LL8 B;  2KNE A;  2OTG C;  3CZ1 A;  1J7R A;  2KFG A;  1A03 A;  2SAS A;  2NXQ A;  1DJI A;  5D69 A;  4DRW A;  1BMO A;  4PHJ A;  3FWB A;  1XO5 A;  1Y0V H;  1S3P A;  2L0P A;  3ICB A;  2ZN8 A;  3L47 A;  1TOP A;  3PAL A;  3PAT A;  1ALV A;  3GK4 X;  3UO9 A;  3PLF B;  1UP5 A;  1XFW O;  2FOT A;  2KBI A;  4I5L B;  5CSN A;  1SYM A;  4ORA B;  1KK7 Y;  2F3Y A;  2KGR A;  3I5I C;  3EVV A;  2Y5I A;  3TUY B;  3VB1 A;  2KLE A;  3A4U B;  2LHL A;  3LK0 A;  1UHK A;  1AJ5 A;  2JOJ A;  2WCF A;  1C3Z A;  3D76 A;  3SG6 A;  1Y1U A;  3S0A A;  1QJT A;  3DF0 B;  1J7P A;  1DMO A;  2Q4U A;  1PUL A;  3DF0 A;  1TTX A;  2M0R A;  4C0J A;  2R2I A;  2M9G A;  3TS5 C;  2HQ8 A;  1S1E A;  2TN4 A;  5F6T A;  1S26 D;  1UHJ A;  2JRF A;  2LAP A;  3CZ2 A;  1SL9 A;  4NDB A;  3EVU A;  3D78 A;  2E6W A;  1TUJ A;  2PRU A;  3HX4 A;  2KI6 C;  1UWO A;  1KWO B;  1G8I A;  1WDC C;  4PAL A;  4MZK A;  1YRT B;  2K2F A;  3NSI A;  4DIR A;  4I5N B;  3GK1 A;  2LMT A;  1DEL A;  2CNP A;  1BJF A;  1PVA A;  4USL A;  5KU1 A;  1BF5 A;  2EC6 B;  1V1G A;  1OOI X;  4WRI A;  1TNQ A;  4ZCV A;  2M7N A;  1OE9 B;  2O60 A;  3QRX A;  3N7H A;  3SG7 A;  1CLM A;  4FTG A;  1TIZ A;  2K2A A;  1BOC A;  5DKN A;  2JPO A;  2QEH A;  1S5G Y;  4OCI A;  5AFP A;  1NUB A;  1GGW A;  3CZ0 A;  2OTG B;  1F4O A;  1DQE A;  2HPS A;  1J7O A;  2LAN A;  4NDD A;  2LE9 B;  4A4B A;  1RFJ A;  2M97 A;  3S0F A;  2BBN A;  1MR8 A;  1TCF A;  3CWG A;  2K61 A;  1K9U A;  1ORG A;  1Y1A A;  3CR5 X;  1IWQ A;  1PK0 D;  2P6B B;  3EK8 A;  4Q04 A;  1XFV O;  3VRR A;  4OVN F;  3AKB A;  3NGV A;  3D74 A;  3I5I B;  3R72 A;  4FQO A;  1M31 A;  2V53 A;  2ZRS A;  1REC A;  1MUX A;  3B87 A;  4ZCU A;  4YGA A;  2LP2 A;  5J3X A;  3QME A;  2PSR A;  1OZS A;  2KQY A;  1YRU B;  3E3R A;  2M49 B;  4GGF A;  2MAZ A;  3TS5 B;  1QX2 A;  1YR5 A;  2L50 A;  1PVB A;  1QIV A;  2DOQ A;  2FCE A;  2JTZ A;  3BUO B;  4M2O A;  1CB1 A;  3OBV A;  1QLS A;  1WY9 A;  1BLQ A;  3KEV A;  1OMR A;  3PSR A;  1IIO A;  1RWY A;  2YGU A;  3OX6 A;  3EKH A;  2ZRT A;  1KFU S;  1C7W A;  3PN7 C;  3JTD C;  1XYD A;  3BUM B;  4QJ5 B;  1J1E A;  5FI6 A;  3O4Y A;  4YBH B;  1B8L A;  1UHN A;  1KFX S;  5I8N A;  2WCB A;  2JT0 A;  2LUC A;  3IQQ A;  5HL1 A;  2OS8 C;  1KK8 C;  2WOR A;  4MZL A;  3RM1 A;  2KSP A;  2KHN A;  4OKH A;  2IS9 A;  2NCP A;  3CYZ A;  3NSO A;  1MHO A;  1ALW A;  1UUS A;  1RTP 1;  1KCY A;  1B8C A;  5KSZ A;  2WC6 A;  3VRQ A;  3TZ1 A;  1K2H A;  4CID A;  3KHE A;  1AK8 A;  2CXJ A;  1RK9 A;  1NX0 A;  3TDZ A;  1YVL A;  1JBA A;  1DTL A;  1G33 A;  2M29 A;  1SL8 A;  3FWC A;  1IKU A;  1XFX O;  1CKK A;  1Z4H A;  1DF0 B;  1N65 A;  2M3W A;  1OOJ A;  3NHT A;  2KI4 C;  4XJK B;  2L98 A;  1DF0 A;  3I5F C;  3BFH A;  2PYQ A;  3KO0 A;  1C07 A;  2H8V A;  3GOF A;  3AKA A;  3RZS A;  2WCJ A;  1P28 A;  1Z2C B;  1NWD A;  5D7F A; 
#chains in the Genus database with same CATH homology
 1CLL A;  1WLM A;  1ZFS A;  1CLB A;  1QXP A;  2SCP A;  1B9A A;  1VRK A;  4PCW A;  2G2B A;  2PVB A;  2WC8 A;  3BUX B;  3M0W A;  1CDL A;  1NP8 A;  2M8U A;  2ZKM X;  1NIW A;  4ETO A;  3FIA A;  1WRL A;  4NDC A;  4M2Q A;  1DGV A;  4QJ4 B;  1U5I A;  3PN7 B;  2BEC A;  3I5G C;  4YI8 A;  1Y1X A;  1L2O C;  1MXL C;  2KAV A;  3JVT C;  1B8R A;  3D0Y A;  2I7A A;  1DVI A;  1QV1 A;  1F55 A;  2JTT A;  1Q80 A;  1S36 A;  2F3Z A;  2JUL A;  3D10 A;  2CT9 A;  4GBA A;  1YUS A;  1SNL A;  3EK4 A;  1MWN A;  4CFQ A;  2COL B;  2F8P A;  1M63 B;  2KFF A;  4GGF C;  1TNP A;  1M45 A;  2CTN A;  4YGB B;  1CFP A;  5I2L A;  2NCO A;  2JWW A;  3K21 A;  1CFC A;  4D1E A;  5K89 A;  1DJY A;  1QVI Y;  1KQV A;  3CR4 X;  5HKY A;  1KFU L;  3I5H C;  1C7V A;  4PE7 A;  1LA0 A;  2KI4 B;  1KK7 Z;  1ZOT B;  1YVH A;  1TNW A;  2GGZ A;  3I5F B;  3IF7 A;  3ZWH A;  1KFX L;  2KAX A;  1K9P A;  2LMU A;  5CSF A;  1F8H A;  1TN4 A;  2K7C A;  2MBX A;  1DJH A;  1CTR A;  4MN0 A;  1XFU O;  2K7B A;  2F33 A;  1UUR A;  4PHN A;  4PE0 A;  3GK2 A;  2BL0 C;  1V1F A;  1OSA A;  2LM5 A;  3WNX B;  1K95 A;  2VRG A;  2LMV A;  3AAK A;  4MLW A;  2JT8 A;  4UPG A;  2JNF A;  4P5O E;  1QX7 A;  3I5G B;  3NXA A;  4DCK A;  1L7Z A;  3JVT B;  3VGO A;  2JQ6 A;  1NCX A;  2ZND A;  4M2P A;  3TDI A;  2Y1N A;  1WRZ A;  1ZUZ A;  3OB2 B;  3CZT X;  4N1G A;  1Y6W A;  1CM4 A;  1BT6 A;  2JXL A;  1SRA A;  2H2K A;  4WQ2 A;  1S5G Z;  3BUW B;  1B7T Y;  2QAC A;  2M7L A;  4YGE B;  1KSO A;  2PAS A;  1M39 A;  5CPV A;  2PMY A;  4A4C A;  4CPV A;  2JT3 A;  1CDN A;  1K96 A;  1NX2 A;  2WCE A;  4MZJ A;  4MRX A;  2KYC A;  2WND A;  1S6C A;  5JOL A;  4P2Y B;  3WXA A;  1DT7 B;  1AJ4 A;  3BYA A;  1K90 D;  1CMF A;  1WDC B;  1JUO A;  1OZO A;  1QTX A;  3LK1 A;  3A8R A;  1KQM C;  1K93 D;  2BCA A;  3NSK A;  3NSL A;  4ICB A;  4PE4 A;  3CR2 A;  1YUU A;  1NYA A;  2H61 C;  2KGB C;  3O2P A;  4C0L A;  3RLZ A;  2LV7 A;  1LA3 A;  2I94 A;  3F45 A;  3SG3 A;  1CDP A;  2L51 A;  1K8U A;  2K8M B;  2BL0 B;  2CCM A;  3MSE B;  1BOD A;  2MHH A;  4F0Z B;  1SW8 A;  3CTN A;  1XK4 C;  2Y1M A;  2NLN A;  1N2D A;  4IL1 A;  3EK7 A;  1IGV A;  3OB1 B;  5HYD A;  3CS1 A;  2KYF A;  1G4Y R;  2QPT A;  5DKR A;  4QJ3 B;  3KPX A;  1CDM A;  4GUK A;  1J7Q A;  1F71 A;  2AUC A;  2HET A;  2JXC A;  3C1V A;  1TNX A;  5HKW A;  1EG3 A;  1EL4 A;  3WHT B;  1QV0 A;  1NCY A;  4PHM A;  4JWQ A;  2M1K B;  4YGC B;  2D8N A;  1AUI B;  1QX5 B;  2E30 A;  1NSH A;  2LVI A;  2MLF C;  4PDZ A;  2BKI B;  1EH2 A;  1PSB A;  1UHI A;  2L4I A;  1FBV A;  3BUN B;  4YI9 A;  1SCM C;  1U5I B;  1HT9 A;  1ZMZ A;  3DVK A;  3SG4 A;  4E68 A;  1E8A A;  1KQM B;  3JTD B;  1H4B A;  2FCD A;  3D0Y B;  3DVE A;  1JFK A;  2JZI A;  1HQV A;  1S6I A;  5BPJ A;  1IJ5 A;  4YRU A;  2H61 A;  1FF1 A;  2EC6 C;  2PAL A;  1NCZ A;  5PAL A;  1RRO A;  1SCV A;  2BE6 A;  2OS8 B;  1KK8 B;  1TRF A;  1YX7 A;  5AEQ A;  5TNC A;  3CGA A;  4ORC B;  4YGD B;  2EGD A;  3ZNI A;  3H4S E;  3OP0 A;  3O78 A;  3EKJ A;  2LLT A;  5AAN A;  2KDH A;  1NX3 A;  2L4H A;  3EVR A;  1LIN A;  1WRK A;  2AMI A;  5FYX A;  4MRY A;  1XK4 A;  4PE1 A;  2KBM A;  1WLZ A;  1JC2 A;  1KSM A;  2ZFD A;  1OMV A;  1EXR A;  1SR6 C;  1F54 A;  5AER A;  3SIB A;  3SG2 A;  3VRP A;  5GQQ C;  3DVM A;  4CLN A;  1CFF A;  1X02 A;  2OPO A;  2LVV A;  2K0J A;  3SJS A;  2HF5 A;  1QS7 A;  2L5X B;  3BXK A;  2JU0 A;  4JPZ B;  1J1D A;  1LKJ A;  1FI5 A;  2JC2 A;  2MA2 A;  1MXE A;  1QVI Z;  1NPQ A;  4R1E A;  1IQ5 A;  1EJ3 A;  1SPY A;  2BBM A;  5JJG A;  1IG5 A;  2BCX A;  1SKT A;  3VRO A;  2ZNE A;  1SCM B;  1D1O A;  2LC5 A;  2KOT A;  1GQM A;  4PHK A;  3FS7 A;  1XA5 A;  1GGZ A;  2GV5 A;  4OR9 B;  2BKH B;  4N5X A;  5ER4 X;  1DJZ A;  2K7D A;  1QAS A;  3DVJ A;  1L2O B;  5HKZ A;  5B8I B;  3OHM B;  4AOM A;  5ER5 A;  1AP4 A;  2HQW A;  1AHR A;  5AXI A;  1R2U A;  3HCM A;  4L9M A;  2B1U A;  2GGM A;  2LLU A;  1N0Y A;  1MQ1 A;  1PSR A;  1QIW A;  1BG1 A;  3LLE A;  4HRE E;  1UHH A;  1A75 B;  1J55 A;  3CLN A;  4DUQ A;  1F70 A;  1BU3 A;  2RGI A;  2EHB A;  1ODB A;  3SG5 A;  1A75 A;  2I18 A;  3OX5 A;  4TNC A;  2JNX A;  2L2E A;  4XYN A;  5CSJ A;  1S6J A;  2KQ6 A;  1SR6 B;  2F2O A;  3I5H B;  4OV2 A;  2LUX A;  4AQJ A;  4AQI A;  5I2O A;  1CMG A;  1SK6 D;  1GJY A;  4GFT A;  1DGU A;  3TDU A;  1EG4 A;  5DKQ A;  1A2X A;  4GAO A;  3VRN A;  4BY5 A;  1XVJ A;  1LXF C;  5HLO A;  1JSA A;  4DS7 A;  1JFJ A;  1MF8 B;  2G9B A;  2LLS A;  4MSP A;  2Y4Q A;  2JPT A;  5G08 A;  1CNP A;  5HLV A;  1YUR A;  1B7T Z;  1A29 A;  2BCB A;  4CFR A;  2LCP A;  4MEW A;  5IBW A;  2NZ0 A;  2LHI A;  4WQ3 A;  4HSZ A;  4U8D A;  1QAT A;  1YTZ C;  1JWD A;  2MRD A;  1B47 A;  1SL7 A;  1DJG A;  3AAJ A;  4JQ0 D;  1IRJ A;  2KAY A;  1IH0 A;  1TCO B;  2KI6 D;  1B4C A;  1BR1 B;  2M1U A;  1PAL A;  2MLE C;  1K94 A;  1YUT A;  3WHU B;  5CSI A;  3TUY C;  1QLK A;  1DJX A;  1A4P A;  1SMG A;  1NX1 A;  4MBE A;  4BY4 A;  1W7I B;  1R6P A;  1SY9 A;  4GNK B;  3BQ3 A;  1W7J B;  1M46 A;  2Q91 A;  4C0K A;  2LNK A;  2ZN9 A;  5I2Q A;  1OQP A;  2LVJ A;  3KF9 A;  1IJ6 A;  2AAO A;  1RJV A;  1H8B A;  4MVF A;  2BE4 A;  4NQG A;  2CBL A;  1ZAC A;  3O6B A;  4GPL B;  4ORB B;  2I2R E;  2KFH A;  1FI6 A;  1K9K A;  1FPW A;  2MJW B;  3LCP C;  3PM8 A;  1KWO C;  4HRH A;  1LVC D;  1XFZ O;  4I5K A;  1OMD A;  4GGN A;  3IQO A;  1JF0 A;  1SBJ A;  4XJK A;  2ISD A;  1CFD A;  2FJU B;  1IQ3 A;  1B1G A;  1F4Q A;  1PRW A;  1AVS A;  2LP3 A;  1XFY O;  3PFV A;  4I5J A;  1JF2 A;  2A4J A;  3DD4 A;  1CM1 A;  3BOW B;  4N1F A;  3BOW A;  2LVK A;  1FW4 A;  1YX8 A;  5KTY A;  2WOS A;  1DJW A;  2F2P A;  2K7O A;  4HRG A;  1BR4 B;  3SIA A;  3LL8 B;  2KNE A;  2OTG C;  1J7R A;  2KFG A;  1A03 A;  2SAS A;  2NXQ A;  1DJI A;  5D69 A;  4DRW A;  1BMO A;  4PHJ A;  3FWB A;  1XO5 A;  1Y0V H;  1S3P A;  2L0P A;  3ICB A;  2ZN8 A;  3PAL A;  1TOP A;  3PAT A;  1ALV A;  3GK4 X;  3PLF B;  1UP5 A;  1XFW O;  2FOT A;  2KBI A;  4I5L B;  5CSN A;  1SYM A;  4ORA B;  1KK7 Y;  2F3Y A;  2KGR A;  3I5I C;  3EVV A;  2Y5I A;  3TUY B;  3A4U B;  2LHL A;  3LK0 A;  1UHK A;  1AJ5 A;  2JOJ A;  2WCF A;  3SG6 A;  1Y1U A;  1QJT A;  3DF0 B;  1J7P A;  1DMO A;  2Q4U A;  1PUL A;  3DF0 A;  1TTX A;  2M0R A;  4C0J A;  2R2I A;  2M9G A;  3TS5 C;  2HQ8 A;  1S1E A;  2TN4 A;  5F6T A;  1S26 D;  1UHJ A;  2JRF A;  2LAP A;  1SL9 A;  4NDB A;  3EVU A;  2E6W A;  2PRU A;  3HX4 A;  2KI6 C;  1UWO A;  1KWO B;  1G8I A;  1WDC C;  4PAL A;  4MZK A;  1YRT B;  2K2F A;  3NSI A;  4DIR A;  4I5N B;  3GK1 A;  2LMT A;  2CNP A;  1BJF A;  1PVA A;  4USL A;  5KU1 A;  1BF5 A;  2EC6 B;  1V1G A;  4WRI A;  1TNQ A;  4ZCV A;  2M7N A;  1OE9 B;  2O60 A;  3QRX A;  3SG7 A;  1CLM A;  4FTG A;  1TIZ A;  2K2A A;  1BOC A;  5DKN A;  1S5G Y;  4OCI A;  5AFP A;  1NUB A;  1GGW A;  2OTG B;  1F4O A;  2HPS A;  1J7O A;  2LAN A;  4NDD A;  2LE9 B;  4A4B A;  1RFJ A;  2M97 A;  2BBN A;  1MR8 A;  1TCF A;  3CWG A;  2K61 A;  1K9U A;  1Y1A A;  3CR5 X;  1IWQ A;  1PK0 D;  2P6B B;  3EK8 A;  4Q04 A;  1XFV O;  3VRR A;  4OVN F;  3AKB A;  3I5I B;  4FQO A;  1M31 A;  2V53 A;  2ZRS A;  1REC A;  1MUX A;  4ZCU A;  4YGA A;  2LP2 A;  5J3X A;  2PSR A;  1OZS A;  2KQY A;  1YRU B;  3E3R A;  2M49 B;  4GGF A;  2MAZ A;  3TS5 B;  1QX2 A;  1YR5 A;  2L50 A;  1PVB A;  1QIV A;  2DOQ A;  2FCE A;  2JTZ A;  3BUO B;  4M2O A;  1CB1 A;  1QLS A;  1WY9 A;  1BLQ A;  3KEV A;  1OMR A;  3PSR A;  1RWY A;  3OX6 A;  3EKH A;  2ZRT A;  1KFU S;  1C7W A;  3PN7 C;  3JTD C;  1XYD A;  3BUM B;  4QJ5 B;  1J1E A;  3O4Y A;  4YBH B;  1B8L A;  1UHN A;  1KFX S;  5I8N A;  2WCB A;  2JT0 A;  2LUC A;  3IQQ A;  2OS8 C;  1KK8 C;  2WOR A;  4MZL A;  3RM1 A;  2KSP A;  2KHN A;  4OKH A;  2IS9 A;  2NCP A;  3NSO A;  1MHO A;  1ALW A;  1UUS A;  1RTP 1;  1KCY A;  1B8C A;  5KSZ A;  3VRQ A;  3TZ1 A;  1K2H A;  4CID A;  3KHE A;  1AK8 A;  2CXJ A;  1RK9 A;  1NX0 A;  3TDZ A;  1YVL A;  1JBA A;  1DTL A;  1G33 A;  2M29 A;  1SL8 A;  3FWC A;  1IKU A;  1XFX O;  1CKK A;  1DF0 B;  1N65 A;  2M3W A;  1OOJ A;  2KI4 C;  4XJK B;  2L98 A;  1DF0 A;  3I5F C;  3KO0 A;  1C07 A;  3GOF A;  3AKA A;  2O5G A;  1NWD A;  5D7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...