1F55A

Solution structure of the calcium bound n-terminal domain of yeast calmodulin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CALMODULIN
publication title Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f55A00
2I94A 2AUCA 1B9AA 1UHJA 2MLEC 1NCYA 1RJVA 1ALWA 1QVIZ 2AMIA 3D0YB 3FS7A 4XJKA 3PALA 1U5IA 1BU3A 2JC2A 3O78A 2KI4B 1EG4A 2O5GA 4OVNF 1FW4A 2ZN8A 1WRLA 3NSIA 1NUBA 1QLSA 4UPGA 1DT7B 2G9BA 1KQVA 1IWQA 1OQPA 3O2PA 1IGVA 4YGAA 3TS5C 5HLOA 2MA2A 4BY4A 1FI5A 1JF2A 3WHTB 2JXLA 3BUXB 1U5IB 1SNLA 1YX7A 5DKRA 1UHIA 4PHKA 1ZACA 4MZKA 1B8RA 1SYMA 4D1EA 2HQ8A 2BE6A 3M0WA 2M8UA 4P5OE 2I2RE 1KFUL 2LVJA 2QPTA 4YI8A 1KK7Z 4N1FA 1S6JA 1S26D 1WDCB 1YVHA 2ZNEA 5J3XA 2ZRTA 1FBVA 2ISDA 4R1EA 1BR4B 3EVVA 2JNFA 1KCYA 1HT9A 2M29A 1S1EA 3CTNA 3NSLA 1JC2A 4MLWA 2JXCA 2MJWB 4I5KA 1NIWA 1TRFA 2KHNA 2KGRA 1YRUB 2KYFA 2QACA 1K90D 3I5HC 3SG2A 2WC8A 3BYAA 4YI9A 5JOLA 4JWQA 2OS8C 5F6TA 2TN4A 2ZRSA 4FTGA 3SG3A 1GQMA 4PHJA 3VRQA 1KQMB 1NX1A 3BUMB 4TNCA 2PASA 4Q04A 1PVBA 2CCMA 4GBAA 5DKQA 2LM5A 1GGZA 1PSBA 2WCFA 2LP2A 2CNPA 1CMFA 3PN7B 3QRXA 4HSZA 4YGDB 2KQYA 1A75B 3AKAA 2LVIA 1DJWA 1CKKA 2NLNA 1IQ3A 1DJHA 3AAJA 1FI6A 1RK9A 2SCPA 3I5GC 2JRFA 1S3PA 2JQ6A 1SRAA 5HYDA 1A29A 3OHMB 3KHEA 3SG4A 5I2LA 4C0KA 1RWYA 1FPWA 2KGBC 2HETA 2MHHA 1CLMA 3PFVA 1NX2A 1YURA 1TNQA 3SJSA 4PE4A 1R2UA 2LLTA 2ZFDA 2COLB 2L50A 1F4QA 3WHUB 1S6CA 4YGEB 1QVIY 1AJ5A 4PHMA 1E8AA 1W7IB 2M49B 1IRJA 2WCBA 4YGBB 2MBXA 3EK8A 1CDPA 1CMGA 3BXKA 1XK4C 1M31A 3GK2A 2MRDA 2F2PA 2PVBA 1MR8A 1QATA 2F33A 2G2BA 1MWNA 2M97A 3EK4A 1PULA 3I5IC 3O6BA 1BLQA 3H4SE 1HQVA 5CPVA 2EGDA 4A4CA 3K21A 4MBEA 1L7ZA 1JFJA 1SCMB 5I8NA 4PE0A 1A03A 2CTNA 1XFYO 1YUSA 3JVTB 1Y0VH 1KK7Y 1XVJA 1KFUS 1SK6D 2K2FA 4HRGA 1C7VA 1ZMZA 4ORAB 1XFXO 3LLEA 3SG5A 1DGUA 4N1GA 3TDZA 2H61A 2LMTA 2Y1NA 1DMOA 4OR9B 1SR6B 1TNXA 1PSRA 1N2DA 2E6WA 2V53A 3KPXA 5I2QA 2EC6C 1DVIA 3EK7A 1ALVA 4CPVA 1B47A 5KTYA 1TIZA 3DF0A 2GGZA 1XO5A 1F70A 3PM8A 1LA0A 4WQ3A 4CFRA 2WOSA 1K8UA 4GFTA 4GGFC 1MHOA 1CM4A 5HLVA 1YVLA 2KAXA 1UURA 2BCBA 1XFWO 2F3ZA 1Y1AA 4MN0A 2MLFC 1AP4A 1NCZA 5K89A 2CXJA 2FCEA 2Q91A 1PALA 3LL8B 2AAOA 5FYXA 3CR5X 3DVMA 4YRUA 2H2KA 1MQ1A 4A4BA 2HQWA 2LUXA 1JSAA 1IJ5A 1QX5B 1YTZC 2PALA 3EVUA 4ORBB 2JT8A 1YR5A 1PRWA 1XFUO 3IQOA 2M7LA 3CR4X 2JOJA 2KDHA 1SW8A 1NX3A 2WORA 1IQ5A 1DF0A 1M63B 2DOQA 2K7BA 1TCOB 2KFGA 4YBHB 1BOCA 1CLBA 1LA3A 1DTLA 3TS5B 1B4CA 4OV2A 4PALA 1DF0B 2PRUA 1YX8A 3BUNB 1DJXA 4F0ZB 3FWBA 2K7OA 3DVJA 1UWOA 1SL7A 2JZIA 4CLNA 2JNXA 5CSIA 1CDLA 1AVSA 1OSAA 1NSHA 2M1KB 2F2OA 1G4YR 4GGNA 1F55A 1DJYA 5AANA 2BKIB 1XYDA 3NXAA 4BY5A 5I2OA 1K2HA 4C0JA 3AKBA 2M9GA 3SG7A 4ETOA 2HPSA 1V1FA 1A75A 2KI6D 2LLSA 1K9PA 1VRKA 5HKYA 1SPYA 2LVKA 3I5HB 2SASA 1S36A 2OS8B 3KF9A 4I5LB 5CSNA 1L2OC 2NXQA 2GV5A 3IQQA 4CIDA 1KK8C 2PMYA 1TCFA 1XFZO 2KBIA 2LC5A 2M3WA 2M7NA 3BOWA 3FIAA 3OB2B 3OP0A 2I18A 4HREE 1CTRA 4U8DA 1A2XA 4JPZB 1RECA 3CS1A 1CM1A 2FJUB 4GNKB 3CGAA 4DIRA 2BL0C 1CLLA 1FF1A 2BKHB 5D7FA 1AJ4A 3F45A 3SG6A 3TUYC 3BOWB 4USLA 4IL1A 3HX4A 1NYAA 1YUUA 2LAPA 4DCKA 4AQIA 1B1GA 1K9UA 3KEVA 1AK8A 2BCXA 3I5GB 2BBNA 2M1UA 1JBAA 1J7QA 3TUYB 3EKHA 1EH2A 1JF0A 3RLZA 1F71A 1G33A 1DJZA 2ZN9A 2LV7A 1W7JB 2L2EA 4MSPA 3EKJA 2KBMA 1LVCD 3SIBA 3D10A 1CFFA 1S5GZ 1XK4A 1F54A 4NQGA 1BT6A 2L98A 2LUCA 2ZKMX 2K7CA 3TDUA 5HKZA 1QLKA 4ZCUA 2LP3A 3CLNA 2KAYA 2Q4UA 3KO0A 3RM1A 1RFJA 2WCEA 2B1UA 1J7PA 1TNPA 1QS7A 1WY9A 1NWDA 3I5IB 2P6BB 1M39A 1SMGA 1K95A 1SL8A 3OX5A 2OTGC 1MUXA 2NZ0A 1KFXL 1YRTB 2JU0A 2WNDA 1F8HA 2VRGA 2KFFA 3A8RA 5AFPA 1DJGA 1WLZA 5CSFA 1J55A 2OTGB 3LCPC 1M46A 4GGFA 2EC6B 1IG5A 3WNXB 3VROA 1B7TZ 2BCAA 3PATA 5GQQC 1CFCA 1QIWA 1KSOA 2I7AA 2O60A 2KSPA 1RROA 1J1DA 2JWWA 1RTP1 1BMOA 4N5XA 1WRZA 2LHLA 4NDBA 2Y5IA 2M0RA 4ICBA 2JT0A 1SKTA 4MRXA 1WRKA 4AQJA 1CNPA 2EHBA 1F4OA 4C0LA 4GAOA 4I5JA 2LHIA 3GK4X 2KFHA 2LLUA 3BUWB 1UP5A 1MXEA 1ZUZA 3NSOA 1KSMA 1OZSA 1DGVA 3DD4A 3ZWHA 1D1OA 4JQ0D 2HF5A 1OE9B 1OZOA 5PALA 3MSEB 4OKHA 2LVVA 3GK1A 1EG3A 5BPJA 4WQ2A 2JT3A 1YUTA 1JFKA 1GJYA 1UHKA 3TZ1A 2JTZA 3AAKA 4MVFA 2K61A 4MZLA 4M2QA 3VRPA 3VRRA 1Q80A 3TDIA 5AXIA 1WDCC 2L4HA 3EVRA 1LXFC 4XJKB 1UHHA 1C07A 2JULA 4PHNA 4CFQA 3PLFB 1S5GY 1X02A 1N65A 1AUIB 4M2PA 4I5NB 4FQOA 2KQ6A 4PE1A 5AEQA 1EL4A 3JTDC 3WXAA 2BECA 3OX6A 3SIAA 1CFPA 2CT9A 1R6PA 3FWCA 4NDDA 3ZNIA 3DVEA 4HRHA 3LK0A 1ZFSA 1NCXA 2KOTA 3ICBA 1IJ6A 1JWDA 1QASA 1TNWA 1MXLC 4ZCVA 4PE7A 3JTDB 1QX2A 1KQMC 4GUKA 1OMRA 1V1GA 1UUSA 2Y1MA 1TOPA 1PK0D 4PCWA 1QIVA 5B8IB 1KFXS 2LANA 3DVKA 1OMDA 4WRIA 2LE9B 1ODBA 4DRWA 2PSRA 2F3YA 5IBWA 2FOTA 1DJIA 2L5XB 3PN7C 4QJ5B 1CFDA 2D8NA 1LKJA 5CSJA 3HCMA 2A4JA 3CZTX 1L2OB 3OB1B 1QXPA 1CB1A 1QX7A 1KK8B 2ZNDA 1BJFA 2LMUA 1B7TY 1EJ3A 2JPTA 1XFVO 2L4IA 1MF8B 3CR2A 1K9KA 4MEWA 4QJ3B 5G08A 1TTXA 1A4PA 1QTXA 4DS7A 2BL0B 2L0PA 4PDZA 4M2OA 2F8PA 1TN4A 4AOMA 3A4UB 2K8MB 5HKWA 1K94A 5KU1A 2BE4A 5KSZA 1NX0A 1QJTA 4GPLB 1BR1B 4E68A 1LINA 3C1VA 1H4BA 1SY9A 2Y4QA 1WLMA 3NSKA 1QV1A 1BF5A 1SCVA 4ORCB 4YGCB 2CBLA 2BBMA 1S6IA 4XYNA 2K0JA 2NCOA 2JTTA 1C7WA 2NCPA 4NDCA 1GGWA 1B8LA 3CWGA 3GOFA 2KNEA 3LK1A 1QV0A 2L51A 1SCMC 2KI6C 1CDMA 1ZOTB 1J1EA 3JVTC 2R2IA 4P2YB 4L9MA 1J7RA 1K93D 5TNCA 2E30A 5D69A 1IKUA 1B8CA 1SL9A 1BG1A 3VRNA 1NP8A 3BQ3A 3VGOA 4QJ4B 1AHRA 1SR6C 2MAZA 1Y1XA 1Y1UA 3IF7A 5DKNA 1BODA 2H61C 2RGIA 1KWOC 3O4YA 4OCIA 2GGMA 2K2AA 1CDNA 1M45A 1OMVA 1JUOA 1N0YA 3E3RA 3PSRA 1IH0A 3I5FC 1PVAA 2OPOA 1Y6WA 1SBJA 3BUOB 1EXRA 1G8IA 1UHNA 5ER5A 1H8BA 2KAVA 1KWOB 4MRYA 2LMVA 2FCDA 4MZJA 5ER4X 4DUQA 1OOJA 5JJGA 1K96A 5AERA 1XA5A 2KI4C 3D0YA 2IS9A 2K7DA 2KYCA 1NPQA 3I5FB 1J7OA 3DF0B 2LCPA 2LNKA
chains in the Genus database with same CATH superfamily
2I94A 4FQTA 2AUCA 1B9AA 1UHJA 2MLEC 1NCYA 1RJVA 1ALWA 2WCMA 3OBVA 3PM2A 1QVIZ 2AMIA 3D0YB 3FS7A 4XJKA 3PALA 1U5IA 1BU3A 5HL1A 2JC2A 3O78A 2KI4B 1EG4A 2O5GA 4OVNF 1FW4A 2ZN8A 1WRLA 3NSIA 1NUBA 1QLSA 3VB1A 4UPGA 2G9BA 1DT7B 1KQVA 1IWQA 1OQPA 3O2PA 1IGVA 4YGAA 1Z4HA 3TS5C 5HLOA 2MA2A 4BY4A 1FI5A 1JF2A 3WHTB 2JXLA 3BUXB 4INXA 1U5IB 1SNLA 1YX7A 1DELA 1XFRA 1UHIA 4PHKA 3Q8IA 1ZACA 4MZKA 1B8RA 1SYMA 5DKRA 4D1EA 2HQ8A 2BE6A 3M0WA 2M8UA 4P5OE 2I2RE 1KFUL 2LVJA 2QEVA 2QPTA 4YI8A 1KK7Z 4N1FA 1S6JA 1S26D 1WDCB 1YVHA 2ZNEA 5J3XA 2ZRTA 1FBVA 3CDNA 2ISDA 4R1EA 1BR4B 1TUJA 3EVVA 2JNFA 1KCYA 1HT9A 2M29A 2FJYA 1S1EA 4JKTA 5D3OA 3CTNA 3NSLA 1JC2A 4MLWA 2JXCA 2MJWB 4I5KA 4OZDA 1NIWA 1TRFA 2KHNA 2KGRA 1YRUB 2KYFA 2QACA 1K90D 3K1EA 1DC1A 3I5HC 3SG2A 2WC8A 3BYAA 4YI9A 5JOLA 4JWQA 3S0DA 2OS8C 5F6TA 2TN4A 2ZRSA 4FTGA 3SG3A 1GQMA 5FI6A 4PHJA 3VRQA 2WC5A 1KQMB 1NX1A 3BUMB 4TNCA 2PASA 4Q04A 3O4XA 1PVBA 2CCMA 4GBAA 5DKQA 1C3YA 2LM5A 1GGZA 1PSBA 3L47A 2WCFA 2LP2A 2CNPA 1CMFA 3PN7B 3QRXA 4HSZA 4YGDB 3S0EA 2KQYA 3R1PA 3FE6A 1A75B 2WCJA 3AKAA 2LVIA 1DJWA 1CKKA 2NLNA 1IQ3A 1DJHA 3AAJA 1FI6A 1C3ZA 1RK9A 2SCPA 3CZ2A 3I5GC 2JRFA 3L4AA 1S3PA 2JQ6A 1SRAA 2P70A 5HYDA 1A29A 3OHMB 3KHEA 3SG4A 5I2LA 4C0KA 1RWYA 1FPWA 2KGBC 2HETA 2MHHA 1CLMA 3PFVA 1NX2A 1YURA 1TNQA 3SJSA 4PE4A 1R2UA 5EL2A 2LLTA 2ZFDA 2COLB 2L50A 1F4QA 3WHUB 1S6CA 4YGEB 3EG5B 1QVIY 1AJ5A 4PHMA 1E8AA 1W7IB 2M49B 1IRJA 2WCBA 3D78A 4YGBB 2MBXA 3EK8A 1CDPA 1CMGA 3IVTA 3BXKA 1XK4C 1M31A 3GK2A 2MRDA 2F2PA 2PVBA 1MR8A 1QATA 2F33A 2G2BA 1MWNA 2M97A 3EK4A 1PULA 3I5IC 3O6BA 1BLQA 3H4SE 1HQVA 5CPVA 2EGDA 4A4CA 3K21A 1ORGA 3FE9A 1L7ZA 4MBEA 1SCMB 1JFJA 5I8NA 4PE0A 1A03A 2CTNA 1XFYO 1YUSA 2H8VA 1Y0VH 1KK7Y 1XVJA 1KFUS 1SK6D 2K2FA 4HRGA 1C7VA 1ZMZA 4ORAB 1XFXO 3LLEA 3SG5A 1DGUA 4N1GA 2QDIA 1QWVA 3TDZA 2H61A 2LMTA 2Y1NA 1DMOA 4OR9B 1SR6B 1TNXA 1PSRA 1N2DA 2E6WA 2V53A 3KPXA 5I2QA 1T14A 2EC6C 1DVIA 3EK7A 1ALVA 4CPVA 2BNXA 1B47A 5KTYA 1TIZA 3DF0A 2GGZA 1XO5A 1F70A 1P28A 3PM8A 1LA0A 1OOGA 4WQ3A 4CFRA 2WOSA 1K8UA 4GFTA 4GGFC 1MHOA 1CM4A 5HLVA 1YVLA 3BFBA 2KAXA 1UURA 1XFWO 2BCBA 2F3ZA 2L2CA 1Y1AA 4MN0A 2MLFC 1AP4A 1NCZA 5K89A 2CXJA 2FCEA 2Q91A 1PALA 3LL8B 2AAOA 5FYXA 3CR5X 3DVMA 4YRUA 2H2KA 1MQ1A 4A4BA 2HQWA 2LUXA 1JSAA 1IJ5A 1QX5B 1YTZC 2PALA 3CZ1A 3EVUA 4ORBB 2JT8A 1YR5A 1PRWA 1XFUO 3IQOA 2M7LA 3CR4X 2JOJA 2KDHA 1SW8A 1NX3A 2WORA 1DEKA 3SS4A 1IQ5A 1DF0A 1M63B 2DOQA 2K7BA 1TCOB 2KFGA 4YBHB 1BOCA 1CLBA 1LA3A 1DTLA 3TS5B 1B4CA 4OV2A 4PALA 1DF0B 2PRUA 1YX8A 3BUNB 1DJXA 4F0ZB 3FWBA 2K7OA 3DVJA 1UWOA 1SL7A 2JZIA 4CLNA 2JNXA 5CSIA 1CDLA 2YGUA 1DQEA 1AVSA 3S0AA 1OSAA 1NSHA 2M1KB 2F2OA 1G4YR 4GGNA 1F55A 1DJYA 5AANA 2BKIB 3NHIA 1XYDA 3NXAA 4BY5A 5I2OA 1K2HA 2P71A 4C0JA 2WCHA 3AKBA 2M9GA 2PYQA 3SG7A 4ETOA 2HPSA 1V1FA 1A75A 2KI6D 2LLSA 1K9PA 1VRKA 3B87A 1SPYA 2LVKA 3I5HB 5HKYA 3NGVA 2SASA 1S36A 2OS8B 2K60A 3KF9A 4I5LB 3B7AA 5CSNA 1L2OC 2NXQA 2GV5A 3IQQA 4CIDA 1KK8C 2PMYA 2WCKA 1TCFA 1XFZO 2KBIA 2LC5A 2M3WA 2M7NA 1LS8A 3BOWA 3FIAA 3OB2B 2I18A 4HREE 1CTRA 4U8DA 1A2XA 4JPZB 1RECA 1GM0A 3CS1A 2PQLA 1CM1A 2FJUB 4GNKB 3CGAA 4DIRA 2BL0C 1CLLA 1FF1A 2BKHB 5D7FA 1AJ4A 3F45A 3SG6A 3TUYC 3BOWB 4USLA 3QMEA 4IL1A 3HX4A 1NYAA 1YUUA 2LAPA 4DCKA 3NHTA 4AQIA 1B1GA 1TWOA 1K9UA 3KEVA 3D77A 2BCXA 3I5GB 1AK8A 2BBNA 2M1UA 3BJHA 1JBAA 1J7QA 2QEBA 1W9ZA 3EKHA 3TUYB 1EH2A 1JF0A 3RLZA 1F71A 1G33A 1DJZA 3UO9A 2ZN9A 2LV7A 1W7JB 2L2EA 4MSPA 1OW4A 2KBMA 3EKJA 1LVCD 2L5YA 5FI7A 3SIBA 3D10A 1CFFA 2KPHA 1S5GZ 1XK4A 3PJIA 1F54A 4NQGA 1BT6A 2L98A 2LUCA 2ZKMX 2K7CA 3TDUA 5HKZA 1QLKA 3N7HA 4ZCUA 2ERBA 2LP3A 3CLNA 2KAYA 2Q4UA 3KO0A 3RM1A 1RFJA 2WCEA 5FI2A 2B1UA 1J7PA 1TNPA 1QS7A 1WY9A 1NWDA 3I5IB 4NDBA 2P6BB 1M39A 1SMGA 1K95A 1SL8A 3OX5A 3FE8A 2OTGC 1MUXA 2NZ0A 1KFXL 1YRTB 2JU0A 2WNDA 1F8HA 2VRGA 2KFFA 3A8RA 5AFPA 3DZTA 1DJGA 1WLZA 3CZ0A 4KYNA 3D75A 5CSFA 3DY9A 1J55A 2OTGB 3LCPC 1M46A 3DXLA 4GGFA 2EC6B 1IG5A 3WNXB 3VROA 1B7TZ 2BCAA 3PATA 5GQQC 1CFCA 1QIWA 1KSOA 2I7AA 2O60A 2KSPA 1RROA 1J1DA 2JWWA 1RTP1 4JD9A 1BMOA 4N5XA 1WRZA 2LHLA 3D73A 2Y5IA 2M0RA 4ICBA 2JT0A 1SKTA 4MRXA 1WRKA 4AQJA 1CNPA 2EHBA 1F4OA 4C0LA 4GAOA 4I5JA 2LHIA 3GK4X 2KFHA 2LLUA 3BUWB 1UP5A 1IIOA 1MXEA 1ZUZA 3NSOA 3R1VA 1KSMA 1OZSA 1DGVA 3DD4A 3ZWHA 1D1OA 4JQ0D 2HF5A 1OE9B 1OZOA 5PALA 3MSEB 4OKHA 2LVVA 1SSEB 1EG3A 3DYEA 3GK1A 4WQ2A 1Z2CB 3BFAA 5BPJA 2JT3A 1YUTA 1JFKA 1GJYA 1UHKA 2WCLA 3TZ1A 2JTZA 3AAKA 4MVFA 2K61A 4MZLA 4M2QA 3VRPA 3VRRA 3S0FA 1Q80A 3TDIA 5AXIA 1WDCC 2L4HA 3EVRA 1LXFC 1OOIX 1OOFA 4XJKB 1UHHA 2KLDA 2JULA 1C07A 4PHNA 2KLEA 4CFQA 3PLFB 1S5GY 1X02A 1N65A 1AUIB 3JVTB 4M2PA 4I5NB 3OP0A 4FQOA 2KQ6A 4PE1A 5AEQA 1EL4A 3JTDC 3WXAA 2BECA 3OX6A 3SIAA 5I94A 1CFPA 2CT9A 1R6PA 3FWCA 4NDDA 3ZNIA 3DVEA 4HRHA 3LK0A 1ZFSA 1NCXA 2KOTA 3ICBA 1IJ6A 3B86A 1QASA 1JWDA 1TNWA 1MXLC 4ZCVA 4PE7A 3JTDB 1QX2A 3D74A 3S0GA 1KQMC 4GUKA 1OMRA 1V1GA 1UUSA 2Y1MA 1TOPA 1PK0D 4PCWA 1QIVA 5B8IB 1KFXS 2LANA 3DVKA 1OMDA 4WRIA 2LE9B 1ODBA 3SS3A 4DRWA 2PSRA 2F3YA 5IBWA 2FOTA 1DJIA 2L5XB 3PN7C 4QJ5B 1CFDA 2D8NA 1LKJA 5CSJA 3UNWA 3HCMA 2A4JA 3CZTX 3SS5A 1L2OB 3OB1B 1QXPA 1CB1A 1QX7A 1KK8B 2ZNDA 1BJFA 3RZSA 2LMUA 3OGNA 1B7TY 1EJ3A 2JPTA 1XFVO 2L4IA 1MF8B 2GTEA 3CR2A 3BFHA 1K9KA 4MEWA 4QJ3B 5G08A 1TTXA 1A4PA 1QTXA 4DS7A 2BL0B 2L0PA 4INWA 4PDZA 4M2OA 2F8PA 3B88A 1TN4A 2WC6A 3A4UB 4AOMA 2K8MB 5HKWA 3CYZA 1K94A 5KU1A 2BE4A 3R72A 5KSZA 1NX0A 1QJTA 4GPLB 1BR1B 4E68A 1LINA 3C1VA 1H4BA 1SY9A 2Y4QA 1WLMA 3NSKA 1QV1A 3B6XA 1BF5A 1SCVA 4ORCB 4YGCB 2CBLA 2BBMA 1S6IA 4XYNA 2K0JA 2NCOA 3S0BA 2JTTA 1C7WA 2NCPA 4NDCA 1GGWA 1B8LA 3CWGA 3GOFA 4PT1A 2KNEA 3LK1A 1QV0A 2L51A 1SCMC 2KI6C 3V2LA 1CDMA 1ZOTB 1J1EA 1OOHA 3JVTC 2R2IA 4P2YB 4L9MA 1J7RA 1K93D 5TNCA 2E30A 5D69A 1IKUA 1TUZA 4F7FA 1B8CA 1SL9A 1BG1A 3VRNA 1NP8A 3BQ3A 3VGOA 4QJ4B 1AHRA 1SR6C 2MAZA 4IJ7A 1Y1XA 1Y1UA 3CABA 3IF7A 5DKNA 1BODA 2H61C 2RGIA 1KWOC 3O4YA 4OCIA 2GGMA 2K2AA 1CDNA 1M45A 1OMVA 1JUOA 3L4LA 2QEHA 5DICA 1N0YA 3E3RA 3PSRA 1IH0A 3I5FC 1PVAA 2OPOA 1Y6WA 1SBJA 3BUOB 3R1OA 1EXRA 3D76A 1G8IA 1UHNA 5ER5A 1H8BA 2KAVA 1KWOB 4MRYA 2LMVA 2FCDA 4MZJA 5ER4X 4DUQA 1OOJA 5JJGA 1K96A 5AERA 1XA5A 2KI4C 2JPOA 2IS9A 2K7DA 3D0YA 2KYCA 2QEOA 1NPQA 3I5FB 1J7OA 2BAPA 3DF0B 2LCPA 2LNKA
chains in the Genus database with same CATH topology
2I94A 2AUCA 1B9AA 1UHJA 2MLEC 1NCYA 1RJVA 1ALWA 1QVIZ 2AMIA 3D0YB 3FS7A 4XJKA 3PALA 1U5IA 1BU3A 2JC2A 3O78A 2KI4B 1EG4A 2O5GA 4OVNF 1FW4A 2ZN8A 1WRLA 3NSIA 1NUBA 1QLSA 4UPGA 1DT7B 2G9BA 1KQVA 1IWQA 1OQPA 3O2PA 1IGVA 4YGAA 3TS5C 5HLOA 2MA2A 4BY4A 1FI5A 1JF2A 3WHTB 2JXLA 3BUXB 1U5IB 1SNLA 1YX7A 5DKRA 1UHIA 4PHKA 1ZACA 4MZKA 1B8RA 1SYMA 4D1EA 2HQ8A 2BE6A 3M0WA 2M8UA 4P5OE 2I2RE 1KFUL 2LVJA 2QPTA 4YI8A 1KK7Z 4N1FA 1S6JA 1S26D 1WDCB 1YVHA 2ZNEA 5J3XA 2ZRTA 1FBVA 2ISDA 4R1EA 1BR4B 3EVVA 2JNFA 1KCYA 1HT9A 2M29A 1S1EA 3CTNA 3NSLA 1JC2A 4MLWA 2JXCA 2MJWB 4I5KA 1NIWA 1TRFA 2KHNA 2KGRA 1YRUB 2KYFA 2QACA 1K90D 3I5HC 3SG2A 2WC8A 3BYAA 4YI9A 5JOLA 4JWQA 2OS8C 5F6TA 2TN4A 2ZRSA 4FTGA 3SG3A 1GQMA 4PHJA 3VRQA 1KQMB 1NX1A 3BUMB 4TNCA 2PASA 4Q04A 1PVBA 2CCMA 4GBAA 5DKQA 2LM5A 1GGZA 1PSBA 2WCFA 2LP2A 2CNPA 1CMFA 3PN7B 3QRXA 4HSZA 4YGDB 2KQYA 1A75B 3AKAA 2LVIA 1DJWA 1CKKA 2NLNA 1IQ3A 1DJHA 3AAJA 1FI6A 1RK9A 2SCPA 3I5GC 2JRFA 1S3PA 2JQ6A 1SRAA 5HYDA 1A29A 3OHMB 3KHEA 3SG4A 5I2LA 4C0KA 1RWYA 1FPWA 2KGBC 2HETA 2MHHA 1CLMA 3PFVA 1NX2A 1YURA 1TNQA 3SJSA 4PE4A 1R2UA 2LLTA 2ZFDA 2COLB 2L50A 1F4QA 3WHUB 1S6CA 4YGEB 1QVIY 1AJ5A 4PHMA 1E8AA 1W7IB 2M49B 1IRJA 2WCBA 4YGBB 2MBXA 3EK8A 1CDPA 1CMGA 3BXKA 1XK4C 1M31A 3GK2A 2MRDA 2F2PA 2PVBA 1MR8A 1QATA 2F33A 2G2BA 1MWNA 2M97A 3EK4A 1PULA 3I5IC 3O6BA 1BLQA 3H4SE 1HQVA 5CPVA 2EGDA 4A4CA 3K21A 4MBEA 1L7ZA 1JFJA 1SCMB 5I8NA 4PE0A 1A03A 2CTNA 1XFYO 1YUSA 3JVTB 1Y0VH 1KK7Y 1XVJA 1KFUS 1SK6D 2K2FA 4HRGA 1C7VA 1ZMZA 4ORAB 1XFXO 3LLEA 3SG5A 1DGUA 4N1GA 3TDZA 2H61A 2LMTA 2Y1NA 1DMOA 4OR9B 1SR6B 1TNXA 1PSRA 1N2DA 2E6WA 2V53A 3KPXA 5I2QA 2EC6C 1DVIA 3EK7A 1ALVA 4CPVA 1B47A 5KTYA 1TIZA 3DF0A 2GGZA 1XO5A 1F70A 3PM8A 1LA0A 4WQ3A 4CFRA 2WOSA 1K8UA 4GFTA 4GGFC 1MHOA 1CM4A 5HLVA 1YVLA 2KAXA 1UURA 2BCBA 1XFWO 2F3ZA 1Y1AA 4MN0A 2MLFC 1AP4A 1NCZA 5K89A 2CXJA 2FCEA 2Q91A 1PALA 3LL8B 2AAOA 5FYXA 3CR5X 3DVMA 4YRUA 2H2KA 1MQ1A 4A4BA 2HQWA 2LUXA 1JSAA 1IJ5A 1QX5B 1YTZC 2PALA 3EVUA 4ORBB 2JT8A 1YR5A 1PRWA 1XFUO 3IQOA 2M7LA 3CR4X 2JOJA 2KDHA 1SW8A 1NX3A 2WORA 1IQ5A 1DF0A 1M63B 2DOQA 2K7BA 1TCOB 2KFGA 4YBHB 1BOCA 1CLBA 1LA3A 1DTLA 3TS5B 1B4CA 4OV2A 4PALA 1DF0B 2PRUA 1YX8A 3BUNB 1DJXA 4F0ZB 3FWBA 2K7OA 3DVJA 1UWOA 1SL7A 2JZIA 4CLNA 2JNXA 5CSIA 1CDLA 1AVSA 1OSAA 1NSHA 2M1KB 2F2OA 1G4YR 4GGNA 1F55A 1DJYA 5AANA 2BKIB 1XYDA 3NXAA 4BY5A 5I2OA 1K2HA 4C0JA 3AKBA 2M9GA 3SG7A 4ETOA 2HPSA 1V1FA 1A75A 2KI6D 2LLSA 1K9PA 1VRKA 5HKYA 1SPYA 2LVKA 3I5HB 2SASA 1S36A 2OS8B 3KF9A 4I5LB 5CSNA 1L2OC 2NXQA 2GV5A 3IQQA 4CIDA 1KK8C 2PMYA 1TCFA 1XFZO 2KBIA 2LC5A 2M3WA 2M7NA 3BOWA 3FIAA 3OB2B 3OP0A 2I18A 4HREE 1CTRA 4U8DA 1A2XA 4JPZB 1RECA 3CS1A 1CM1A 2FJUB 4GNKB 3CGAA 4DIRA 2BL0C 1CLLA 1FF1A 2BKHB 5D7FA 1AJ4A 3F45A 3SG6A 3TUYC 3BOWB 4USLA 4IL1A 3HX4A 1NYAA 1YUUA 2LAPA 4DCKA 4AQIA 1B1GA 1K9UA 3KEVA 1AK8A 2BCXA 3I5GB 2BBNA 2M1UA 1JBAA 1J7QA 3TUYB 3EKHA 1EH2A 1JF0A 3RLZA 1F71A 1G33A 1DJZA 2ZN9A 2LV7A 1W7JB 2L2EA 4MSPA 3EKJA 2KBMA 1LVCD 3SIBA 3D10A 1CFFA 1S5GZ 1XK4A 1F54A 4NQGA 1BT6A 2L98A 2LUCA 2ZKMX 2K7CA 3TDUA 5HKZA 1QLKA 4ZCUA 2LP3A 3CLNA 2KAYA 2Q4UA 3KO0A 3RM1A 1RFJA 2WCEA 2B1UA 1J7PA 1TNPA 1QS7A 1WY9A 1NWDA 3I5IB 2P6BB 1M39A 1SMGA 1K95A 1SL8A 3OX5A 2OTGC 1MUXA 2NZ0A 1KFXL 1YRTB 2JU0A 2WNDA 1F8HA 2VRGA 2KFFA 3A8RA 5AFPA 1DJGA 1WLZA 5CSFA 1J55A 2OTGB 3LCPC 1M46A 4GGFA 2EC6B 1IG5A 3WNXB 3VROA 1B7TZ 2BCAA 3PATA 5GQQC 1CFCA 1QIWA 1KSOA 2I7AA 2O60A 2KSPA 1RROA 1J1DA 2JWWA 1RTP1 1BMOA 4N5XA 1WRZA 2LHLA 4NDBA 2Y5IA 2M0RA 4ICBA 2JT0A 1SKTA 4MRXA 1WRKA 4AQJA 1CNPA 2EHBA 1F4OA 4C0LA 4GAOA 4I5JA 2LHIA 3GK4X 2KFHA 2LLUA 3BUWB 1UP5A 1MXEA 1ZUZA 3NSOA 1KSMA 1OZSA 1DGVA 3DD4A 3ZWHA 1D1OA 4JQ0D 2HF5A 1OE9B 1OZOA 5PALA 3MSEB 4OKHA 2LVVA 3GK1A 1EG3A 5BPJA 4WQ2A 2JT3A 1YUTA 1JFKA 1GJYA 1UHKA 3TZ1A 2JTZA 3AAKA 4MVFA 2K61A 4MZLA 4M2QA 3VRPA 3VRRA 1Q80A 3TDIA 5AXIA 1WDCC 2L4HA 3EVRA 1LXFC 4XJKB 1UHHA 1C07A 2JULA 4PHNA 4CFQA 3PLFB 1S5GY 1X02A 1N65A 1AUIB 4M2PA 4I5NB 4FQOA 2KQ6A 4PE1A 5AEQA 1EL4A 3JTDC 3WXAA 2BECA 3OX6A 3SIAA 1CFPA 2CT9A 1R6PA 3FWCA 4NDDA 3ZNIA 3DVEA 4HRHA 3LK0A 1ZFSA 1NCXA 2KOTA 3ICBA 1IJ6A 1JWDA 1QASA 1TNWA 1MXLC 4ZCVA 4PE7A 3JTDB 1QX2A 1KQMC 4GUKA 1OMRA 1V1GA 1UUSA 2Y1MA 1TOPA 1PK0D 4PCWA 1QIVA 5B8IB 1KFXS 2LANA 3DVKA 1OMDA 4WRIA 2LE9B 1ODBA 4DRWA 2PSRA 2F3YA 5IBWA 2FOTA 1DJIA 2L5XB 3PN7C 4QJ5B 1CFDA 2D8NA 1LKJA 5CSJA 3HCMA 2A4JA 3CZTX 1L2OB 3OB1B 1QXPA 1CB1A 1QX7A 1KK8B 2ZNDA 1BJFA 2LMUA 1B7TY 1EJ3A 2JPTA 1XFVO 2L4IA 1MF8B 3CR2A 1K9KA 4MEWA 4QJ3B 5G08A 1TTXA 1A4PA 1QTXA 4DS7A 2BL0B 2L0PA 4PDZA 4M2OA 2F8PA 1TN4A 4AOMA 3A4UB 2K8MB 5HKWA 1K94A 5KU1A 2BE4A 5KSZA 1NX0A 1QJTA 4GPLB 1BR1B 4E68A 1LINA 3C1VA 1H4BA 1SY9A 2Y4QA 1WLMA 3NSKA 1QV1A 1BF5A 1SCVA 4ORCB 4YGCB 2CBLA 2BBMA 1S6IA 4XYNA 2K0JA 2NCOA 2JTTA 1C7WA 2NCPA 4NDCA 1GGWA 1B8LA 3CWGA 3GOFA 2KNEA 3LK1A 1QV0A 2L51A 1SCMC 2KI6C 1CDMA 1ZOTB 1J1EA 3JVTC 2R2IA 4P2YB 4L9MA 1J7RA 1K93D 5TNCA 2E30A 5D69A 1IKUA 1B8CA 1SL9A 1BG1A 3VRNA 1NP8A 3BQ3A 3VGOA 4QJ4B 1AHRA 1SR6C 2MAZA 1Y1XA 1Y1UA 3IF7A 5DKNA 1BODA 2H61C 2RGIA 1KWOC 3O4YA 4OCIA 2GGMA 2K2AA 1CDNA 1M45A 1OMVA 1JUOA 1N0YA 3E3RA 3PSRA 1IH0A 3I5FC 1PVAA 2OPOA 1Y6WA 1SBJA 3BUOB 1EXRA 1G8IA 1UHNA 5ER5A 1H8BA 2KAVA 1KWOB 4MRYA 2LMVA 2FCDA 4MZJA 5ER4X 4DUQA 1OOJA 5JJGA 1K96A 5AERA 1XA5A 2KI4C 3D0YA 2IS9A 2K7DA 2KYCA 1NPQA 3I5FB 1J7OA 3DF0B 2LCPA 2LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I94 A;  2AUC A;  1B9A A;  1UHJ A;  2MLE C;  1NCY A;  1RJV A;  1ALW A;  1QVI Z;  2AMI A;  3D0Y B;  3FS7 A;  4XJK A;  3PAL A;  1U5I A;  1BU3 A;  2JC2 A;  3O78 A;  2KI4 B;  1EG4 A;  2O5G A;  4OVN F;  1FW4 A;  2ZN8 A;  1WRL A;  3NSI A;  1NUB A;  1QLS A;  4UPG A;  1DT7 B;  2G9B A;  1KQV A;  1IWQ A;  1OQP A;  3O2P A;  1IGV A;  4YGA A;  3TS5 C;  5HLO A;  2MA2 A;  4BY4 A;  1FI5 A;  1JF2 A;  3WHT B;  2JXL A;  3BUX B;  1U5I B;  1SNL A;  1YX7 A;  5DKR A;  1UHI A;  4PHK A;  1ZAC A;  4MZK A;  1B8R A;  1SYM A;  4D1E A;  2HQ8 A;  2BE6 A;  3M0W A;  2M8U A;  4P5O E;  2I2R E;  1KFU L;  2LVJ A;  2QPT A;  4YI8 A;  1KK7 Z;  4N1F A;  1S6J A;  1S26 D;  1WDC B;  1YVH A;  2ZNE A;  5J3X A;  2ZRT A;  1FBV A;  2ISD A;  4R1E A;  1BR4 B;  3EVV A;  2JNF A;  1KCY A;  1HT9 A;  2M29 A;  1S1E A;  3CTN A;  3NSL A;  1JC2 A;  4MLW A;  2JXC A;  2MJW B;  4I5K A;  1NIW A;  1TRF A;  2KHN A;  2KGR A;  1YRU B;  2KYF A;  2QAC A;  1K90 D;  3I5H C;  3SG2 A;  2WC8 A;  3BYA A;  4YI9 A;  5JOL A;  4JWQ A;  2OS8 C;  5F6T A;  2TN4 A;  2ZRS A;  4FTG A;  3SG3 A;  1GQM A;  4PHJ A;  3VRQ A;  1KQM B;  1NX1 A;  3BUM B;  4TNC A;  2PAS A;  4Q04 A;  1PVB A;  2CCM A;  4GBA A;  5DKQ A;  2LM5 A;  1GGZ A;  1PSB A;  2WCF A;  2LP2 A;  2CNP A;  1CMF A;  3PN7 B;  3QRX A;  4HSZ A;  4YGD B;  2KQY A;  1A75 B;  3AKA A;  2LVI A;  1DJW A;  1CKK A;  2NLN A;  1IQ3 A;  1DJH A;  3AAJ A;  1FI6 A;  1RK9 A;  2SCP A;  3I5G C;  2JRF A;  1S3P A;  2JQ6 A;  1SRA A;  5HYD A;  1A29 A;  3OHM B;  3KHE A;  3SG4 A;  5I2L A;  4C0K A;  1RWY A;  1FPW A;  2KGB C;  2HET A;  2MHH A;  1CLM A;  3PFV A;  1NX2 A;  1YUR A;  1TNQ A;  3SJS A;  4PE4 A;  1R2U A;  2LLT A;  2ZFD A;  2COL B;  2L50 A;  1F4Q A;  3WHU B;  1S6C A;  4YGE B;  1QVI Y;  1AJ5 A;  4PHM A;  1E8A A;  1W7I B;  2M49 B;  1IRJ A;  2WCB A;  4YGB B;  2MBX A;  3EK8 A;  1CDP A;  1CMG A;  3BXK A;  1XK4 C;  1M31 A;  3GK2 A;  2MRD A;  2F2P A;  2PVB A;  1MR8 A;  1QAT A;  2F33 A;  2G2B A;  1MWN A;  2M97 A;  3EK4 A;  1PUL A;  3I5I C;  3O6B A;  1BLQ A;  3H4S E;  1HQV A;  5CPV A;  2EGD A;  4A4C A;  3K21 A;  4MBE A;  1L7Z A;  1JFJ A;  1SCM B;  5I8N A;  4PE0 A;  1A03 A;  2CTN A;  1XFY O;  1YUS A;  3JVT B;  1Y0V H;  1KK7 Y;  1XVJ A;  1KFU S;  1SK6 D;  2K2F A;  4HRG A;  1C7V A;  1ZMZ A;  4ORA B;  1XFX O;  3LLE A;  3SG5 A;  1DGU A;  4N1G A;  3TDZ A;  2H61 A;  2LMT A;  2Y1N A;  1DMO A;  4OR9 B;  1SR6 B;  1TNX A;  1PSR A;  1N2D A;  2E6W A;  2V53 A;  3KPX A;  5I2Q A;  2EC6 C;  1DVI A;  3EK7 A;  1ALV A;  4CPV A;  1B47 A;  5KTY A;  1TIZ A;  3DF0 A;  2GGZ A;  1XO5 A;  1F70 A;  3PM8 A;  1LA0 A;  4WQ3 A;  4CFR A;  2WOS A;  1K8U A;  4GFT A;  4GGF C;  1MHO A;  1CM4 A;  5HLV A;  1YVL A;  2KAX A;  1UUR A;  2BCB A;  1XFW O;  2F3Z A;  1Y1A A;  4MN0 A;  2MLF C;  1AP4 A;  1NCZ A;  5K89 A;  2CXJ A;  2FCE A;  2Q91 A;  1PAL A;  3LL8 B;  2AAO A;  5FYX A;  3CR5 X;  3DVM A;  4YRU A;  2H2K A;  1MQ1 A;  4A4B A;  2HQW A;  2LUX A;  1JSA A;  1IJ5 A;  1QX5 B;  1YTZ C;  2PAL A;  3EVU A;  4ORB B;  2JT8 A;  1YR5 A;  1PRW A;  1XFU O;  3IQO A;  2M7L A;  3CR4 X;  2JOJ A;  2KDH A;  1SW8 A;  1NX3 A;  2WOR A;  1IQ5 A;  1DF0 A;  1M63 B;  2DOQ A;  2K7B A;  1TCO B;  2KFG A;  4YBH B;  1BOC A;  1CLB A;  1LA3 A;  1DTL A;  3TS5 B;  1B4C A;  4OV2 A;  4PAL A;  1DF0 B;  2PRU A;  1YX8 A;  3BUN B;  1DJX A;  4F0Z B;  3FWB A;  2K7O A;  3DVJ A;  1UWO A;  1SL7 A;  2JZI A;  4CLN A;  2JNX A;  5CSI A;  1CDL A;  1AVS A;  1OSA A;  1NSH A;  2M1K B;  2F2O A;  1G4Y R;  4GGN A;  1F55 A;  1DJY A;  5AAN A;  2BKI B;  1XYD A;  3NXA A;  4BY5 A;  5I2O A;  1K2H A;  4C0J A;  3AKB A;  2M9G A;  3SG7 A;  4ETO A;  2HPS A;  1V1F A;  1A75 A;  2KI6 D;  2LLS A;  1K9P A;  1VRK A;  5HKY A;  1SPY A;  2LVK A;  3I5H B;  2SAS A;  1S36 A;  2OS8 B;  3KF9 A;  4I5L B;  5CSN A;  1L2O C;  2NXQ A;  2GV5 A;  3IQQ A;  4CID A;  1KK8 C;  2PMY A;  1TCF A;  1XFZ O;  2KBI A;  2LC5 A;  2M3W A;  2M7N A;  3BOW A;  3FIA A;  3OB2 B;  3OP0 A;  2I18 A;  4HRE E;  1CTR A;  4U8D A;  1A2X A;  4JPZ B;  1REC A;  3CS1 A;  1CM1 A;  2FJU B;  4GNK B;  3CGA A;  4DIR A;  2BL0 C;  1CLL A;  1FF1 A;  2BKH B;  5D7F A;  1AJ4 A;  3F45 A;  3SG6 A;  3TUY C;  3BOW B;  4USL A;  4IL1 A;  3HX4 A;  1NYA A;  1YUU A;  2LAP A;  4DCK A;  4AQI A;  1B1G A;  1K9U A;  3KEV A;  1AK8 A;  2BCX A;  3I5G B;  2BBN A;  2M1U A;  1JBA A;  1J7Q A;  3TUY B;  3EKH A;  1EH2 A;  1JF0 A;  3RLZ A;  1F71 A;  1G33 A;  1DJZ A;  2ZN9 A;  2LV7 A;  1W7J B;  2L2E A;  4MSP A;  3EKJ A;  2KBM A;  1LVC D;  3SIB A;  3D10 A;  1CFF A;  1S5G Z;  1XK4 A;  1F54 A;  4NQG A;  1BT6 A;  2L98 A;  2LUC A;  2ZKM X;  2K7C A;  3TDU A;  5HKZ A;  1QLK A;  4ZCU A;  2LP3 A;  3CLN A;  2KAY A;  2Q4U A;  3KO0 A;  3RM1 A;  1RFJ A;  2WCE A;  2B1U A;  1J7P A;  1TNP A;  1QS7 A;  1WY9 A;  1NWD A;  3I5I B;  2P6B B;  1M39 A;  1SMG A;  1K95 A;  1SL8 A;  3OX5 A;  2OTG C;  1MUX A;  2NZ0 A;  1KFX L;  1YRT B;  2JU0 A;  2WND A;  1F8H A;  2VRG A;  2KFF A;  3A8R A;  5AFP A;  1DJG A;  1WLZ A;  5CSF A;  1J55 A;  2OTG B;  3LCP C;  1M46 A;  4GGF A;  2EC6 B;  1IG5 A;  3WNX B;  3VRO A;  1B7T Z;  2BCA A;  3PAT A;  5GQQ C;  1CFC A;  1QIW A;  1KSO A;  2I7A A;  2O60 A;  2KSP A;  1RRO A;  1J1D A;  2JWW A;  1RTP 1;  1BMO A;  4N5X A;  1WRZ A;  2LHL A;  4NDB A;  2Y5I A;  2M0R A;  4ICB A;  2JT0 A;  1SKT A;  4MRX A;  1WRK A;  4AQJ A;  1CNP A;  2EHB A;  1F4O A;  4C0L A;  4GAO A;  4I5J A;  2LHI A;  3GK4 X;  2KFH A;  2LLU A;  3BUW B;  1UP5 A;  1MXE A;  1ZUZ A;  3NSO A;  1KSM A;  1OZS A;  1DGV A;  3DD4 A;  3ZWH A;  1D1O A;  4JQ0 D;  2HF5 A;  1OE9 B;  1OZO A;  5PAL A;  3MSE B;  4OKH A;  2LVV A;  3GK1 A;  1EG3 A;  5BPJ A;  4WQ2 A;  2JT3 A;  1YUT A;  1JFK A;  1GJY A;  1UHK A;  3TZ1 A;  2JTZ A;  3AAK A;  4MVF A;  2K61 A;  4MZL A;  4M2Q A;  3VRP A;  3VRR A;  1Q80 A;  3TDI A;  5AXI A;  1WDC C;  2L4H A;  3EVR A;  1LXF C;  4XJK B;  1UHH A;  1C07 A;  2JUL A;  4PHN A;  4CFQ A;  3PLF B;  1S5G Y;  1X02 A;  1N65 A;  1AUI B;  4M2P A;  4I5N B;  4FQO A;  2KQ6 A;  4PE1 A;  5AEQ A;  1EL4 A;  3JTD C;  3WXA A;  2BEC A;  3OX6 A;  3SIA A;  1CFP A;  2CT9 A;  1R6P A;  3FWC A;  4NDD A;  3ZNI A;  3DVE A;  4HRH A;  3LK0 A;  1ZFS A;  1NCX A;  2KOT A;  3ICB A;  1IJ6 A;  1JWD A;  1QAS A;  1TNW A;  1MXL C;  4ZCV A;  4PE7 A;  3JTD B;  1QX2 A;  1KQM C;  4GUK A;  1OMR A;  1V1G A;  1UUS A;  2Y1M A;  1TOP A;  1PK0 D;  4PCW A;  1QIV A;  5B8I B;  1KFX S;  2LAN A;  3DVK A;  1OMD A;  4WRI A;  2LE9 B;  1ODB A;  4DRW A;  2PSR A;  2F3Y A;  5IBW A;  2FOT A;  1DJI A;  2L5X B;  3PN7 C;  4QJ5 B;  1CFD A;  2D8N A;  1LKJ A;  5CSJ A;  3HCM A;  2A4J A;  3CZT X;  1L2O B;  3OB1 B;  1QXP A;  1CB1 A;  1QX7 A;  1KK8 B;  2ZND A;  1BJF A;  2LMU A;  1B7T Y;  1EJ3 A;  2JPT A;  1XFV O;  2L4I A;  1MF8 B;  3CR2 A;  1K9K A;  4MEW A;  4QJ3 B;  5G08 A;  1TTX A;  1A4P A;  1QTX A;  4DS7 A;  2BL0 B;  2L0P A;  4PDZ A;  4M2O A;  2F8P A;  1TN4 A;  4AOM A;  3A4U B;  2K8M B;  5HKW A;  1K94 A;  5KU1 A;  2BE4 A;  5KSZ A;  1NX0 A;  1QJT A;  4GPL B;  1BR1 B;  4E68 A;  1LIN A;  3C1V A;  1H4B A;  1SY9 A;  2Y4Q A;  1WLM A;  3NSK A;  1QV1 A;  1BF5 A;  1SCV A;  4ORC B;  4YGC B;  2CBL A;  2BBM A;  1S6I A;  4XYN A;  2K0J A;  2NCO A;  2JTT A;  1C7W A;  2NCP A;  4NDC A;  1GGW A;  1B8L A;  3CWG A;  3GOF A;  2KNE A;  3LK1 A;  1QV0 A;  2L51 A;  1SCM C;  2KI6 C;  1CDM A;  1ZOT B;  1J1E A;  3JVT C;  2R2I A;  4P2Y B;  4L9M A;  1J7R A;  1K93 D;  5TNC A;  2E30 A;  5D69 A;  1IKU A;  1B8C A;  1SL9 A;  1BG1 A;  3VRN A;  1NP8 A;  3BQ3 A;  3VGO A;  4QJ4 B;  1AHR A;  1SR6 C;  2MAZ A;  1Y1X A;  1Y1U A;  3IF7 A;  5DKN A;  1BOD A;  2H61 C;  2RGI A;  1KWO C;  3O4Y A;  4OCI A;  2GGM A;  2K2A A;  1CDN A;  1M45 A;  1OMV A;  1JUO A;  1N0Y A;  3E3R A;  3PSR A;  1IH0 A;  3I5F C;  1PVA A;  2OPO A;  1Y6W A;  1SBJ A;  3BUO B;  1EXR A;  1G8I A;  1UHN A;  5ER5 A;  1H8B A;  2KAV A;  1KWO B;  4MRY A;  2LMV A;  2FCD A;  4MZJ A;  5ER4 X;  4DUQ A;  1OOJ A;  5JJG A;  1K96 A;  5AER A;  1XA5 A;  2KI4 C;  3D0Y A;  2IS9 A;  2K7D A;  2KYC A;  1NPQ A;  3I5F B;  1J7O A;  3DF0 B;  2LCP A;  2LNK A; 
#chains in the Genus database with same CATH topology
 2I94 A;  4FQT A;  2AUC A;  1B9A A;  1UHJ A;  2MLE C;  1NCY A;  1RJV A;  1ALW A;  2WCM A;  3OBV A;  3PM2 A;  1QVI Z;  2AMI A;  3D0Y B;  3FS7 A;  4XJK A;  3PAL A;  1U5I A;  1BU3 A;  5HL1 A;  2JC2 A;  3O78 A;  2KI4 B;  1EG4 A;  2O5G A;  4OVN F;  1FW4 A;  2ZN8 A;  1WRL A;  3NSI A;  1NUB A;  1QLS A;  3VB1 A;  4UPG A;  2G9B A;  1DT7 B;  1KQV A;  1IWQ A;  1OQP A;  3O2P A;  1IGV A;  4YGA A;  1Z4H A;  3TS5 C;  5HLO A;  2MA2 A;  4BY4 A;  1FI5 A;  1JF2 A;  3WHT B;  2JXL A;  3BUX B;  4INX A;  1U5I B;  1SNL A;  1YX7 A;  1DEL A;  1XFR A;  1UHI A;  4PHK A;  3Q8I A;  1ZAC A;  4MZK A;  1B8R A;  1SYM A;  5DKR A;  4D1E A;  2HQ8 A;  2BE6 A;  3M0W A;  2M8U A;  4P5O E;  2I2R E;  1KFU L;  2LVJ A;  2QEV A;  2QPT A;  4YI8 A;  1KK7 Z;  4N1F A;  1S6J A;  1S26 D;  1WDC B;  1YVH A;  2ZNE A;  5J3X A;  2ZRT A;  1FBV A;  3CDN A;  2ISD A;  4R1E A;  1BR4 B;  1TUJ A;  3EVV A;  2JNF A;  1KCY A;  1HT9 A;  2M29 A;  2FJY A;  1S1E A;  4JKT A;  5D3O A;  3CTN A;  3NSL A;  1JC2 A;  4MLW A;  2JXC A;  2MJW B;  4I5K A;  4OZD A;  1NIW A;  1TRF A;  2KHN A;  2KGR A;  1YRU B;  2KYF A;  2QAC A;  1K90 D;  3K1E A;  1DC1 A;  3I5H C;  3SG2 A;  2WC8 A;  3BYA A;  4YI9 A;  5JOL A;  4JWQ A;  3S0D A;  2OS8 C;  5F6T A;  2TN4 A;  2ZRS A;  4FTG A;  3SG3 A;  1GQM A;  5FI6 A;  4PHJ A;  3VRQ A;  2WC5 A;  1KQM B;  1NX1 A;  3BUM B;  4TNC A;  2PAS A;  4Q04 A;  3O4X A;  1PVB A;  2CCM A;  4GBA A;  5DKQ A;  1C3Y A;  2LM5 A;  1GGZ A;  1PSB A;  3L47 A;  2WCF A;  2LP2 A;  2CNP A;  1CMF A;  3PN7 B;  3QRX A;  4HSZ A;  4YGD B;  3S0E A;  2KQY A;  3R1P A;  3FE6 A;  1A75 B;  2WCJ A;  3AKA A;  2LVI A;  1DJW A;  1CKK A;  2NLN A;  1IQ3 A;  1DJH A;  3AAJ A;  1FI6 A;  1C3Z A;  1RK9 A;  2SCP A;  3CZ2 A;  3I5G C;  2JRF A;  3L4A A;  1S3P A;  2JQ6 A;  1SRA A;  2P70 A;  5HYD A;  1A29 A;  3OHM B;  3KHE A;  3SG4 A;  5I2L A;  4C0K A;  1RWY A;  1FPW A;  2KGB C;  2HET A;  2MHH A;  1CLM A;  3PFV A;  1NX2 A;  1YUR A;  1TNQ A;  3SJS A;  4PE4 A;  1R2U A;  5EL2 A;  2LLT A;  2ZFD A;  2COL B;  2L50 A;  1F4Q A;  3WHU B;  1S6C A;  4YGE B;  3EG5 B;  1QVI Y;  1AJ5 A;  4PHM A;  1E8A A;  1W7I B;  2M49 B;  1IRJ A;  2WCB A;  3D78 A;  4YGB B;  2MBX A;  3EK8 A;  1CDP A;  1CMG A;  3IVT A;  3BXK A;  1XK4 C;  1M31 A;  3GK2 A;  2MRD A;  2F2P A;  2PVB A;  1MR8 A;  1QAT A;  2F33 A;  2G2B A;  1MWN A;  2M97 A;  3EK4 A;  1PUL A;  3I5I C;  3O6B A;  1BLQ A;  3H4S E;  1HQV A;  5CPV A;  2EGD A;  4A4C A;  3K21 A;  1ORG A;  3FE9 A;  1L7Z A;  4MBE A;  1SCM B;  1JFJ A;  5I8N A;  4PE0 A;  1A03 A;  2CTN A;  1XFY O;  1YUS A;  2H8V A;  1Y0V H;  1KK7 Y;  1XVJ A;  1KFU S;  1SK6 D;  2K2F A;  4HRG A;  1C7V A;  1ZMZ A;  4ORA B;  1XFX O;  3LLE A;  3SG5 A;  1DGU A;  4N1G A;  2QDI A;  1QWV A;  3TDZ A;  2H61 A;  2LMT A;  2Y1N A;  1DMO A;  4OR9 B;  1SR6 B;  1TNX A;  1PSR A;  1N2D A;  2E6W A;  2V53 A;  3KPX A;  5I2Q A;  1T14 A;  2EC6 C;  1DVI A;  3EK7 A;  1ALV A;  4CPV A;  2BNX A;  1B47 A;  5KTY A;  1TIZ A;  3DF0 A;  2GGZ A;  1XO5 A;  1F70 A;  1P28 A;  3PM8 A;  1LA0 A;  1OOG A;  4WQ3 A;  4CFR A;  2WOS A;  1K8U A;  4GFT A;  4GGF C;  1MHO A;  1CM4 A;  5HLV A;  1YVL A;  3BFB A;  2KAX A;  1UUR A;  1XFW O;  2BCB A;  2F3Z A;  2L2C A;  1Y1A A;  4MN0 A;  2MLF C;  1AP4 A;  1NCZ A;  5K89 A;  2CXJ A;  2FCE A;  2Q91 A;  1PAL A;  3LL8 B;  2AAO A;  5FYX A;  3CR5 X;  3DVM A;  4YRU A;  2H2K A;  1MQ1 A;  4A4B A;  2HQW A;  2LUX A;  1JSA A;  1IJ5 A;  1QX5 B;  1YTZ C;  2PAL A;  3CZ1 A;  3EVU A;  4ORB B;  2JT8 A;  1YR5 A;  1PRW A;  1XFU O;  3IQO A;  2M7L A;  3CR4 X;  2JOJ A;  2KDH A;  1SW8 A;  1NX3 A;  2WOR A;  1DEK A;  3SS4 A;  1IQ5 A;  1DF0 A;  1M63 B;  2DOQ A;  2K7B A;  1TCO B;  2KFG A;  4YBH B;  1BOC A;  1CLB A;  1LA3 A;  1DTL A;  3TS5 B;  1B4C A;  4OV2 A;  4PAL A;  1DF0 B;  2PRU A;  1YX8 A;  3BUN B;  1DJX A;  4F0Z B;  3FWB A;  2K7O A;  3DVJ A;  1UWO A;  1SL7 A;  2JZI A;  4CLN A;  2JNX A;  5CSI A;  1CDL A;  2YGU A;  1DQE A;  1AVS A;  3S0A A;  1OSA A;  1NSH A;  2M1K B;  2F2O A;  1G4Y R;  4GGN A;  1F55 A;  1DJY A;  5AAN A;  2BKI B;  3NHI A;  1XYD A;  3NXA A;  4BY5 A;  5I2O A;  1K2H A;  2P71 A;  4C0J A;  2WCH A;  3AKB A;  2M9G A;  2PYQ A;  3SG7 A;  4ETO A;  2HPS A;  1V1F A;  1A75 A;  2KI6 D;  2LLS A;  1K9P A;  1VRK A;  3B87 A;  1SPY A;  2LVK A;  3I5H B;  5HKY A;  3NGV A;  2SAS A;  1S36 A;  2OS8 B;  2K60 A;  3KF9 A;  4I5L B;  3B7A A;  5CSN A;  1L2O C;  2NXQ A;  2GV5 A;  3IQQ A;  4CID A;  1KK8 C;  2PMY A;  2WCK A;  1TCF A;  1XFZ O;  2KBI A;  2LC5 A;  2M3W A;  2M7N A;  1LS8 A;  3BOW A;  3FIA A;  3OB2 B;  2I18 A;  4HRE E;  1CTR A;  4U8D A;  1A2X A;  4JPZ B;  1REC A;  1GM0 A;  3CS1 A;  2PQL A;  1CM1 A;  2FJU B;  4GNK B;  3CGA A;  4DIR A;  2BL0 C;  1CLL A;  1FF1 A;  2BKH B;  5D7F A;  1AJ4 A;  3F45 A;  3SG6 A;  3TUY C;  3BOW B;  4USL A;  3QME A;  4IL1 A;  3HX4 A;  1NYA A;  1YUU A;  2LAP A;  4DCK A;  3NHT A;  4AQI A;  1B1G A;  1TWO A;  1K9U A;  3KEV A;  3D77 A;  2BCX A;  3I5G B;  1AK8 A;  2BBN A;  2M1U A;  3BJH A;  1JBA A;  1J7Q A;  2QEB A;  1W9Z A;  3EKH A;  3TUY B;  1EH2 A;  1JF0 A;  3RLZ A;  1F71 A;  1G33 A;  1DJZ A;  3UO9 A;  2ZN9 A;  2LV7 A;  1W7J B;  2L2E A;  4MSP A;  1OW4 A;  2KBM A;  3EKJ A;  1LVC D;  2L5Y A;  5FI7 A;  3SIB A;  3D10 A;  1CFF A;  2KPH A;  1S5G Z;  1XK4 A;  3PJI A;  1F54 A;  4NQG A;  1BT6 A;  2L98 A;  2LUC A;  2ZKM X;  2K7C A;  3TDU A;  5HKZ A;  1QLK A;  3N7H A;  4ZCU A;  2ERB A;  2LP3 A;  3CLN A;  2KAY A;  2Q4U A;  3KO0 A;  3RM1 A;  1RFJ A;  2WCE A;  5FI2 A;  2B1U A;  1J7P A;  1TNP A;  1QS7 A;  1WY9 A;  1NWD A;  3I5I B;  4NDB A;  2P6B B;  1M39 A;  1SMG A;  1K95 A;  1SL8 A;  3OX5 A;  3FE8 A;  2OTG C;  1MUX A;  2NZ0 A;  1KFX L;  1YRT B;  2JU0 A;  2WND A;  1F8H A;  2VRG A;  2KFF A;  3A8R A;  5AFP A;  3DZT A;  1DJG A;  1WLZ A;  3CZ0 A;  4KYN A;  3D75 A;  5CSF A;  3DY9 A;  1J55 A;  2OTG B;  3LCP C;  1M46 A;  3DXL A;  4GGF A;  2EC6 B;  1IG5 A;  3WNX B;  3VRO A;  1B7T Z;  2BCA A;  3PAT A;  5GQQ C;  1CFC A;  1QIW A;  1KSO A;  2I7A A;  2O60 A;  2KSP A;  1RRO A;  1J1D A;  2JWW A;  1RTP 1;  4JD9 A;  1BMO A;  4N5X A;  1WRZ A;  2LHL A;  3D73 A;  2Y5I A;  2M0R A;  4ICB A;  2JT0 A;  1SKT A;  4MRX A;  1WRK A;  4AQJ A;  1CNP A;  2EHB A;  1F4O A;  4C0L A;  4GAO A;  4I5J A;  2LHI A;  3GK4 X;  2KFH A;  2LLU A;  3BUW B;  1UP5 A;  1IIO A;  1MXE A;  1ZUZ A;  3NSO A;  3R1V A;  1KSM A;  1OZS A;  1DGV A;  3DD4 A;  3ZWH A;  1D1O A;  4JQ0 D;  2HF5 A;  1OE9 B;  1OZO A;  5PAL A;  3MSE B;  4OKH A;  2LVV A;  1SSE B;  1EG3 A;  3DYE A;  3GK1 A;  4WQ2 A;  1Z2C B;  3BFA A;  5BPJ A;  2JT3 A;  1YUT A;  1JFK A;  1GJY A;  1UHK A;  2WCL A;  3TZ1 A;  2JTZ A;  3AAK A;  4MVF A;  2K61 A;  4MZL A;  4M2Q A;  3VRP A;  3VRR A;  3S0F A;  1Q80 A;  3TDI A;  5AXI A;  1WDC C;  2L4H A;  3EVR A;  1LXF C;  1OOI X;  1OOF A;  4XJK B;  1UHH A;  2KLD A;  2JUL A;  1C07 A;  4PHN A;  2KLE A;  4CFQ A;  3PLF B;  1S5G Y;  1X02 A;  1N65 A;  1AUI B;  3JVT B;  4M2P A;  4I5N B;  3OP0 A;  4FQO A;  2KQ6 A;  4PE1 A;  5AEQ A;  1EL4 A;  3JTD C;  3WXA A;  2BEC A;  3OX6 A;  3SIA A;  5I94 A;  1CFP A;  2CT9 A;  1R6P A;  3FWC A;  4NDD A;  3ZNI A;  3DVE A;  4HRH A;  3LK0 A;  1ZFS A;  1NCX A;  2KOT A;  3ICB A;  1IJ6 A;  3B86 A;  1QAS A;  1JWD A;  1TNW A;  1MXL C;  4ZCV A;  4PE7 A;  3JTD B;  1QX2 A;  3D74 A;  3S0G A;  1KQM C;  4GUK A;  1OMR A;  1V1G A;  1UUS A;  2Y1M A;  1TOP A;  1PK0 D;  4PCW A;  1QIV A;  5B8I B;  1KFX S;  2LAN A;  3DVK A;  1OMD A;  4WRI A;  2LE9 B;  1ODB A;  3SS3 A;  4DRW A;  2PSR A;  2F3Y A;  5IBW A;  2FOT A;  1DJI A;  2L5X B;  3PN7 C;  4QJ5 B;  1CFD A;  2D8N A;  1LKJ A;  5CSJ A;  3UNW A;  3HCM A;  2A4J A;  3CZT X;  3SS5 A;  1L2O B;  3OB1 B;  1QXP A;  1CB1 A;  1QX7 A;  1KK8 B;  2ZND A;  1BJF A;  3RZS A;  2LMU A;  3OGN A;  1B7T Y;  1EJ3 A;  2JPT A;  1XFV O;  2L4I A;  1MF8 B;  2GTE A;  3CR2 A;  3BFH A;  1K9K A;  4MEW A;  4QJ3 B;  5G08 A;  1TTX A;  1A4P A;  1QTX A;  4DS7 A;  2BL0 B;  2L0P A;  4INW A;  4PDZ A;  4M2O A;  2F8P A;  3B88 A;  1TN4 A;  2WC6 A;  3A4U B;  4AOM A;  2K8M B;  5HKW A;  3CYZ A;  1K94 A;  5KU1 A;  2BE4 A;  3R72 A;  5KSZ A;  1NX0 A;  1QJT A;  4GPL B;  1BR1 B;  4E68 A;  1LIN A;  3C1V A;  1H4B A;  1SY9 A;  2Y4Q A;  1WLM A;  3NSK A;  1QV1 A;  3B6X A;  1BF5 A;  1SCV A;  4ORC B;  4YGC B;  2CBL A;  2BBM A;  1S6I A;  4XYN A;  2K0J A;  2NCO A;  3S0B A;  2JTT A;  1C7W A;  2NCP A;  4NDC A;  1GGW A;  1B8L A;  3CWG A;  3GOF A;  4PT1 A;  2KNE A;  3LK1 A;  1QV0 A;  2L51 A;  1SCM C;  2KI6 C;  3V2L A;  1CDM A;  1ZOT B;  1J1E A;  1OOH A;  3JVT C;  2R2I A;  4P2Y B;  4L9M A;  1J7R A;  1K93 D;  5TNC A;  2E30 A;  5D69 A;  1IKU A;  1TUZ A;  4F7F A;  1B8C A;  1SL9 A;  1BG1 A;  3VRN A;  1NP8 A;  3BQ3 A;  3VGO A;  4QJ4 B;  1AHR A;  1SR6 C;  2MAZ A;  4IJ7 A;  1Y1X A;  1Y1U A;  3CAB A;  3IF7 A;  5DKN A;  1BOD A;  2H61 C;  2RGI A;  1KWO C;  3O4Y A;  4OCI A;  2GGM A;  2K2A A;  1CDN A;  1M45 A;  1OMV A;  1JUO A;  3L4L A;  2QEH A;  5DIC A;  1N0Y A;  3E3R A;  3PSR A;  1IH0 A;  3I5F C;  1PVA A;  2OPO A;  1Y6W A;  1SBJ A;  3BUO B;  3R1O A;  1EXR A;  3D76 A;  1G8I A;  1UHN A;  5ER5 A;  1H8B A;  2KAV A;  1KWO B;  4MRY A;  2LMV A;  2FCD A;  4MZJ A;  5ER4 X;  4DUQ A;  1OOJ A;  5JJG A;  1K96 A;  5AER A;  1XA5 A;  2KI4 C;  2JPO A;  2IS9 A;  2K7D A;  3D0Y A;  2KYC A;  2QEO A;  1NPQ A;  3I5F B;  1J7O A;  2BAP A;  3DF0 B;  2LCP A;  2LNK A; 
#chains in the Genus database with same CATH homology
 2I94 A;  2AUC A;  1B9A A;  1UHJ A;  2MLE C;  1NCY A;  1RJV A;  1ALW A;  1QVI Z;  2AMI A;  3D0Y B;  3FS7 A;  4XJK A;  3PAL A;  1U5I A;  1BU3 A;  2JC2 A;  3O78 A;  2KI4 B;  1EG4 A;  2O5G A;  4OVN F;  1FW4 A;  2ZN8 A;  1WRL A;  3NSI A;  1NUB A;  1QLS A;  4UPG A;  1DT7 B;  2G9B A;  1KQV A;  1IWQ A;  1OQP A;  3O2P A;  1IGV A;  4YGA A;  3TS5 C;  5HLO A;  2MA2 A;  4BY4 A;  1FI5 A;  1JF2 A;  3WHT B;  2JXL A;  3BUX B;  1U5I B;  1SNL A;  1YX7 A;  5DKR A;  1UHI A;  4PHK A;  1ZAC A;  4MZK A;  1B8R A;  1SYM A;  4D1E A;  2HQ8 A;  2BE6 A;  3M0W A;  2M8U A;  4P5O E;  2I2R E;  1KFU L;  2LVJ A;  2QPT A;  4YI8 A;  1KK7 Z;  4N1F A;  1S6J A;  1S26 D;  1WDC B;  1YVH A;  2ZNE A;  5J3X A;  2ZRT A;  1FBV A;  2ISD A;  4R1E A;  1BR4 B;  3EVV A;  2JNF A;  1KCY A;  1HT9 A;  2M29 A;  1S1E A;  3CTN A;  3NSL A;  1JC2 A;  4MLW A;  2JXC A;  2MJW B;  4I5K A;  1NIW A;  1TRF A;  2KHN A;  2KGR A;  1YRU B;  2KYF A;  2QAC A;  1K90 D;  3I5H C;  3SG2 A;  2WC8 A;  3BYA A;  4YI9 A;  5JOL A;  4JWQ A;  2OS8 C;  5F6T A;  2TN4 A;  2ZRS A;  4FTG A;  3SG3 A;  1GQM A;  4PHJ A;  3VRQ A;  1KQM B;  1NX1 A;  3BUM B;  4TNC A;  2PAS A;  4Q04 A;  1PVB A;  2CCM A;  4GBA A;  5DKQ A;  2LM5 A;  1GGZ A;  1PSB A;  2WCF A;  2LP2 A;  2CNP A;  1CMF A;  3PN7 B;  3QRX A;  4HSZ A;  4YGD B;  2KQY A;  1A75 B;  3AKA A;  2LVI A;  1DJW A;  1CKK A;  2NLN A;  1IQ3 A;  1DJH A;  3AAJ A;  1FI6 A;  1RK9 A;  2SCP A;  3I5G C;  2JRF A;  1S3P A;  2JQ6 A;  1SRA A;  5HYD A;  1A29 A;  3OHM B;  3KHE A;  3SG4 A;  5I2L A;  4C0K A;  1RWY A;  1FPW A;  2KGB C;  2HET A;  2MHH A;  1CLM A;  3PFV A;  1NX2 A;  1YUR A;  1TNQ A;  3SJS A;  4PE4 A;  1R2U A;  2LLT A;  2ZFD A;  2COL B;  2L50 A;  1F4Q A;  3WHU B;  1S6C A;  4YGE B;  1QVI Y;  1AJ5 A;  4PHM A;  1E8A A;  1W7I B;  2M49 B;  1IRJ A;  2WCB A;  4YGB B;  2MBX A;  3EK8 A;  1CDP A;  1CMG A;  3BXK A;  1XK4 C;  1M31 A;  3GK2 A;  2MRD A;  2F2P A;  2PVB A;  1MR8 A;  1QAT A;  2F33 A;  2G2B A;  1MWN A;  2M97 A;  3EK4 A;  1PUL A;  3I5I C;  3O6B A;  1BLQ A;  3H4S E;  1HQV A;  5CPV A;  2EGD A;  4A4C A;  3K21 A;  4MBE A;  1L7Z A;  1JFJ A;  1SCM B;  5I8N A;  4PE0 A;  1A03 A;  2CTN A;  1XFY O;  1YUS A;  3JVT B;  1Y0V H;  1KK7 Y;  1XVJ A;  1KFU S;  1SK6 D;  2K2F A;  4HRG A;  1C7V A;  1ZMZ A;  4ORA B;  1XFX O;  3LLE A;  3SG5 A;  1DGU A;  4N1G A;  3TDZ A;  2H61 A;  2LMT A;  2Y1N A;  1DMO A;  4OR9 B;  1SR6 B;  1TNX A;  1PSR A;  1N2D A;  2E6W A;  2V53 A;  3KPX A;  5I2Q A;  2EC6 C;  1DVI A;  3EK7 A;  1ALV A;  4CPV A;  1B47 A;  5KTY A;  1TIZ A;  3DF0 A;  2GGZ A;  1XO5 A;  1F70 A;  3PM8 A;  1LA0 A;  4WQ3 A;  4CFR A;  2WOS A;  1K8U A;  4GFT A;  4GGF C;  1MHO A;  1CM4 A;  5HLV A;  1YVL A;  2KAX A;  1UUR A;  2BCB A;  1XFW O;  2F3Z A;  1Y1A A;  4MN0 A;  2MLF C;  1AP4 A;  1NCZ A;  5K89 A;  2CXJ A;  2FCE A;  2Q91 A;  1PAL A;  3LL8 B;  2AAO A;  5FYX A;  3CR5 X;  3DVM A;  4YRU A;  2H2K A;  1MQ1 A;  4A4B A;  2HQW A;  2LUX A;  1JSA A;  1IJ5 A;  1QX5 B;  1YTZ C;  2PAL A;  3EVU A;  4ORB B;  2JT8 A;  1YR5 A;  1PRW A;  1XFU O;  3IQO A;  2M7L A;  3CR4 X;  2JOJ A;  2KDH A;  1SW8 A;  1NX3 A;  2WOR A;  1IQ5 A;  1DF0 A;  1M63 B;  2DOQ A;  2K7B A;  1TCO B;  2KFG A;  4YBH B;  1BOC A;  1CLB A;  1LA3 A;  1DTL A;  3TS5 B;  1B4C A;  4OV2 A;  4PAL A;  1DF0 B;  2PRU A;  1YX8 A;  3BUN B;  1DJX A;  4F0Z B;  3FWB A;  2K7O A;  3DVJ A;  1UWO A;  1SL7 A;  2JZI A;  4CLN A;  2JNX A;  5CSI A;  1CDL A;  1AVS A;  1OSA A;  1NSH A;  2M1K B;  2F2O A;  1G4Y R;  4GGN A;  1F55 A;  1DJY A;  5AAN A;  2BKI B;  1XYD A;  3NXA A;  4BY5 A;  5I2O A;  1K2H A;  4C0J A;  3AKB A;  2M9G A;  3SG7 A;  4ETO A;  2HPS A;  1V1F A;  1A75 A;  2KI6 D;  2LLS A;  1K9P A;  1VRK A;  5HKY A;  1SPY A;  2LVK A;  3I5H B;  2SAS A;  1S36 A;  2OS8 B;  3KF9 A;  4I5L B;  5CSN A;  1L2O C;  2NXQ A;  2GV5 A;  3IQQ A;  4CID A;  1KK8 C;  2PMY A;  1TCF A;  1XFZ O;  2KBI A;  2LC5 A;  2M3W A;  2M7N A;  3BOW A;  3FIA A;  3OB2 B;  3OP0 A;  2I18 A;  4HRE E;  1CTR A;  4U8D A;  1A2X A;  4JPZ B;  1REC A;  3CS1 A;  1CM1 A;  2FJU B;  4GNK B;  3CGA A;  4DIR A;  2BL0 C;  1CLL A;  1FF1 A;  2BKH B;  5D7F A;  1AJ4 A;  3F45 A;  3SG6 A;  3TUY C;  3BOW B;  4USL A;  4IL1 A;  3HX4 A;  1NYA A;  1YUU A;  2LAP A;  4DCK A;  4AQI A;  1B1G A;  1K9U A;  3KEV A;  1AK8 A;  2BCX A;  3I5G B;  2BBN A;  2M1U A;  1JBA A;  1J7Q A;  3TUY B;  3EKH A;  1EH2 A;  1JF0 A;  3RLZ A;  1F71 A;  1G33 A;  1DJZ A;  2ZN9 A;  2LV7 A;  1W7J B;  2L2E A;  4MSP A;  3EKJ A;  2KBM A;  1LVC D;  3SIB A;  3D10 A;  1CFF A;  1S5G Z;  1XK4 A;  1F54 A;  4NQG A;  1BT6 A;  2L98 A;  2LUC A;  2ZKM X;  2K7C A;  3TDU A;  5HKZ A;  1QLK A;  4ZCU A;  2LP3 A;  3CLN A;  2KAY A;  2Q4U A;  3KO0 A;  3RM1 A;  1RFJ A;  2WCE A;  2B1U A;  1J7P A;  1TNP A;  1QS7 A;  1WY9 A;  1NWD A;  3I5I B;  2P6B B;  1M39 A;  1SMG A;  1K95 A;  1SL8 A;  3OX5 A;  2OTG C;  1MUX A;  2NZ0 A;  1KFX L;  1YRT B;  2JU0 A;  2WND A;  1F8H A;  2VRG A;  2KFF A;  3A8R A;  5AFP A;  1DJG A;  1WLZ A;  5CSF A;  1J55 A;  2OTG B;  3LCP C;  1M46 A;  4GGF A;  2EC6 B;  1IG5 A;  3WNX B;  3VRO A;  1B7T Z;  2BCA A;  3PAT A;  5GQQ C;  1CFC A;  1QIW A;  1KSO A;  2I7A A;  2O60 A;  2KSP A;  1RRO A;  1J1D A;  2JWW A;  1RTP 1;  1BMO A;  4N5X A;  1WRZ A;  2LHL A;  4NDB A;  2Y5I A;  2M0R A;  4ICB A;  2JT0 A;  1SKT A;  4MRX A;  1WRK A;  4AQJ A;  1CNP A;  2EHB A;  1F4O A;  4C0L A;  4GAO A;  4I5J A;  2LHI A;  3GK4 X;  2KFH A;  2LLU A;  3BUW B;  1UP5 A;  1MXE A;  1ZUZ A;  3NSO A;  1KSM A;  1OZS A;  1DGV A;  3DD4 A;  3ZWH A;  1D1O A;  4JQ0 D;  2HF5 A;  1OE9 B;  1OZO A;  5PAL A;  3MSE B;  4OKH A;  2LVV A;  3GK1 A;  1EG3 A;  5BPJ A;  4WQ2 A;  2JT3 A;  1YUT A;  1JFK A;  1GJY A;  1UHK A;  3TZ1 A;  2JTZ A;  3AAK A;  4MVF A;  2K61 A;  4MZL A;  4M2Q A;  3VRP A;  3VRR A;  1Q80 A;  3TDI A;  5AXI A;  1WDC C;  2L4H A;  3EVR A;  1LXF C;  4XJK B;  1UHH A;  1C07 A;  2JUL A;  4PHN A;  4CFQ A;  3PLF B;  1S5G Y;  1X02 A;  1N65 A;  1AUI B;  4M2P A;  4I5N B;  4FQO A;  2KQ6 A;  4PE1 A;  5AEQ A;  1EL4 A;  3JTD C;  3WXA A;  2BEC A;  3OX6 A;  3SIA A;  1CFP A;  2CT9 A;  1R6P A;  3FWC A;  4NDD A;  3ZNI A;  3DVE A;  4HRH A;  3LK0 A;  1ZFS A;  1NCX A;  2KOT A;  3ICB A;  1IJ6 A;  1JWD A;  1QAS A;  1TNW A;  1MXL C;  4ZCV A;  4PE7 A;  3JTD B;  1QX2 A;  1KQM C;  4GUK A;  1OMR A;  1V1G A;  1UUS A;  2Y1M A;  1TOP A;  1PK0 D;  4PCW A;  1QIV A;  5B8I B;  1KFX S;  2LAN A;  3DVK A;  1OMD A;  4WRI A;  2LE9 B;  1ODB A;  4DRW A;  2PSR A;  2F3Y A;  5IBW A;  2FOT A;  1DJI A;  2L5X B;  3PN7 C;  4QJ5 B;  1CFD A;  2D8N A;  1LKJ A;  5CSJ A;  3HCM A;  2A4J A;  3CZT X;  1L2O B;  3OB1 B;  1QXP A;  1CB1 A;  1QX7 A;  1KK8 B;  2ZND A;  1BJF A;  2LMU A;  1B7T Y;  1EJ3 A;  2JPT A;  1XFV O;  2L4I A;  1MF8 B;  3CR2 A;  1K9K A;  4MEW A;  4QJ3 B;  5G08 A;  1TTX A;  1A4P A;  1QTX A;  4DS7 A;  2BL0 B;  2L0P A;  4PDZ A;  4M2O A;  2F8P A;  1TN4 A;  4AOM A;  3A4U B;  2K8M B;  5HKW A;  1K94 A;  5KU1 A;  2BE4 A;  5KSZ A;  1NX0 A;  1QJT A;  4GPL B;  1BR1 B;  4E68 A;  1LIN A;  3C1V A;  1H4B A;  1SY9 A;  2Y4Q A;  1WLM A;  3NSK A;  1QV1 A;  1BF5 A;  1SCV A;  4ORC B;  4YGC B;  2CBL A;  2BBM A;  1S6I A;  4XYN A;  2K0J A;  2NCO A;  2JTT A;  1C7W A;  2NCP A;  4NDC A;  1GGW A;  1B8L A;  3CWG A;  3GOF A;  2KNE A;  3LK1 A;  1QV0 A;  2L51 A;  1SCM C;  2KI6 C;  1CDM A;  1ZOT B;  1J1E A;  3JVT C;  2R2I A;  4P2Y B;  4L9M A;  1J7R A;  1K93 D;  5TNC A;  2E30 A;  5D69 A;  1IKU A;  1B8C A;  1SL9 A;  1BG1 A;  3VRN A;  1NP8 A;  3BQ3 A;  3VGO A;  4QJ4 B;  1AHR A;  1SR6 C;  2MAZ A;  1Y1X A;  1Y1U A;  3IF7 A;  5DKN A;  1BOD A;  2H61 C;  2RGI A;  1KWO C;  3O4Y A;  4OCI A;  2GGM A;  2K2A A;  1CDN A;  1M45 A;  1OMV A;  1JUO A;  1N0Y A;  3E3R A;  3PSR A;  1IH0 A;  3I5F C;  1PVA A;  2OPO A;  1Y6W A;  1SBJ A;  3BUO B;  1EXR A;  1G8I A;  1UHN A;  5ER5 A;  1H8B A;  2KAV A;  1KWO B;  4MRY A;  2LMV A;  2FCD A;  4MZJ A;  5ER4 X;  4DUQ A;  1OOJ A;  5JJG A;  1K96 A;  5AER A;  1XA5 A;  2KI4 C;  3D0Y A;  2IS9 A;  2K7D A;  2KYC A;  1NPQ A;  3I5F B;  1J7O A;  3DF0 B;  2LCP A;  2LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...