1F70A

Refined solution structure of calmodulin n-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CALMODULIN
publication title Study of conformational rearrangement and refinement of structural homology models by the use of heteronuclear dipolar couplings.
pubmed doi rcsb
source organism Xenopus laevis
total genus 18
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f70A00
1IRJA 1QATA 2BE4A 3VROA 1UURA 1RTP1 1XYDA 1UP5A 5DKRA 1RROA 1OSAA 5KU1A 1S3PA 4AQJA 1CLMA 1PSRA 1WLMA 2M9GA 3EKJA 2AMIA 5HKZA 1A29A 2K7BA 3EVRA 2WCFA 3AAJA 4PDZA 1YRUB 1SY9A 1AHRA 2JXCA 3CR4X 1JF2A 4CIDA 4PALA 2ZKMX 4QJ3B 1BT6A 4GBAA 1Y1UA 3RM1A 2WOSA 1B9AA 2F2OA 3H4SE 1M63B 1L7ZA 3OB2B 3LL8B 1TOPA 2CNPA 2ZN8A 5I8NA 5IBWA 4YRUA 1LA3A 2JULA 3QRXA 3F45A 1DJIA 1NUBA 3EKHA 2BCAA 1YX7A 3I5GC 2Y1MA 1M39A 4ETOA 1K90D 1B8CA 3LK1A 3SG2A 2JXLA 3NSLA 1M46A 1JFKA 1X02A 2JT3A 2COLB 2M7NA 3KPXA 1MXEA 1ZACA 1E8AA 1IQ5A 3IF7A 2KOTA 3CR5X 1LVCD 1A03A 1NP8A 4CPVA 5HKYA 2BBMA 3LCPC 1QVIZ 2B1UA 2JWWA 3I5FC 2LC5A 4NDBA 4HRHA 2O5GA 1EG3A 4ORAB 5K89A 3WXAA 2MLFC 3SG6A 3M0WA 3ICBA 2CTNA 4GUKA 4QJ4B 2L98A 5D7FA 1AK8A 4I5LB 2Y1NA 1J55A 3TDZA 2F8PA 2KBIA 3TDIA 2KAXA 4OR9B 2H61C 1EJ3A 1XK4A 1DJXA 2WCEA 5I2QA 3DD4A 1IJ5A 4I5JA 4MLWA 1K93D 3MSEB 1CLBA 1MQ1A 4XJKB 5PALA 2M1KB 2OS8B 4N1GA 2JQ6A 1SL9A 2GGMA 1NX1A 2JTZA 2K0JA 1F4QA 2L50A 3C1VA 1SL7A 2KAYA 3JTDC 3VRPA 4C0KA 1AP4A 3NSKA 2LAPA 1J7RA 2KQYA 2FJUB 2LANA 1YUSA 1FPWA 2I18A 1KFUS 3CS1A 2HETA 2KFHA 1KWOB 4GPLB 1RK9A 3HX4A 1CFFA 3VRNA 2LVKA 3PN7B 1C7VA 1AJ4A 2LMTA 2MAZA 2GGZA 2KHNA 1QX5B 2M8UA 1G8IA 1UHJA 1U5IA 2WCBA 2H2KA 4DUQA 1V1FA 1SNLA 1HQVA 1BMOA 2A4JA 1SCMB 4YGDB 2KBMA 3DVMA 2JNFA 3CGAA 2BECA 2MLEC 4ORBB 1B7TY 1R2UA 1EG4A 1KQMC 1H8BA 2LNKA 2LMUA 4YGCB 1CFDA 1DF0A 1QLSA 1A75A 2G9BA 2E6WA 1KK7Y 1KK8B 1SCVA 1GGZA 1MHOA 3IQQA 2L2EA 5CSJA 2EHBA 2CBLA 2KAVA 3OX6A 4UPGA 3NSOA 1NIWA 1OZSA 4DCKA 3CTNA 1SYMA 1NWDA 4GGFC 2LP3A 2RGIA 2M49B 2PALA 1QS7A 1IG5A 1XFZO 2Q4UA 3RLZA 1IQ3A 4MN0A 2EC6B 5GQQC 2JU0A 5AXIA 1B47A 1W7JB 2M3WA 1B4CA 2TN4A 1UHHA 4JWQA 1UWOA 3NSIA 4WRIA 3A8RA 1DJWA 1TN4A 1YX8A 4MRXA 4C0LA 4BY5A 1B1GA 1QV0A 1OQPA 3SG5A 4CLNA 1PSBA 1BR4B 1UHIA 2Q91A 1CMGA 1SK6D 1DJGA 1OZOA 3BUNB 4ZCVA 1J7QA 1S6JA 2D8NA 2K7CA 4M2OA 4ORCB 4PE1A 2BKIB 1F70A 1XFXO 2KYFA 3FWCA 2JZIA 1ODBA 2ZNEA 1QTXA 2IS9A 1FI5A 1CFCA 1B8LA 3BYAA 1G4YR 1NPQA 1CKKA 4R1EA 1AVSA 1M45A 2KGBC 3E3RA 4P2YB 1YUTA 1FI6A 3I5HB 4MZJA 2MBXA 2K2FA 1MWNA 1QIVA 1RFJA 1FF1A 5ER4X 1NX0A 2JTTA 1S36A 1XO5A 3ZWHA 2V53A 4U8DA 3FS7A 1SPYA 3KO0A 2K2AA 1KQVA 1CM1A 2MHHA 1RWYA 5DKQA 1JF0A 1SCMC 4YI8A 2DOQA 2ZN9A 2BKHB 1JWDA 4YGAA 1TNQA 1N0YA 1U5IB 3BUMB 3D10A 4JQ0D 5AEQA 3FIAA 3GK1A 3TZ1A 4PE4A 4HREE 1QIWA 2GV5A 1MF8B 2HPSA 2JRFA 1GQMA 2F2PA 3OX5A 2QPTA 1GJYA 1D1OA 2PRUA 1F55A 3EK8A 2PVBA 1OOJA 4OCIA 3KF9A 3EVVA 3BUWB 2L0PA 2AUCA 1B7TZ 1KFXL 2KI4B 1QX7A 5FYXA 1KK8C 1XFWO 2F3YA 1SW8A 2CCMA 1DF0B 1KK7Z 4D1EA 1A75B 1DGUA 1TNPA 4GFTA 1BJFA 3DVEA 3TS5B 1YTZC 1H4BA 3I5IB 4L9MA 2KQ6A 4YGBB 1BF5A 2EC6C 1WRZA 1NX2A 1OMDA 3VGOA 3VRQA 4MZLA 1S1EA 1YVLA 1DJHA 4NDCA 4DRWA 2OTGB 1TTXA 2BL0B 5AANA 2JC2A 5CPVA 3PM8A 3EK7A 1W7IB 1DTLA 1N65A 5ER5A 1CDMA 1RJVA 2PSRA 4MZKA 1JSAA 2I94A 3TUYB 2G2BA 2M0RA 4MBEA 1K96A 1RECA 4A4CA 3OP0A 1JBAA 1YVHA 1UHNA 1SR6B 1IGVA 1XFYO 3A4UB 1IH0A 1SRAA 2HQ8A 2LP2A 3LLEA 1SL8A 1HT9A 1Y6WA 4FQOA 1ALVA 1DT7B 1DJZA 2KYCA 2KFFA 2LUCA 4MEWA 1R6PA 3I5HC 1BG1A 5HKWA 1Y1XA 1F4OA 2E30A 2JPTA 4HRGA 1CNPA 3D0YA 4ZCUA 1XVJA 2ZRSA 1JFJA 4DIRA 4F0ZB 1S5GY 2LLSA 3GOFA 4C0JA 4GAOA 1A2XA 1DGVA 3NXAA 4USLA 5J3XA 2BCBA 3GK2A 1PVBA 1KSMA 2ZFDA 1OMVA 5HLVA 4AQIA 3BXKA 3I5GB 3BOWA 1BLQA 2MJWB 2M29A 3CZTX 4PHMA 1M31A 4NDDA 4I5NB 4Q04A 2CXJA 1FW4A 1JC2A 2K7DA 3OHMB 1DVIA 3JVTB 4GGFA 5D69A 1Q80A 1BODA 3I5FB 2M1UA 1LKJA 3DF0A 5HYDA 2LHLA 1ALWA 2LVVA 2JT8A 2SCPA 3CLNA 2LV7A 3DVJA 1XFUO 1QLKA 1K94A 2L5XB 2NZ0A 2LHIA 2OS8C 2LCPA 3I5IC 1FBVA 2M7LA 5BPJA 1CTRA 1J1EA 3PFVA 3SIAA 1GGWA 4ICBA 4OVNF 2FCEA 1LA0A 1TRFA 1SMGA 1NCYA 3FWBA 2NCOA 3KEVA 1A4PA 2K8MB 3OB1B 2KNEA 1NSHA 4BY4A 1TCFA 5CSNA 4XYNA 3SIBA 1CDPA 2KGRA 1TCOB 1KFUL 1IKUA 1XA5A 2JT0A 4JPZB 1KWOC 1EXRA 4FTGA 2LE9B 2M97A 4E68A 1S26D 3TUYC 1CMFA 2KI6C 5AFPA 2KI6D 3PN7C 2F3ZA 1L2OB 3AKAA 1UUSA 3WNXB 1SR6C 4GGNA 4YBHB 4MVFA 2F33A 2ISDA 1UHKA 2L4IA 2ZNDA 3BUXB 1DMOA 4N5XA 4YGEB 5JOLA 2FCDA 3VRRA 3SJSA 1PALA 1K8UA 1QV1A 2VRGA 1C07A 1WY9A 4WQ2A 2L4HA 1NX3A 4I5KA 1N2DA 4YI9A 1XFVO 1B8RA 1ZFSA 4CFQA 1IWQA 1S5GZ 3D0YB 1CLLA 1K9KA 3EK4A 1MR8A 1YURA 1TIZA 3O6BA 2WNDA 4WQ3A 1KCYA 2BBNA 4IL1A 1PVAA 5KSZA 2KSPA 4PHNA 2H61A 2WORA 3LK0A 3SG3A 1KQMB 2I7AA 1Y0VH 3CWGA 4MSPA 2Y4QA 1ZOTB 4HSZA 2BE6A 5F6TA 3BOWB 1AJ5A 1LXFC 1CFPA 3JVTC 1SBJA 4PHKA 1CB1A 4NQGA 5TNCA 2HF5A 4PE0A 1J7OA 1BR1B 1WLZA 2JOJA 2O60A 4OKHA 3KHEA 1PRWA 3O4YA 2Y5IA 2LVJA 1K9PA 1XK4C 3PATA 2K61A 1G33A 3EVUA 1WDCB 1Y1AA 3DF0B 3BUOB 4QJ5B 1AUIB 1TNXA 2P6BB 4AOMA 3CR2A 1CDNA 2EGDA 2ZRTA 1QJTA 2FOTA 5DKNA 2LMVA 1S6CA 2NLNA 2KFGA 4M2PA 1YRTB 4N1FA 3TDUA 1KSOA 3O78A 1F71A 3AKBA 4M2QA 3PALA 5CSIA 2HQWA 2KDHA 1J7PA 1J1DA 2WC8A 2I2RE 4PCWA 1PULA 4CFRA 3AAKA 1L2OC 1SKTA 1EH2A 3WHUB 4OV2A 1NCZA 4DS7A 1F8HA 2MA2A 1OE9B 1TNWA 2QACA 2L51A 5JJGA 1LINA 1QXPA 1PK0D 3K21A 1DJYA 2SASA 2PMYA 2NXQA 1OMRA 2K7OA 2LLTA 3IQOA 1BU3A 1NCXA 5AERA 1S6IA 1EL4A 4GNKB 1IJ6A 2LUXA 3O2PA 1CDLA 2LVIA 2PASA 2NCPA 5B8IB 5I2LA 3SG7A 2LM5A 5KTYA 3HCMA 4PE7A 4TNCA 1ZUZA 3PSRA 2MRDA 1QVIY 3BQ3A 1QASA 4PHJA 2KI4C 1MXLC 4MRYA 1F54A 1YR5A 1WRKA 5G08A 5CSFA 1WRLA 5I2OA 1V1GA 5HLOA 1CM4A 1VRKA 1KFXS 2OPOA 4XJKA 3DVKA 3TS5C 1YUUA 1NYAA 3ZNIA 3WHTB 4A4BA 1ZMZA 2AAOA 3PLFB 1K2HA 2CT9A 2OTGC 2BL0C 1QX2A 2LLUA 1MUXA 1JUOA 1WDCC 1C7WA 1K9UA 3JTDB 3GK4X 3SG4A 2BCXA 2JNXA 4P5OE 1K95A 2R2IA 1BOCA
chains in the Genus database with same CATH superfamily
1IRJA 1OOGA 1QATA 2BE4A 3VROA 1UURA 1RTP1 1XYDA 1UP5A 5DKRA 1RROA 1OSAA 5KU1A 1S3PA 4AQJA 3N7HA 1CLMA 1PSRA 1WLMA 2M9GA 3EKJA 2AMIA 5HKZA 1A29A 2K7BA 3EVRA 2WCFA 5DICA 3AAJA 4PDZA 1YRUB 1SY9A 1AHRA 2JXCA 3CR4X 2H8VA 1JF2A 5EL2A 4CIDA 1QWVA 4PALA 3R1VA 2ZKMX 4QJ3B 1BT6A 4GBAA 1Y1UA 3RM1A 2WOSA 1B9AA 2F2OA 3H4SE 1M63B 1L7ZA 3OB2B 2QEHA 3LL8B 1TOPA 2CNPA 2ZN8A 5I8NA 5IBWA 4YRUA 1LA3A 2JULA 3QRXA 3F45A 1DJIA 1NUBA 3CABA 3EKHA 2BCAA 1YX7A 3I5GC 2Y1MA 1M39A 4ETOA 1K90D 1B8CA 3LK1A 3SG2A 2JXLA 3B88A 1M46A 1JFKA 1X02A 2JT3A 3NSLA 2BAPA 2COLB 2M7NA 3KPXA 1MXEA 1ZACA 3S0GA 1E8AA 1IQ5A 3IF7A 2KOTA 3CR5X 1LVCD 1A03A 1NP8A 4CPVA 5HKYA 2BBMA 3LCPC 1QVIZ 2B1UA 2JWWA 3I5FC 2LC5A 4NDBA 4HRHA 2O5GA 1EG3A 4ORAB 5K89A 3DXLA 2P71A 2MLFC 3WXAA 3SG6A 3M0WA 3ICBA 3R1OA 2CTNA 4GUKA 4QJ4B 2L98A 5D7FA 1AK8A 4I5LB 2Y1NA 3R72A 1J55A 3TDZA 2F8PA 2KBIA 3TDIA 2KAXA 4OR9B 2WC5A 2H61C 1EJ3A 1XK4A 1DJXA 2PYQA 2WCEA 3DD4A 5I2QA 1IJ5A 4I5JA 4MLWA 1K93D 3MSEB 1CLBA 3B87A 1MQ1A 4XJKB 5PALA 2M1KB 2OS8B 3CYZA 4N1GA 3VB1A 2JQ6A 1SL9A 2GGMA 1NX1A 2JTZA 2K0JA 1F4QA 2L50A 3C1VA 1SL7A 2KAYA 3JTDC 3VRPA 3R1PA 2QEOA 4C0KA 1AP4A 3NSKA 2LAPA 1J7RA 2KQYA 3NHIA 2FJUB 3O4XA 2LANA 1YUSA 4JD9A 1FPWA 2I18A 1KFUS 3CS1A 3D73A 2HETA 2KFHA 1KWOB 1TUJA 4GPLB 1RK9A 2KLDA 3HX4A 1CFFA 3VRNA 2LVKA 3PN7B 1C7VA 1AJ4A 2LMTA 2MAZA 3B86A 2GGZA 2KHNA 4PT1A 1QX5B 2M8UA 1G8IA 1UHJA 1U5IA 3SS3A 2WCBA 2H2KA 4DUQA 1V1FA 1Z4HA 1SNLA 1HQVA 1BMOA 2A4JA 1SCMB 3L47A 3L4AA 4YGDB 2KBMA 3DVMA 2KLEA 2JNFA 3B6XA 3CGAA 2BECA 2MLEC 4ORBB 1B7TY 1R2UA 4FQTA 1EG4A 3UO9A 1KQMC 1H8BA 2LNKA 2LMUA 4YGCB 1CFDA 1DF0A 2KPHA 1XFRA 1QLSA 1A75A 2G9BA 2E6WA 1KK7Y 1KK8B 1SCVA 1GGZA 1MHOA 3IQQA 2L2EA 5CSJA 2EHBA 2CBLA 2KAVA 3OX6A 4UPGA 3NSOA 1NIWA 1OZSA 2L5YA 4DCKA 3CTNA 3DZTA 1SYMA 2WCHA 1NWDA 4GGFC 2LP3A 2RGIA 2M49B 2PALA 1QS7A 1IG5A 1XFZO 2Q4UA 3RLZA 1IQ3A 4MN0A 2EC6B 5GQQC 2JU0A 5AXIA 2WCLA 1B47A 1W7JB 2M3WA 1B4CA 2TN4A 1UHHA 4JWQA 1UWOA 3NSIA 4WRIA 3A8RA 1DJWA 1TN4A 1YX8A 4MRXA 4C0LA 4BY5A 1B1GA 1QV0A 1OQPA 3SG5A 4CLNA 1PSBA 1BR4B 1UHIA 2Q91A 1CMGA 1SK6D 1DJGA 1OZOA 2P70A 3BUNB 4ZCVA 1J7QA 1S6JA 2D8NA 2K7CA 4M2OA 4ORCB 3B7AA 4PE1A 2BKIB 1F70A 1XFXO 2KYFA 3FWCA 2JZIA 3D74A 1ODBA 2ZNEA 2WCKA 1QTXA 2IS9A 1FI5A 1CFCA 1B8LA 3BYAA 1G4YR 1NPQA 1ORGA 1CKKA 4R1EA 1AVSA 1M45A 1P28A 2KGBC 3E3RA 4P2YB 3BFBA 1YUTA 1FI6A 3I5HB 4MZJA 2MBXA 2K2FA 1MWNA 1QIVA 3Q8IA 1RFJA 1FF1A 5ER4X 1NX0A 2JTTA 1S36A 1XO5A 3ZWHA 2V53A 4U8DA 3FS7A 1TWOA 2PQLA 3D76A 1SPYA 2QDIA 2K2AA 3KO0A 1CM1A 2MHHA 1KQVA 1RWYA 5DKQA 2JPOA 1JF0A 1SCMC 4YI8A 2DOQA 2ZN9A 2BKHB 1JWDA 4YGAA 1TNQA 1N0YA 1U5IB 3BUMB 3D10A 4JQ0D 5AEQA 3FIAA 3GK1A 3TZ1A 4PE4A 2YGUA 4HREE 3DYEA 1QIWA 2GV5A 1MF8B 1T14A 2HPSA 1GQMA 2F2PA 2JRFA 3OX5A 2QPTA 1GJYA 1D1OA 2PRUA 1F55A 3EK8A 2PVBA 1OOJA 4OCIA 3KF9A 3S0FA 3EVVA 3BUWB 2L0PA 2AUCA 1B7TZ 1Z2CB 1KFXL 2KI4B 1QX7A 5FYXA 1KK8C 1XFWO 2F3YA 5FI7A 3V2LA 1SW8A 2CCMA 1DF0B 1KK7Z 2WC6A 4D1EA 1A75B 1DGUA 1TNPA 5I94A 4GFTA 1BJFA 3DVEA 1C3ZA 3TS5B 1YTZC 1H4BA 3I5IB 4L9MA 2QEBA 3NGVA 2KQ6A 4YGBB 1BF5A 2EC6C 1WRZA 1NX2A 1OMDA 3VGOA 3VRQA 4MZLA 1S1EA 1YVLA 1DJHA 4NDCA 4DRWA 5FI2A 3CDNA 2OTGB 1TTXA 2BL0B 5AANA 2JC2A 3S0AA 5CPVA 3PM8A 3EK7A 3OBVA 1W7IB 1DTLA 1N65A 5ER5A 1CDMA 1RJVA 2GTEA 2PSRA 2WCJA 4MZKA 1JSAA 2I94A 3BJHA 3TUYB 2G2BA 2M0RA 4MBEA 1K96A 1RECA 4A4CA 3RZSA 3OP0A 1JBAA 1YVHA 1UHNA 1SR6B 3S0BA 1IGVA 4JKTA 1XFYO 3A4UB 1IH0A 1SRAA 2HQ8A 1SSEB 2LP2A 3UNWA 3SS5A 3LLEA 1SL8A 1HT9A 1Y6WA 4FQOA 1ALVA 4INXA 1DT7B 1DJZA 2KYCA 2KFFA 2LUCA 4MEWA 1R6PA 3I5HC 1BG1A 5HKWA 1Y1XA 1F4OA 2E30A 2JPTA 4HRGA 1CNPA 3D0YA 4ZCUA 1XVJA 2ZRSA 1JFJA 4DIRA 4F0ZB 1S5GY 2LLSA 3GOFA 4C0JA 4GAOA 1A2XA 1DGVA 3NXAA 4USLA 5J3XA 2BCBA 2ERBA 3GK2A 1PVBA 1KSMA 2ZFDA 1OMVA 3S0DA 5HLVA 4AQIA 3BXKA 3I5GB 3BOWA 1BLQA 2MJWB 1OOHA 2M29A 3CZTX 4PHMA 1M31A 3L4LA 4NDDA 4I5NB 4Q04A 3S0EA 1C3YA 2CXJA 1FW4A 1JC2A 2K7DA 3OHMB 1DVIA 3JVTB 4GGFA 5D69A 1Q80A 3DY9A 1BODA 3I5FB 2M1UA 1LKJA 3DF0A 5HYDA 2LHLA 1ALWA 2LVVA 2JT8A 2SCPA 3CLNA 2LV7A 3DVJA 1XFUO 1QLKA 1K94A 2L5XB 2NZ0A 2LHIA 2OS8C 1GM0A 2LCPA 3I5IC 1DQEA 1FBVA 2M7LA 5BPJA 1CTRA 1J1EA 3PFVA 3SIAA 3IVTA 1GGWA 4ICBA 4OVNF 2FCEA 1LA0A 1TRFA 1SMGA 1NCYA 3FWBA 3OGNA 2NCOA 3KEVA 1A4PA 2K8MB 3OB1B 2KNEA 1NSHA 4BY4A 2BNXA 1TCFA 5CSNA 4XYNA 3SIBA 1CDPA 2FJYA 2KGRA 1TCOB 1KFUL 1IKUA 1XA5A 2JT0A 4JPZB 1KWOC 1EXRA 4FTGA 2LE9B 2M97A 4E68A 1S26D 3TUYC 1CMFA 2KI6C 5AFPA 2KI6D 3CZ0A 3K1EA 2F3ZA 3PN7C 1L2OB 3AKAA 1UUSA 3WNXB 3FE8A 1SR6C 4GGNA 4YBHB 4MVFA 2F33A 2ISDA 1UHKA 2L4IA 2ZNDA 3BUXB 1TUZA 1DMOA 4N5XA 4YGEB 5JOLA 2FCDA 3VRRA 3SJSA 5D3OA 1DC1A 1OW4A 1PALA 1K8UA 1QV1A 2VRGA 1C07A 1WY9A 4WQ2A 2L4HA 1NX3A 4I5KA 1N2DA 3BFAA 4YI9A 1XFVO 1B8RA 1ZFSA 4CFQA 1IWQA 1S5GZ 3D0YB 3CZ2A 1CLLA 1K9KA 3EK4A 1MR8A 1YURA 1TIZA 3O6BA 4F7FA 2WNDA 4WQ3A 5FI6A 1KCYA 2BBNA 4IL1A 1PVAA 5KSZA 2KSPA 4PHNA 2H61A 2WORA 3LK0A 3SG3A 1KQMB 2I7AA 1Y0VH 3CWGA 5HL1A 4MSPA 2Y4QA 1ZOTB 4HSZA 3CZ1A 2BE6A 5F6TA 3BOWB 1AJ5A 1LXFC 1CFPA 3NHTA 3JVTC 1SBJA 4OZDA 3FE9A 4PHKA 1CB1A 4NQGA 5TNCA 2HF5A 4PE0A 1J7OA 1BR1B 3D77A 1WLZA 2JOJA 2O60A 1DELA 4OKHA 1OOFA 3KHEA 1PRWA 3O4YA 2Y5IA 2LVJA 1K9PA 1XK4C 3BFHA 2K61A 1G33A 3EVUA 1WDCB 1Y1AA 3DF0B 3BUOB 4QJ5B 1AUIB 1TNXA 2P6BB 4AOMA 3CR2A 1CDNA 3SS4A 2EGDA 2ZRTA 1QJTA 2FOTA 5DKNA 2LMVA 1DEKA 1S6CA 2NLNA 2KFGA 4M2PA 1YRTB 4N1FA 3TDUA 1KSOA 3O78A 1F71A 3AKBA 4M2QA 3FE6A 3PATA 3PALA 5CSIA 2HQWA 2KDHA 1J7PA 1J1DA 1LS8A 2WC8A 2I2RE 3PM2A 1PULA 2QEVA 4PCWA 4CFRA 3AAKA 1L2OC 1SKTA 1EH2A 3WHUB 4OV2A 1NCZA 4DS7A 3EG5B 2MA2A 1OE9B 1F8HA 1TNWA 2QACA 3D78A 2K60A 2L51A 5JJGA 1LINA 1QXPA 1PK0D 3K21A 3D75A 1DJYA 2SASA 2PMYA 2NXQA 1OMRA 2K7OA 2LLTA 3IQOA 1BU3A 1NCXA 5AERA 1S6IA 1EL4A 4GNKB 1IJ6A 2LUXA 2WCMA 3O2PA 1CDLA 2LVIA 2PASA 2NCPA 5B8IB 5I2LA 3SG7A 2LM5A 3PJIA 3HCMA 4PE7A 4TNCA 5KTYA 1ZUZA 3PSRA 2MRDA 1QVIY 3BQ3A 1QASA 4IJ7A 4INWA 4PHJA 2KI4C 1MXLC 4MRYA 1F54A 1YR5A 1WRKA 3QMEA 5G08A 5CSFA 1WRLA 5I2OA 1V1GA 5HLOA 1CM4A 1VRKA 1KFXS 2OPOA 4XJKA 3DVKA 3TS5C 1YUUA 1NYAA 3ZNIA 3WHTB 1W9ZA 1ZMZA 2AAOA 3PLFB 4A4BA 1K2HA 4KYNA 2CT9A 2OTGC 2BL0C 1QX2A 2LLUA 1MUXA 2L2CA 1IIOA 1JUOA 1WDCC 1C7WA 1K9UA 3JTDB 3GK4X 3SG4A 2BCXA 2JNXA 4P5OE 1OOIX 1K95A 2R2IA 1BOCA
chains in the Genus database with same CATH topology
1IRJA 1QATA 2BE4A 3VROA 1UURA 1RTP1 1XYDA 1UP5A 5DKRA 1RROA 1OSAA 5KU1A 1S3PA 4AQJA 1CLMA 1PSRA 1WLMA 2M9GA 3EKJA 2AMIA 5HKZA 1A29A 2K7BA 3EVRA 2WCFA 3AAJA 4PDZA 1YRUB 1SY9A 1AHRA 2JXCA 3CR4X 1JF2A 4CIDA 4PALA 2ZKMX 4QJ3B 1BT6A 4GBAA 1Y1UA 3RM1A 2WOSA 1B9AA 2F2OA 3H4SE 1M63B 1L7ZA 3OB2B 3LL8B 1TOPA 2CNPA 2ZN8A 5I8NA 5IBWA 4YRUA 1LA3A 2JULA 3QRXA 3F45A 1DJIA 1NUBA 3EKHA 2BCAA 1YX7A 3I5GC 2Y1MA 1M39A 4ETOA 1K90D 1B8CA 3LK1A 3SG2A 2JXLA 3NSLA 1M46A 1JFKA 1X02A 2JT3A 2COLB 2M7NA 3KPXA 1MXEA 1ZACA 1E8AA 1IQ5A 3IF7A 2KOTA 3CR5X 1LVCD 1A03A 1NP8A 4CPVA 5HKYA 2BBMA 3LCPC 1QVIZ 2B1UA 2JWWA 3I5FC 2LC5A 4NDBA 4HRHA 2O5GA 1EG3A 4ORAB 5K89A 3WXAA 2MLFC 3SG6A 3M0WA 3ICBA 2CTNA 4GUKA 4QJ4B 2L98A 5D7FA 1AK8A 4I5LB 2Y1NA 1J55A 3TDZA 2F8PA 2KBIA 3TDIA 2KAXA 4OR9B 2H61C 1EJ3A 1XK4A 1DJXA 2WCEA 5I2QA 3DD4A 1IJ5A 4I5JA 4MLWA 1K93D 3MSEB 1CLBA 1MQ1A 4XJKB 5PALA 2M1KB 2OS8B 4N1GA 2JQ6A 1SL9A 2GGMA 1NX1A 2JTZA 2K0JA 1F4QA 2L50A 3C1VA 1SL7A 2KAYA 3JTDC 3VRPA 4C0KA 1AP4A 3NSKA 2LAPA 1J7RA 2KQYA 2FJUB 2LANA 1YUSA 1FPWA 2I18A 1KFUS 3CS1A 2HETA 2KFHA 1KWOB 4GPLB 1RK9A 3HX4A 1CFFA 3VRNA 2LVKA 3PN7B 1C7VA 1AJ4A 2LMTA 2MAZA 2GGZA 2KHNA 1QX5B 2M8UA 1G8IA 1UHJA 1U5IA 2WCBA 2H2KA 4DUQA 1V1FA 1SNLA 1HQVA 1BMOA 2A4JA 1SCMB 4YGDB 2KBMA 3DVMA 2JNFA 3CGAA 2BECA 2MLEC 4ORBB 1B7TY 1R2UA 1EG4A 1KQMC 1H8BA 2LNKA 2LMUA 4YGCB 1CFDA 1DF0A 1QLSA 1A75A 2G9BA 2E6WA 1KK7Y 1KK8B 1SCVA 1GGZA 1MHOA 3IQQA 2L2EA 5CSJA 2EHBA 2CBLA 2KAVA 3OX6A 4UPGA 3NSOA 1NIWA 1OZSA 4DCKA 3CTNA 1SYMA 1NWDA 4GGFC 2LP3A 2RGIA 2M49B 2PALA 1QS7A 1IG5A 1XFZO 2Q4UA 3RLZA 1IQ3A 4MN0A 2EC6B 5GQQC 2JU0A 5AXIA 1B47A 1W7JB 2M3WA 1B4CA 2TN4A 1UHHA 4JWQA 1UWOA 3NSIA 4WRIA 3A8RA 1DJWA 1TN4A 1YX8A 4MRXA 4C0LA 4BY5A 1B1GA 1QV0A 1OQPA 3SG5A 4CLNA 1PSBA 1BR4B 1UHIA 2Q91A 1CMGA 1SK6D 1DJGA 1OZOA 3BUNB 4ZCVA 1J7QA 1S6JA 2D8NA 2K7CA 4M2OA 4ORCB 4PE1A 2BKIB 1F70A 1XFXO 2KYFA 3FWCA 2JZIA 1ODBA 2ZNEA 1QTXA 2IS9A 1FI5A 1CFCA 1B8LA 3BYAA 1G4YR 1NPQA 1CKKA 4R1EA 1AVSA 1M45A 2KGBC 3E3RA 4P2YB 1YUTA 1FI6A 3I5HB 4MZJA 2MBXA 2K2FA 1MWNA 1QIVA 1RFJA 1FF1A 5ER4X 1NX0A 2JTTA 1S36A 1XO5A 3ZWHA 2V53A 4U8DA 3FS7A 1SPYA 3KO0A 2K2AA 1KQVA 1CM1A 2MHHA 1RWYA 5DKQA 1JF0A 1SCMC 4YI8A 2DOQA 2ZN9A 2BKHB 1JWDA 4YGAA 1TNQA 1N0YA 1U5IB 3BUMB 3D10A 4JQ0D 5AEQA 3FIAA 3GK1A 3TZ1A 4PE4A 4HREE 1QIWA 2GV5A 1MF8B 2HPSA 2JRFA 1GQMA 2F2PA 3OX5A 2QPTA 1GJYA 1D1OA 2PRUA 1F55A 3EK8A 2PVBA 1OOJA 4OCIA 3KF9A 3EVVA 3BUWB 2L0PA 2AUCA 1B7TZ 1KFXL 2KI4B 1QX7A 5FYXA 1KK8C 1XFWO 2F3YA 1SW8A 2CCMA 1DF0B 1KK7Z 4D1EA 1A75B 1DGUA 1TNPA 4GFTA 1BJFA 3DVEA 3TS5B 1YTZC 1H4BA 3I5IB 4L9MA 2KQ6A 4YGBB 1BF5A 2EC6C 1WRZA 1NX2A 1OMDA 3VGOA 3VRQA 4MZLA 1S1EA 1YVLA 1DJHA 4NDCA 4DRWA 2OTGB 1TTXA 2BL0B 5AANA 2JC2A 5CPVA 3PM8A 3EK7A 1W7IB 1DTLA 1N65A 5ER5A 1CDMA 1RJVA 2PSRA 4MZKA 1JSAA 2I94A 3TUYB 2G2BA 2M0RA 4MBEA 1K96A 1RECA 4A4CA 3OP0A 1JBAA 1YVHA 1UHNA 1SR6B 1IGVA 1XFYO 3A4UB 1IH0A 1SRAA 2HQ8A 2LP2A 3LLEA 1SL8A 1HT9A 1Y6WA 4FQOA 1ALVA 1DT7B 1DJZA 2KYCA 2KFFA 2LUCA 4MEWA 1R6PA 3I5HC 1BG1A 5HKWA 1Y1XA 1F4OA 2E30A 2JPTA 4HRGA 1CNPA 3D0YA 4ZCUA 1XVJA 2ZRSA 1JFJA 4DIRA 4F0ZB 1S5GY 2LLSA 3GOFA 4C0JA 4GAOA 1A2XA 1DGVA 3NXAA 4USLA 5J3XA 2BCBA 3GK2A 1PVBA 1KSMA 2ZFDA 1OMVA 5HLVA 4AQIA 3BXKA 3I5GB 3BOWA 1BLQA 2MJWB 2M29A 3CZTX 4PHMA 1M31A 4NDDA 4I5NB 4Q04A 2CXJA 1FW4A 1JC2A 2K7DA 3OHMB 1DVIA 3JVTB 4GGFA 5D69A 1Q80A 1BODA 3I5FB 2M1UA 1LKJA 3DF0A 5HYDA 2LHLA 1ALWA 2LVVA 2JT8A 2SCPA 3CLNA 2LV7A 3DVJA 1XFUO 1QLKA 1K94A 2L5XB 2NZ0A 2LHIA 2OS8C 2LCPA 3I5IC 1FBVA 2M7LA 5BPJA 1CTRA 1J1EA 3PFVA 3SIAA 1GGWA 4ICBA 4OVNF 2FCEA 1LA0A 1TRFA 1SMGA 1NCYA 3FWBA 2NCOA 3KEVA 1A4PA 2K8MB 3OB1B 2KNEA 1NSHA 4BY4A 1TCFA 5CSNA 4XYNA 3SIBA 1CDPA 2KGRA 1TCOB 1KFUL 1IKUA 1XA5A 2JT0A 4JPZB 1KWOC 1EXRA 4FTGA 2LE9B 2M97A 4E68A 1S26D 3TUYC 1CMFA 2KI6C 5AFPA 2KI6D 3PN7C 2F3ZA 1L2OB 3AKAA 1UUSA 3WNXB 1SR6C 4GGNA 4YBHB 4MVFA 2F33A 2ISDA 1UHKA 2L4IA 2ZNDA 3BUXB 1DMOA 4N5XA 4YGEB 5JOLA 2FCDA 3VRRA 3SJSA 1PALA 1K8UA 1QV1A 2VRGA 1C07A 1WY9A 4WQ2A 2L4HA 1NX3A 4I5KA 1N2DA 4YI9A 1XFVO 1B8RA 1ZFSA 4CFQA 1IWQA 1S5GZ 3D0YB 1CLLA 1K9KA 3EK4A 1MR8A 1YURA 1TIZA 3O6BA 2WNDA 4WQ3A 1KCYA 2BBNA 4IL1A 1PVAA 5KSZA 2KSPA 4PHNA 2H61A 2WORA 3LK0A 3SG3A 1KQMB 2I7AA 1Y0VH 3CWGA 4MSPA 2Y4QA 1ZOTB 4HSZA 2BE6A 5F6TA 3BOWB 1AJ5A 1LXFC 1CFPA 3JVTC 1SBJA 4PHKA 1CB1A 4NQGA 5TNCA 2HF5A 4PE0A 1J7OA 1BR1B 1WLZA 2JOJA 2O60A 4OKHA 3KHEA 1PRWA 3O4YA 2Y5IA 2LVJA 1K9PA 1XK4C 3PATA 2K61A 1G33A 3EVUA 1WDCB 1Y1AA 3DF0B 3BUOB 4QJ5B 1AUIB 1TNXA 2P6BB 4AOMA 3CR2A 1CDNA 2EGDA 2ZRTA 1QJTA 2FOTA 5DKNA 2LMVA 1S6CA 2NLNA 2KFGA 4M2PA 1YRTB 4N1FA 3TDUA 1KSOA 3O78A 1F71A 3AKBA 4M2QA 3PALA 5CSIA 2HQWA 2KDHA 1J7PA 1J1DA 2WC8A 2I2RE 4PCWA 1PULA 4CFRA 3AAKA 1L2OC 1SKTA 1EH2A 3WHUB 4OV2A 1NCZA 4DS7A 1F8HA 2MA2A 1OE9B 1TNWA 2QACA 2L51A 5JJGA 1LINA 1QXPA 1PK0D 3K21A 1DJYA 2SASA 2PMYA 2NXQA 1OMRA 2K7OA 2LLTA 3IQOA 1BU3A 1NCXA 5AERA 1S6IA 1EL4A 4GNKB 1IJ6A 2LUXA 3O2PA 1CDLA 2LVIA 2PASA 2NCPA 5B8IB 5I2LA 3SG7A 2LM5A 5KTYA 3HCMA 4PE7A 4TNCA 1ZUZA 3PSRA 2MRDA 1QVIY 3BQ3A 1QASA 4PHJA 2KI4C 1MXLC 4MRYA 1F54A 1YR5A 1WRKA 5G08A 5CSFA 1WRLA 5I2OA 1V1GA 5HLOA 1CM4A 1VRKA 1KFXS 2OPOA 4XJKA 3DVKA 3TS5C 1YUUA 1NYAA 3ZNIA 3WHTB 4A4BA 1ZMZA 2AAOA 3PLFB 1K2HA 2CT9A 2OTGC 2BL0C 1QX2A 2LLUA 1MUXA 1JUOA 1WDCC 1C7WA 1K9UA 3JTDB 3GK4X 3SG4A 2BCXA 2JNXA 4P5OE 1K95A 2R2IA 1BOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRJ A;  1QAT A;  2BE4 A;  3VRO A;  1UUR A;  1RTP 1;  1XYD A;  1UP5 A;  5DKR A;  1RRO A;  1OSA A;  5KU1 A;  1S3P A;  4AQJ A;  1CLM A;  1PSR A;  1WLM A;  2M9G A;  3EKJ A;  2AMI A;  5HKZ A;  1A29 A;  2K7B A;  3EVR A;  2WCF A;  3AAJ A;  4PDZ A;  1YRU B;  1SY9 A;  1AHR A;  2JXC A;  3CR4 X;  1JF2 A;  4CID A;  4PAL A;  2ZKM X;  4QJ3 B;  1BT6 A;  4GBA A;  1Y1U A;  3RM1 A;  2WOS A;  1B9A A;  2F2O A;  3H4S E;  1M63 B;  1L7Z A;  3OB2 B;  3LL8 B;  1TOP A;  2CNP A;  2ZN8 A;  5I8N A;  5IBW A;  4YRU A;  1LA3 A;  2JUL A;  3QRX A;  3F45 A;  1DJI A;  1NUB A;  3EKH A;  2BCA A;  1YX7 A;  3I5G C;  2Y1M A;  1M39 A;  4ETO A;  1K90 D;  1B8C A;  3LK1 A;  3SG2 A;  2JXL A;  3NSL A;  1M46 A;  1JFK A;  1X02 A;  2JT3 A;  2COL B;  2M7N A;  3KPX A;  1MXE A;  1ZAC A;  1E8A A;  1IQ5 A;  3IF7 A;  2KOT A;  3CR5 X;  1LVC D;  1A03 A;  1NP8 A;  4CPV A;  5HKY A;  2BBM A;  3LCP C;  1QVI Z;  2B1U A;  2JWW A;  3I5F C;  2LC5 A;  4NDB A;  4HRH A;  2O5G A;  1EG3 A;  4ORA B;  5K89 A;  3WXA A;  2MLF C;  3SG6 A;  3M0W A;  3ICB A;  2CTN A;  4GUK A;  4QJ4 B;  2L98 A;  5D7F A;  1AK8 A;  4I5L B;  2Y1N A;  1J55 A;  3TDZ A;  2F8P A;  2KBI A;  3TDI A;  2KAX A;  4OR9 B;  2H61 C;  1EJ3 A;  1XK4 A;  1DJX A;  2WCE A;  5I2Q A;  3DD4 A;  1IJ5 A;  4I5J A;  4MLW A;  1K93 D;  3MSE B;  1CLB A;  1MQ1 A;  4XJK B;  5PAL A;  2M1K B;  2OS8 B;  4N1G A;  2JQ6 A;  1SL9 A;  2GGM A;  1NX1 A;  2JTZ A;  2K0J A;  1F4Q A;  2L50 A;  3C1V A;  1SL7 A;  2KAY A;  3JTD C;  3VRP A;  4C0K A;  1AP4 A;  3NSK A;  2LAP A;  1J7R A;  2KQY A;  2FJU B;  2LAN A;  1YUS A;  1FPW A;  2I18 A;  1KFU S;  3CS1 A;  2HET A;  2KFH A;  1KWO B;  4GPL B;  1RK9 A;  3HX4 A;  1CFF A;  3VRN A;  2LVK A;  3PN7 B;  1C7V A;  1AJ4 A;  2LMT A;  2MAZ A;  2GGZ A;  2KHN A;  1QX5 B;  2M8U A;  1G8I A;  1UHJ A;  1U5I A;  2WCB A;  2H2K A;  4DUQ A;  1V1F A;  1SNL A;  1HQV A;  1BMO A;  2A4J A;  1SCM B;  4YGD B;  2KBM A;  3DVM A;  2JNF A;  3CGA A;  2BEC A;  2MLE C;  4ORB B;  1B7T Y;  1R2U A;  1EG4 A;  1KQM C;  1H8B A;  2LNK A;  2LMU A;  4YGC B;  1CFD A;  1DF0 A;  1QLS A;  1A75 A;  2G9B A;  2E6W A;  1KK7 Y;  1KK8 B;  1SCV A;  1GGZ A;  1MHO A;  3IQQ A;  2L2E A;  5CSJ A;  2EHB A;  2CBL A;  2KAV A;  3OX6 A;  4UPG A;  3NSO A;  1NIW A;  1OZS A;  4DCK A;  3CTN A;  1SYM A;  1NWD A;  4GGF C;  2LP3 A;  2RGI A;  2M49 B;  2PAL A;  1QS7 A;  1IG5 A;  1XFZ O;  2Q4U A;  3RLZ A;  1IQ3 A;  4MN0 A;  2EC6 B;  5GQQ C;  2JU0 A;  5AXI A;  1B47 A;  1W7J B;  2M3W A;  1B4C A;  2TN4 A;  1UHH A;  4JWQ A;  1UWO A;  3NSI A;  4WRI A;  3A8R A;  1DJW A;  1TN4 A;  1YX8 A;  4MRX A;  4C0L A;  4BY5 A;  1B1G A;  1QV0 A;  1OQP A;  3SG5 A;  4CLN A;  1PSB A;  1BR4 B;  1UHI A;  2Q91 A;  1CMG A;  1SK6 D;  1DJG A;  1OZO A;  3BUN B;  4ZCV A;  1J7Q A;  1S6J A;  2D8N A;  2K7C A;  4M2O A;  4ORC B;  4PE1 A;  2BKI B;  1F70 A;  1XFX O;  2KYF A;  3FWC A;  2JZI A;  1ODB A;  2ZNE A;  1QTX A;  2IS9 A;  1FI5 A;  1CFC A;  1B8L A;  3BYA A;  1G4Y R;  1NPQ A;  1CKK A;  4R1E A;  1AVS A;  1M45 A;  2KGB C;  3E3R A;  4P2Y B;  1YUT A;  1FI6 A;  3I5H B;  4MZJ A;  2MBX A;  2K2F A;  1MWN A;  1QIV A;  1RFJ A;  1FF1 A;  5ER4 X;  1NX0 A;  2JTT A;  1S36 A;  1XO5 A;  3ZWH A;  2V53 A;  4U8D A;  3FS7 A;  1SPY A;  3KO0 A;  2K2A A;  1KQV A;  1CM1 A;  2MHH A;  1RWY A;  5DKQ A;  1JF0 A;  1SCM C;  4YI8 A;  2DOQ A;  2ZN9 A;  2BKH B;  1JWD A;  4YGA A;  1TNQ A;  1N0Y A;  1U5I B;  3BUM B;  3D10 A;  4JQ0 D;  5AEQ A;  3FIA A;  3GK1 A;  3TZ1 A;  4PE4 A;  4HRE E;  1QIW A;  2GV5 A;  1MF8 B;  2HPS A;  2JRF A;  1GQM A;  2F2P A;  3OX5 A;  2QPT A;  1GJY A;  1D1O A;  2PRU A;  1F55 A;  3EK8 A;  2PVB A;  1OOJ A;  4OCI A;  3KF9 A;  3EVV A;  3BUW B;  2L0P A;  2AUC A;  1B7T Z;  1KFX L;  2KI4 B;  1QX7 A;  5FYX A;  1KK8 C;  1XFW O;  2F3Y A;  1SW8 A;  2CCM A;  1DF0 B;  1KK7 Z;  4D1E A;  1A75 B;  1DGU A;  1TNP A;  4GFT A;  1BJF A;  3DVE A;  3TS5 B;  1YTZ C;  1H4B A;  3I5I B;  4L9M A;  2KQ6 A;  4YGB B;  1BF5 A;  2EC6 C;  1WRZ A;  1NX2 A;  1OMD A;  3VGO A;  3VRQ A;  4MZL A;  1S1E A;  1YVL A;  1DJH A;  4NDC A;  4DRW A;  2OTG B;  1TTX A;  2BL0 B;  5AAN A;  2JC2 A;  5CPV A;  3PM8 A;  3EK7 A;  1W7I B;  1DTL A;  1N65 A;  5ER5 A;  1CDM A;  1RJV A;  2PSR A;  4MZK A;  1JSA A;  2I94 A;  3TUY B;  2G2B A;  2M0R A;  4MBE A;  1K96 A;  1REC A;  4A4C A;  3OP0 A;  1JBA A;  1YVH A;  1UHN A;  1SR6 B;  1IGV A;  1XFY O;  3A4U B;  1IH0 A;  1SRA A;  2HQ8 A;  2LP2 A;  3LLE A;  1SL8 A;  1HT9 A;  1Y6W A;  4FQO A;  1ALV A;  1DT7 B;  1DJZ A;  2KYC A;  2KFF A;  2LUC A;  4MEW A;  1R6P A;  3I5H C;  1BG1 A;  5HKW A;  1Y1X A;  1F4O A;  2E30 A;  2JPT A;  4HRG A;  1CNP A;  3D0Y A;  4ZCU A;  1XVJ A;  2ZRS A;  1JFJ A;  4DIR A;  4F0Z B;  1S5G Y;  2LLS A;  3GOF A;  4C0J A;  4GAO A;  1A2X A;  1DGV A;  3NXA A;  4USL A;  5J3X A;  2BCB A;  3GK2 A;  1PVB A;  1KSM A;  2ZFD A;  1OMV A;  5HLV A;  4AQI A;  3BXK A;  3I5G B;  3BOW A;  1BLQ A;  2MJW B;  2M29 A;  3CZT X;  4PHM A;  1M31 A;  4NDD A;  4I5N B;  4Q04 A;  2CXJ A;  1FW4 A;  1JC2 A;  2K7D A;  3OHM B;  1DVI A;  3JVT B;  4GGF A;  5D69 A;  1Q80 A;  1BOD A;  3I5F B;  2M1U A;  1LKJ A;  3DF0 A;  5HYD A;  2LHL A;  1ALW A;  2LVV A;  2JT8 A;  2SCP A;  3CLN A;  2LV7 A;  3DVJ A;  1XFU O;  1QLK A;  1K94 A;  2L5X B;  2NZ0 A;  2LHI A;  2OS8 C;  2LCP A;  3I5I C;  1FBV A;  2M7L A;  5BPJ A;  1CTR A;  1J1E A;  3PFV A;  3SIA A;  1GGW A;  4ICB A;  4OVN F;  2FCE A;  1LA0 A;  1TRF A;  1SMG A;  1NCY A;  3FWB A;  2NCO A;  3KEV A;  1A4P A;  2K8M B;  3OB1 B;  2KNE A;  1NSH A;  4BY4 A;  1TCF A;  5CSN A;  4XYN A;  3SIB A;  1CDP A;  2KGR A;  1TCO B;  1KFU L;  1IKU A;  1XA5 A;  2JT0 A;  4JPZ B;  1KWO C;  1EXR A;  4FTG A;  2LE9 B;  2M97 A;  4E68 A;  1S26 D;  3TUY C;  1CMF A;  2KI6 C;  5AFP A;  2KI6 D;  3PN7 C;  2F3Z A;  1L2O B;  3AKA A;  1UUS A;  3WNX B;  1SR6 C;  4GGN A;  4YBH B;  4MVF A;  2F33 A;  2ISD A;  1UHK A;  2L4I A;  2ZND A;  3BUX B;  1DMO A;  4N5X A;  4YGE B;  5JOL A;  2FCD A;  3VRR A;  3SJS A;  1PAL A;  1K8U A;  1QV1 A;  2VRG A;  1C07 A;  1WY9 A;  4WQ2 A;  2L4H A;  1NX3 A;  4I5K A;  1N2D A;  4YI9 A;  1XFV O;  1B8R A;  1ZFS A;  4CFQ A;  1IWQ A;  1S5G Z;  3D0Y B;  1CLL A;  1K9K A;  3EK4 A;  1MR8 A;  1YUR A;  1TIZ A;  3O6B A;  2WND A;  4WQ3 A;  1KCY A;  2BBN A;  4IL1 A;  1PVA A;  5KSZ A;  2KSP A;  4PHN A;  2H61 A;  2WOR A;  3LK0 A;  3SG3 A;  1KQM B;  2I7A A;  1Y0V H;  3CWG A;  4MSP A;  2Y4Q A;  1ZOT B;  4HSZ A;  2BE6 A;  5F6T A;  3BOW B;  1AJ5 A;  1LXF C;  1CFP A;  3JVT C;  1SBJ A;  4PHK A;  1CB1 A;  4NQG A;  5TNC A;  2HF5 A;  4PE0 A;  1J7O A;  1BR1 B;  1WLZ A;  2JOJ A;  2O60 A;  4OKH A;  3KHE A;  1PRW A;  3O4Y A;  2Y5I A;  2LVJ A;  1K9P A;  1XK4 C;  3PAT A;  2K61 A;  1G33 A;  3EVU A;  1WDC B;  1Y1A A;  3DF0 B;  3BUO B;  4QJ5 B;  1AUI B;  1TNX A;  2P6B B;  4AOM A;  3CR2 A;  1CDN A;  2EGD A;  2ZRT A;  1QJT A;  2FOT A;  5DKN A;  2LMV A;  1S6C A;  2NLN A;  2KFG A;  4M2P A;  1YRT B;  4N1F A;  3TDU A;  1KSO A;  3O78 A;  1F71 A;  3AKB A;  4M2Q A;  3PAL A;  5CSI A;  2HQW A;  2KDH A;  1J7P A;  1J1D A;  2WC8 A;  2I2R E;  4PCW A;  1PUL A;  4CFR A;  3AAK A;  1L2O C;  1SKT A;  1EH2 A;  3WHU B;  4OV2 A;  1NCZ A;  4DS7 A;  1F8H A;  2MA2 A;  1OE9 B;  1TNW A;  2QAC A;  2L51 A;  5JJG A;  1LIN A;  1QXP A;  1PK0 D;  3K21 A;  1DJY A;  2SAS A;  2PMY A;  2NXQ A;  1OMR A;  2K7O A;  2LLT A;  3IQO A;  1BU3 A;  1NCX A;  5AER A;  1S6I A;  1EL4 A;  4GNK B;  1IJ6 A;  2LUX A;  3O2P A;  1CDL A;  2LVI A;  2PAS A;  2NCP A;  5B8I B;  5I2L A;  3SG7 A;  2LM5 A;  5KTY A;  3HCM A;  4PE7 A;  4TNC A;  1ZUZ A;  3PSR A;  2MRD A;  1QVI Y;  3BQ3 A;  1QAS A;  4PHJ A;  2KI4 C;  1MXL C;  4MRY A;  1F54 A;  1YR5 A;  1WRK A;  5G08 A;  5CSF A;  1WRL A;  5I2O A;  1V1G A;  5HLO A;  1CM4 A;  1VRK A;  1KFX S;  2OPO A;  4XJK A;  3DVK A;  3TS5 C;  1YUU A;  1NYA A;  3ZNI A;  3WHT B;  4A4B A;  1ZMZ A;  2AAO A;  3PLF B;  1K2H A;  2CT9 A;  2OTG C;  2BL0 C;  1QX2 A;  2LLU A;  1MUX A;  1JUO A;  1WDC C;  1C7W A;  1K9U A;  3JTD B;  3GK4 X;  3SG4 A;  2BCX A;  2JNX A;  4P5O E;  1K95 A;  2R2I A;  1BOC A; 
#chains in the Genus database with same CATH topology
 1IRJ A;  1OOG A;  1QAT A;  2BE4 A;  3VRO A;  1UUR A;  1RTP 1;  1XYD A;  1UP5 A;  5DKR A;  1RRO A;  1OSA A;  5KU1 A;  1S3P A;  4AQJ A;  3N7H A;  1CLM A;  1PSR A;  1WLM A;  2M9G A;  3EKJ A;  2AMI A;  5HKZ A;  1A29 A;  2K7B A;  3EVR A;  2WCF A;  5DIC A;  3AAJ A;  4PDZ A;  1YRU B;  1SY9 A;  1AHR A;  2JXC A;  3CR4 X;  2H8V A;  1JF2 A;  5EL2 A;  4CID A;  1QWV A;  4PAL A;  3R1V A;  2ZKM X;  4QJ3 B;  1BT6 A;  4GBA A;  1Y1U A;  3RM1 A;  2WOS A;  1B9A A;  2F2O A;  3H4S E;  1M63 B;  1L7Z A;  3OB2 B;  2QEH A;  3LL8 B;  1TOP A;  2CNP A;  2ZN8 A;  5I8N A;  5IBW A;  4YRU A;  1LA3 A;  2JUL A;  3QRX A;  3F45 A;  1DJI A;  1NUB A;  3CAB A;  3EKH A;  2BCA A;  1YX7 A;  3I5G C;  2Y1M A;  1M39 A;  4ETO A;  1K90 D;  1B8C A;  3LK1 A;  3SG2 A;  2JXL A;  3B88 A;  1M46 A;  1JFK A;  1X02 A;  2JT3 A;  3NSL A;  2BAP A;  2COL B;  2M7N A;  3KPX A;  1MXE A;  1ZAC A;  3S0G A;  1E8A A;  1IQ5 A;  3IF7 A;  2KOT A;  3CR5 X;  1LVC D;  1A03 A;  1NP8 A;  4CPV A;  5HKY A;  2BBM A;  3LCP C;  1QVI Z;  2B1U A;  2JWW A;  3I5F C;  2LC5 A;  4NDB A;  4HRH A;  2O5G A;  1EG3 A;  4ORA B;  5K89 A;  3DXL A;  2P71 A;  2MLF C;  3WXA A;  3SG6 A;  3M0W A;  3ICB A;  3R1O A;  2CTN A;  4GUK A;  4QJ4 B;  2L98 A;  5D7F A;  1AK8 A;  4I5L B;  2Y1N A;  3R72 A;  1J55 A;  3TDZ A;  2F8P A;  2KBI A;  3TDI A;  2KAX A;  4OR9 B;  2WC5 A;  2H61 C;  1EJ3 A;  1XK4 A;  1DJX A;  2PYQ A;  2WCE A;  3DD4 A;  5I2Q A;  1IJ5 A;  4I5J A;  4MLW A;  1K93 D;  3MSE B;  1CLB A;  3B87 A;  1MQ1 A;  4XJK B;  5PAL A;  2M1K B;  2OS8 B;  3CYZ A;  4N1G A;  3VB1 A;  2JQ6 A;  1SL9 A;  2GGM A;  1NX1 A;  2JTZ A;  2K0J A;  1F4Q A;  2L50 A;  3C1V A;  1SL7 A;  2KAY A;  3JTD C;  3VRP A;  3R1P A;  2QEO A;  4C0K A;  1AP4 A;  3NSK A;  2LAP A;  1J7R A;  2KQY A;  3NHI A;  2FJU B;  3O4X A;  2LAN A;  1YUS A;  4JD9 A;  1FPW A;  2I18 A;  1KFU S;  3CS1 A;  3D73 A;  2HET A;  2KFH A;  1KWO B;  1TUJ A;  4GPL B;  1RK9 A;  2KLD A;  3HX4 A;  1CFF A;  3VRN A;  2LVK A;  3PN7 B;  1C7V A;  1AJ4 A;  2LMT A;  2MAZ A;  3B86 A;  2GGZ A;  2KHN A;  4PT1 A;  1QX5 B;  2M8U A;  1G8I A;  1UHJ A;  1U5I A;  3SS3 A;  2WCB A;  2H2K A;  4DUQ A;  1V1F A;  1Z4H A;  1SNL A;  1HQV A;  1BMO A;  2A4J A;  1SCM B;  3L47 A;  3L4A A;  4YGD B;  2KBM A;  3DVM A;  2KLE A;  2JNF A;  3B6X A;  3CGA A;  2BEC A;  2MLE C;  4ORB B;  1B7T Y;  1R2U A;  4FQT A;  1EG4 A;  3UO9 A;  1KQM C;  1H8B A;  2LNK A;  2LMU A;  4YGC B;  1CFD A;  1DF0 A;  2KPH A;  1XFR A;  1QLS A;  1A75 A;  2G9B A;  2E6W A;  1KK7 Y;  1KK8 B;  1SCV A;  1GGZ A;  1MHO A;  3IQQ A;  2L2E A;  5CSJ A;  2EHB A;  2CBL A;  2KAV A;  3OX6 A;  4UPG A;  3NSO A;  1NIW A;  1OZS A;  2L5Y A;  4DCK A;  3CTN A;  3DZT A;  1SYM A;  2WCH A;  1NWD A;  4GGF C;  2LP3 A;  2RGI A;  2M49 B;  2PAL A;  1QS7 A;  1IG5 A;  1XFZ O;  2Q4U A;  3RLZ A;  1IQ3 A;  4MN0 A;  2EC6 B;  5GQQ C;  2JU0 A;  5AXI A;  2WCL A;  1B47 A;  1W7J B;  2M3W A;  1B4C A;  2TN4 A;  1UHH A;  4JWQ A;  1UWO A;  3NSI A;  4WRI A;  3A8R A;  1DJW A;  1TN4 A;  1YX8 A;  4MRX A;  4C0L A;  4BY5 A;  1B1G A;  1QV0 A;  1OQP A;  3SG5 A;  4CLN A;  1PSB A;  1BR4 B;  1UHI A;  2Q91 A;  1CMG A;  1SK6 D;  1DJG A;  1OZO A;  2P70 A;  3BUN B;  4ZCV A;  1J7Q A;  1S6J A;  2D8N A;  2K7C A;  4M2O A;  4ORC B;  3B7A A;  4PE1 A;  2BKI B;  1F70 A;  1XFX O;  2KYF A;  3FWC A;  2JZI A;  3D74 A;  1ODB A;  2ZNE A;  2WCK A;  1QTX A;  2IS9 A;  1FI5 A;  1CFC A;  1B8L A;  3BYA A;  1G4Y R;  1NPQ A;  1ORG A;  1CKK A;  4R1E A;  1AVS A;  1M45 A;  1P28 A;  2KGB C;  3E3R A;  4P2Y B;  3BFB A;  1YUT A;  1FI6 A;  3I5H B;  4MZJ A;  2MBX A;  2K2F A;  1MWN A;  1QIV A;  3Q8I A;  1RFJ A;  1FF1 A;  5ER4 X;  1NX0 A;  2JTT A;  1S36 A;  1XO5 A;  3ZWH A;  2V53 A;  4U8D A;  3FS7 A;  1TWO A;  2PQL A;  3D76 A;  1SPY A;  2QDI A;  2K2A A;  3KO0 A;  1CM1 A;  2MHH A;  1KQV A;  1RWY A;  5DKQ A;  2JPO A;  1JF0 A;  1SCM C;  4YI8 A;  2DOQ A;  2ZN9 A;  2BKH B;  1JWD A;  4YGA A;  1TNQ A;  1N0Y A;  1U5I B;  3BUM B;  3D10 A;  4JQ0 D;  5AEQ A;  3FIA A;  3GK1 A;  3TZ1 A;  4PE4 A;  2YGU A;  4HRE E;  3DYE A;  1QIW A;  2GV5 A;  1MF8 B;  1T14 A;  2HPS A;  1GQM A;  2F2P A;  2JRF A;  3OX5 A;  2QPT A;  1GJY A;  1D1O A;  2PRU A;  1F55 A;  3EK8 A;  2PVB A;  1OOJ A;  4OCI A;  3KF9 A;  3S0F A;  3EVV A;  3BUW B;  2L0P A;  2AUC A;  1B7T Z;  1Z2C B;  1KFX L;  2KI4 B;  1QX7 A;  5FYX A;  1KK8 C;  1XFW O;  2F3Y A;  5FI7 A;  3V2L A;  1SW8 A;  2CCM A;  1DF0 B;  1KK7 Z;  2WC6 A;  4D1E A;  1A75 B;  1DGU A;  1TNP A;  5I94 A;  4GFT A;  1BJF A;  3DVE A;  1C3Z A;  3TS5 B;  1YTZ C;  1H4B A;  3I5I B;  4L9M A;  2QEB A;  3NGV A;  2KQ6 A;  4YGB B;  1BF5 A;  2EC6 C;  1WRZ A;  1NX2 A;  1OMD A;  3VGO A;  3VRQ A;  4MZL A;  1S1E A;  1YVL A;  1DJH A;  4NDC A;  4DRW A;  5FI2 A;  3CDN A;  2OTG B;  1TTX A;  2BL0 B;  5AAN A;  2JC2 A;  3S0A A;  5CPV A;  3PM8 A;  3EK7 A;  3OBV A;  1W7I B;  1DTL A;  1N65 A;  5ER5 A;  1CDM A;  1RJV A;  2GTE A;  2PSR A;  2WCJ A;  4MZK A;  1JSA A;  2I94 A;  3BJH A;  3TUY B;  2G2B A;  2M0R A;  4MBE A;  1K96 A;  1REC A;  4A4C A;  3RZS A;  3OP0 A;  1JBA A;  1YVH A;  1UHN A;  1SR6 B;  3S0B A;  1IGV A;  4JKT A;  1XFY O;  3A4U B;  1IH0 A;  1SRA A;  2HQ8 A;  1SSE B;  2LP2 A;  3UNW A;  3SS5 A;  3LLE A;  1SL8 A;  1HT9 A;  1Y6W A;  4FQO A;  1ALV A;  4INX A;  1DT7 B;  1DJZ A;  2KYC A;  2KFF A;  2LUC A;  4MEW A;  1R6P A;  3I5H C;  1BG1 A;  5HKW A;  1Y1X A;  1F4O A;  2E30 A;  2JPT A;  4HRG A;  1CNP A;  3D0Y A;  4ZCU A;  1XVJ A;  2ZRS A;  1JFJ A;  4DIR A;  4F0Z B;  1S5G Y;  2LLS A;  3GOF A;  4C0J A;  4GAO A;  1A2X A;  1DGV A;  3NXA A;  4USL A;  5J3X A;  2BCB A;  2ERB A;  3GK2 A;  1PVB A;  1KSM A;  2ZFD A;  1OMV A;  3S0D A;  5HLV A;  4AQI A;  3BXK A;  3I5G B;  3BOW A;  1BLQ A;  2MJW B;  1OOH A;  2M29 A;  3CZT X;  4PHM A;  1M31 A;  3L4L A;  4NDD A;  4I5N B;  4Q04 A;  3S0E A;  1C3Y A;  2CXJ A;  1FW4 A;  1JC2 A;  2K7D A;  3OHM B;  1DVI A;  3JVT B;  4GGF A;  5D69 A;  1Q80 A;  3DY9 A;  1BOD A;  3I5F B;  2M1U A;  1LKJ A;  3DF0 A;  5HYD A;  2LHL A;  1ALW A;  2LVV A;  2JT8 A;  2SCP A;  3CLN A;  2LV7 A;  3DVJ A;  1XFU O;  1QLK A;  1K94 A;  2L5X B;  2NZ0 A;  2LHI A;  2OS8 C;  1GM0 A;  2LCP A;  3I5I C;  1DQE A;  1FBV A;  2M7L A;  5BPJ A;  1CTR A;  1J1E A;  3PFV A;  3SIA A;  3IVT A;  1GGW A;  4ICB A;  4OVN F;  2FCE A;  1LA0 A;  1TRF A;  1SMG A;  1NCY A;  3FWB A;  3OGN A;  2NCO A;  3KEV A;  1A4P A;  2K8M B;  3OB1 B;  2KNE A;  1NSH A;  4BY4 A;  2BNX A;  1TCF A;  5CSN A;  4XYN A;  3SIB A;  1CDP A;  2FJY A;  2KGR A;  1TCO B;  1KFU L;  1IKU A;  1XA5 A;  2JT0 A;  4JPZ B;  1KWO C;  1EXR A;  4FTG A;  2LE9 B;  2M97 A;  4E68 A;  1S26 D;  3TUY C;  1CMF A;  2KI6 C;  5AFP A;  2KI6 D;  3CZ0 A;  3K1E A;  2F3Z A;  3PN7 C;  1L2O B;  3AKA A;  1UUS A;  3WNX B;  3FE8 A;  1SR6 C;  4GGN A;  4YBH B;  4MVF A;  2F33 A;  2ISD A;  1UHK A;  2L4I A;  2ZND A;  3BUX B;  1TUZ A;  1DMO A;  4N5X A;  4YGE B;  5JOL A;  2FCD A;  3VRR A;  3SJS A;  5D3O A;  1DC1 A;  1OW4 A;  1PAL A;  1K8U A;  1QV1 A;  2VRG A;  1C07 A;  1WY9 A;  4WQ2 A;  2L4H A;  1NX3 A;  4I5K A;  1N2D A;  3BFA A;  4YI9 A;  1XFV O;  1B8R A;  1ZFS A;  4CFQ A;  1IWQ A;  1S5G Z;  3D0Y B;  3CZ2 A;  1CLL A;  1K9K A;  3EK4 A;  1MR8 A;  1YUR A;  1TIZ A;  3O6B A;  4F7F A;  2WND A;  4WQ3 A;  5FI6 A;  1KCY A;  2BBN A;  4IL1 A;  1PVA A;  5KSZ A;  2KSP A;  4PHN A;  2H61 A;  2WOR A;  3LK0 A;  3SG3 A;  1KQM B;  2I7A A;  1Y0V H;  3CWG A;  5HL1 A;  4MSP A;  2Y4Q A;  1ZOT B;  4HSZ A;  3CZ1 A;  2BE6 A;  5F6T A;  3BOW B;  1AJ5 A;  1LXF C;  1CFP A;  3NHT A;  3JVT C;  1SBJ A;  4OZD A;  3FE9 A;  4PHK A;  1CB1 A;  4NQG A;  5TNC A;  2HF5 A;  4PE0 A;  1J7O A;  1BR1 B;  3D77 A;  1WLZ A;  2JOJ A;  2O60 A;  1DEL A;  4OKH A;  1OOF A;  3KHE A;  1PRW A;  3O4Y A;  2Y5I A;  2LVJ A;  1K9P A;  1XK4 C;  3BFH A;  2K61 A;  1G33 A;  3EVU A;  1WDC B;  1Y1A A;  3DF0 B;  3BUO B;  4QJ5 B;  1AUI B;  1TNX A;  2P6B B;  4AOM A;  3CR2 A;  1CDN A;  3SS4 A;  2EGD A;  2ZRT A;  1QJT A;  2FOT A;  5DKN A;  2LMV A;  1DEK A;  1S6C A;  2NLN A;  2KFG A;  4M2P A;  1YRT B;  4N1F A;  3TDU A;  1KSO A;  3O78 A;  1F71 A;  3AKB A;  4M2Q A;  3FE6 A;  3PAT A;  3PAL A;  5CSI A;  2HQW A;  2KDH A;  1J7P A;  1J1D A;  1LS8 A;  2WC8 A;  2I2R E;  3PM2 A;  1PUL A;  2QEV A;  4PCW A;  4CFR A;  3AAK A;  1L2O C;  1SKT A;  1EH2 A;  3WHU B;  4OV2 A;  1NCZ A;  4DS7 A;  3EG5 B;  2MA2 A;  1OE9 B;  1F8H A;  1TNW A;  2QAC A;  3D78 A;  2K60 A;  2L51 A;  5JJG A;  1LIN A;  1QXP A;  1PK0 D;  3K21 A;  3D75 A;  1DJY A;  2SAS A;  2PMY A;  2NXQ A;  1OMR A;  2K7O A;  2LLT A;  3IQO A;  1BU3 A;  1NCX A;  5AER A;  1S6I A;  1EL4 A;  4GNK B;  1IJ6 A;  2LUX A;  2WCM A;  3O2P A;  1CDL A;  2LVI A;  2PAS A;  2NCP A;  5B8I B;  5I2L A;  3SG7 A;  2LM5 A;  3PJI A;  3HCM A;  4PE7 A;  4TNC A;  5KTY A;  1ZUZ A;  3PSR A;  2MRD A;  1QVI Y;  3BQ3 A;  1QAS A;  4IJ7 A;  4INW A;  4PHJ A;  2KI4 C;  1MXL C;  4MRY A;  1F54 A;  1YR5 A;  1WRK A;  3QME A;  5G08 A;  5CSF A;  1WRL A;  5I2O A;  1V1G A;  5HLO A;  1CM4 A;  1VRK A;  1KFX S;  2OPO A;  4XJK A;  3DVK A;  3TS5 C;  1YUU A;  1NYA A;  3ZNI A;  3WHT B;  1W9Z A;  1ZMZ A;  2AAO A;  3PLF B;  4A4B A;  1K2H A;  4KYN A;  2CT9 A;  2OTG C;  2BL0 C;  1QX2 A;  2LLU A;  1MUX A;  2L2C A;  1IIO A;  1JUO A;  1WDC C;  1C7W A;  1K9U A;  3JTD B;  3GK4 X;  3SG4 A;  2BCX A;  2JNX A;  4P5O E;  1OOI X;  1K95 A;  2R2I A;  1BOC A; 
#chains in the Genus database with same CATH homology
 1IRJ A;  1QAT A;  2BE4 A;  3VRO A;  1UUR A;  1RTP 1;  1XYD A;  1UP5 A;  5DKR A;  1RRO A;  1OSA A;  5KU1 A;  1S3P A;  4AQJ A;  1CLM A;  1PSR A;  1WLM A;  2M9G A;  3EKJ A;  2AMI A;  5HKZ A;  1A29 A;  2K7B A;  3EVR A;  2WCF A;  3AAJ A;  4PDZ A;  1YRU B;  1SY9 A;  1AHR A;  2JXC A;  3CR4 X;  1JF2 A;  4CID A;  4PAL A;  2ZKM X;  4QJ3 B;  1BT6 A;  4GBA A;  1Y1U A;  3RM1 A;  2WOS A;  1B9A A;  2F2O A;  3H4S E;  1M63 B;  1L7Z A;  3OB2 B;  3LL8 B;  1TOP A;  2CNP A;  2ZN8 A;  5I8N A;  5IBW A;  4YRU A;  1LA3 A;  2JUL A;  3QRX A;  3F45 A;  1DJI A;  1NUB A;  3EKH A;  2BCA A;  1YX7 A;  3I5G C;  2Y1M A;  1M39 A;  4ETO A;  1K90 D;  1B8C A;  3LK1 A;  3SG2 A;  2JXL A;  3NSL A;  1M46 A;  1JFK A;  1X02 A;  2JT3 A;  2COL B;  2M7N A;  3KPX A;  1MXE A;  1ZAC A;  1E8A A;  1IQ5 A;  3IF7 A;  2KOT A;  3CR5 X;  1LVC D;  1A03 A;  1NP8 A;  4CPV A;  5HKY A;  2BBM A;  3LCP C;  1QVI Z;  2B1U A;  2JWW A;  3I5F C;  2LC5 A;  4NDB A;  4HRH A;  2O5G A;  1EG3 A;  4ORA B;  5K89 A;  3WXA A;  2MLF C;  3SG6 A;  3M0W A;  3ICB A;  2CTN A;  4GUK A;  4QJ4 B;  2L98 A;  5D7F A;  1AK8 A;  4I5L B;  2Y1N A;  1J55 A;  3TDZ A;  2F8P A;  2KBI A;  3TDI A;  2KAX A;  4OR9 B;  2H61 C;  1EJ3 A;  1XK4 A;  1DJX A;  2WCE A;  5I2Q A;  3DD4 A;  1IJ5 A;  4I5J A;  4MLW A;  1K93 D;  3MSE B;  1CLB A;  1MQ1 A;  4XJK B;  5PAL A;  2M1K B;  2OS8 B;  4N1G A;  2JQ6 A;  1SL9 A;  2GGM A;  1NX1 A;  2JTZ A;  2K0J A;  1F4Q A;  2L50 A;  3C1V A;  1SL7 A;  2KAY A;  3JTD C;  3VRP A;  4C0K A;  1AP4 A;  3NSK A;  2LAP A;  1J7R A;  2KQY A;  2FJU B;  2LAN A;  1YUS A;  1FPW A;  2I18 A;  1KFU S;  3CS1 A;  2HET A;  2KFH A;  1KWO B;  4GPL B;  1RK9 A;  3HX4 A;  1CFF A;  3VRN A;  2LVK A;  3PN7 B;  1C7V A;  1AJ4 A;  2LMT A;  2MAZ A;  2GGZ A;  2KHN A;  1QX5 B;  2M8U A;  1G8I A;  1UHJ A;  1U5I A;  2WCB A;  2H2K A;  4DUQ A;  1V1F A;  1SNL A;  1HQV A;  1BMO A;  2A4J A;  1SCM B;  4YGD B;  2KBM A;  3DVM A;  2JNF A;  3CGA A;  2BEC A;  2MLE C;  4ORB B;  1B7T Y;  1R2U A;  1EG4 A;  1KQM C;  1H8B A;  2LNK A;  2LMU A;  4YGC B;  1CFD A;  1DF0 A;  1QLS A;  1A75 A;  2G9B A;  2E6W A;  1KK7 Y;  1KK8 B;  1SCV A;  1GGZ A;  1MHO A;  3IQQ A;  2L2E A;  5CSJ A;  2EHB A;  2CBL A;  2KAV A;  3OX6 A;  4UPG A;  3NSO A;  1NIW A;  1OZS A;  4DCK A;  3CTN A;  1SYM A;  1NWD A;  4GGF C;  2LP3 A;  2RGI A;  2M49 B;  2PAL A;  1QS7 A;  1IG5 A;  1XFZ O;  2Q4U A;  3RLZ A;  1IQ3 A;  4MN0 A;  2EC6 B;  5GQQ C;  2JU0 A;  5AXI A;  1B47 A;  1W7J B;  2M3W A;  1B4C A;  2TN4 A;  1UHH A;  4JWQ A;  1UWO A;  3NSI A;  4WRI A;  3A8R A;  1DJW A;  1TN4 A;  1YX8 A;  4MRX A;  4C0L A;  4BY5 A;  1B1G A;  1QV0 A;  1OQP A;  3SG5 A;  4CLN A;  1PSB A;  1BR4 B;  1UHI A;  2Q91 A;  1CMG A;  1SK6 D;  1DJG A;  1OZO A;  3BUN B;  4ZCV A;  1J7Q A;  1S6J A;  2D8N A;  2K7C A;  4M2O A;  4ORC B;  4PE1 A;  2BKI B;  1F70 A;  1XFX O;  2KYF A;  3FWC A;  2JZI A;  1ODB A;  2ZNE A;  1QTX A;  2IS9 A;  1FI5 A;  1CFC A;  1B8L A;  3BYA A;  1G4Y R;  1NPQ A;  1CKK A;  4R1E A;  1AVS A;  1M45 A;  2KGB C;  3E3R A;  4P2Y B;  1YUT A;  1FI6 A;  3I5H B;  4MZJ A;  2MBX A;  2K2F A;  1MWN A;  1QIV A;  1RFJ A;  1FF1 A;  5ER4 X;  1NX0 A;  2JTT A;  1S36 A;  1XO5 A;  3ZWH A;  2V53 A;  4U8D A;  3FS7 A;  1SPY A;  3KO0 A;  2K2A A;  1KQV A;  1CM1 A;  2MHH A;  1RWY A;  5DKQ A;  1JF0 A;  1SCM C;  4YI8 A;  2DOQ A;  2ZN9 A;  2BKH B;  1JWD A;  4YGA A;  1TNQ A;  1N0Y A;  1U5I B;  3BUM B;  3D10 A;  4JQ0 D;  5AEQ A;  3FIA A;  3GK1 A;  3TZ1 A;  4PE4 A;  4HRE E;  1QIW A;  2GV5 A;  1MF8 B;  2HPS A;  2JRF A;  1GQM A;  2F2P A;  3OX5 A;  2QPT A;  1GJY A;  1D1O A;  2PRU A;  1F55 A;  3EK8 A;  2PVB A;  1OOJ A;  4OCI A;  3KF9 A;  3EVV A;  3BUW B;  2L0P A;  2AUC A;  1B7T Z;  1KFX L;  2KI4 B;  1QX7 A;  5FYX A;  1KK8 C;  1XFW O;  2F3Y A;  1SW8 A;  2CCM A;  1DF0 B;  1KK7 Z;  4D1E A;  1A75 B;  1DGU A;  1TNP A;  4GFT A;  1BJF A;  3DVE A;  3TS5 B;  1YTZ C;  1H4B A;  3I5I B;  4L9M A;  2KQ6 A;  4YGB B;  1BF5 A;  2EC6 C;  1WRZ A;  1NX2 A;  1OMD A;  3VGO A;  3VRQ A;  4MZL A;  1S1E A;  1YVL A;  1DJH A;  4NDC A;  4DRW A;  2OTG B;  1TTX A;  2BL0 B;  5AAN A;  2JC2 A;  5CPV A;  3PM8 A;  3EK7 A;  1W7I B;  1DTL A;  1N65 A;  5ER5 A;  1CDM A;  1RJV A;  2PSR A;  4MZK A;  1JSA A;  2I94 A;  3TUY B;  2G2B A;  2M0R A;  4MBE A;  1K96 A;  1REC A;  4A4C A;  3OP0 A;  1JBA A;  1YVH A;  1UHN A;  1SR6 B;  1IGV A;  1XFY O;  3A4U B;  1IH0 A;  1SRA A;  2HQ8 A;  2LP2 A;  3LLE A;  1SL8 A;  1HT9 A;  1Y6W A;  4FQO A;  1ALV A;  1DT7 B;  1DJZ A;  2KYC A;  2KFF A;  2LUC A;  4MEW A;  1R6P A;  3I5H C;  1BG1 A;  5HKW A;  1Y1X A;  1F4O A;  2E30 A;  2JPT A;  4HRG A;  1CNP A;  3D0Y A;  4ZCU A;  1XVJ A;  2ZRS A;  1JFJ A;  4DIR A;  4F0Z B;  1S5G Y;  2LLS A;  3GOF A;  4C0J A;  4GAO A;  1A2X A;  1DGV A;  3NXA A;  4USL A;  5J3X A;  2BCB A;  3GK2 A;  1PVB A;  1KSM A;  2ZFD A;  1OMV A;  5HLV A;  4AQI A;  3BXK A;  3I5G B;  3BOW A;  1BLQ A;  2MJW B;  2M29 A;  3CZT X;  4PHM A;  1M31 A;  4NDD A;  4I5N B;  4Q04 A;  2CXJ A;  1FW4 A;  1JC2 A;  2K7D A;  3OHM B;  1DVI A;  3JVT B;  4GGF A;  5D69 A;  1Q80 A;  1BOD A;  3I5F B;  2M1U A;  1LKJ A;  3DF0 A;  5HYD A;  2LHL A;  1ALW A;  2LVV A;  2JT8 A;  2SCP A;  3CLN A;  2LV7 A;  3DVJ A;  1XFU O;  1QLK A;  1K94 A;  2L5X B;  2NZ0 A;  2LHI A;  2OS8 C;  2LCP A;  3I5I C;  1FBV A;  2M7L A;  5BPJ A;  1CTR A;  1J1E A;  3PFV A;  3SIA A;  1GGW A;  4ICB A;  4OVN F;  2FCE A;  1LA0 A;  1TRF A;  1SMG A;  1NCY A;  3FWB A;  2NCO A;  3KEV A;  1A4P A;  2K8M B;  3OB1 B;  2KNE A;  1NSH A;  4BY4 A;  1TCF A;  5CSN A;  4XYN A;  3SIB A;  1CDP A;  2KGR A;  1TCO B;  1KFU L;  1IKU A;  1XA5 A;  2JT0 A;  4JPZ B;  1KWO C;  1EXR A;  4FTG A;  2LE9 B;  2M97 A;  4E68 A;  1S26 D;  3TUY C;  1CMF A;  2KI6 C;  5AFP A;  2KI6 D;  3PN7 C;  2F3Z A;  1L2O B;  3AKA A;  1UUS A;  3WNX B;  1SR6 C;  4GGN A;  4YBH B;  4MVF A;  2F33 A;  2ISD A;  1UHK A;  2L4I A;  2ZND A;  3BUX B;  1DMO A;  4N5X A;  4YGE B;  5JOL A;  2FCD A;  3VRR A;  3SJS A;  1PAL A;  1K8U A;  1QV1 A;  2VRG A;  1C07 A;  1WY9 A;  4WQ2 A;  2L4H A;  1NX3 A;  4I5K A;  1N2D A;  4YI9 A;  1XFV O;  1B8R A;  1ZFS A;  4CFQ A;  1IWQ A;  1S5G Z;  3D0Y B;  1CLL A;  1K9K A;  3EK4 A;  1MR8 A;  1YUR A;  1TIZ A;  3O6B A;  2WND A;  4WQ3 A;  1KCY A;  2BBN A;  4IL1 A;  1PVA A;  5KSZ A;  2KSP A;  4PHN A;  2H61 A;  2WOR A;  3LK0 A;  3SG3 A;  1KQM B;  2I7A A;  1Y0V H;  3CWG A;  4MSP A;  2Y4Q A;  1ZOT B;  4HSZ A;  2BE6 A;  5F6T A;  3BOW B;  1AJ5 A;  1LXF C;  1CFP A;  3JVT C;  1SBJ A;  4PHK A;  1CB1 A;  4NQG A;  5TNC A;  2HF5 A;  4PE0 A;  1J7O A;  1BR1 B;  1WLZ A;  2JOJ A;  2O60 A;  4OKH A;  3KHE A;  1PRW A;  3O4Y A;  2Y5I A;  2LVJ A;  1K9P A;  1XK4 C;  3PAT A;  2K61 A;  1G33 A;  3EVU A;  1WDC B;  1Y1A A;  3DF0 B;  3BUO B;  4QJ5 B;  1AUI B;  1TNX A;  2P6B B;  4AOM A;  3CR2 A;  1CDN A;  2EGD A;  2ZRT A;  1QJT A;  2FOT A;  5DKN A;  2LMV A;  1S6C A;  2NLN A;  2KFG A;  4M2P A;  1YRT B;  4N1F A;  3TDU A;  1KSO A;  3O78 A;  1F71 A;  3AKB A;  4M2Q A;  3PAL A;  5CSI A;  2HQW A;  2KDH A;  1J7P A;  1J1D A;  2WC8 A;  2I2R E;  4PCW A;  1PUL A;  4CFR A;  3AAK A;  1L2O C;  1SKT A;  1EH2 A;  3WHU B;  4OV2 A;  1NCZ A;  4DS7 A;  1F8H A;  2MA2 A;  1OE9 B;  1TNW A;  2QAC A;  2L51 A;  5JJG A;  1LIN A;  1QXP A;  1PK0 D;  3K21 A;  1DJY A;  2SAS A;  2PMY A;  2NXQ A;  1OMR A;  2K7O A;  2LLT A;  3IQO A;  1BU3 A;  1NCX A;  5AER A;  1S6I A;  1EL4 A;  4GNK B;  1IJ6 A;  2LUX A;  3O2P A;  1CDL A;  2LVI A;  2PAS A;  2NCP A;  5B8I B;  5I2L A;  3SG7 A;  2LM5 A;  5KTY A;  3HCM A;  4PE7 A;  4TNC A;  1ZUZ A;  3PSR A;  2MRD A;  1QVI Y;  3BQ3 A;  1QAS A;  4PHJ A;  2KI4 C;  1MXL C;  4MRY A;  1F54 A;  1YR5 A;  1WRK A;  5G08 A;  5CSF A;  1WRL A;  5I2O A;  1V1G A;  5HLO A;  1CM4 A;  1VRK A;  1KFX S;  2OPO A;  4XJK A;  3DVK A;  3TS5 C;  1YUU A;  1NYA A;  3ZNI A;  3WHT B;  4A4B A;  1ZMZ A;  2AAO A;  3PLF B;  1K2H A;  2CT9 A;  2OTG C;  2BL0 C;  1QX2 A;  2LLU A;  1MUX A;  1JUO A;  1WDC C;  1C7W A;  1K9U A;  3JTD B;  3GK4 X;  3SG4 A;  2BCX A;  2JNX A;  4P5O E;  1K95 A;  2R2I A;  1BOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...