1F8HA

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1f8hA00
3TZ1A 4GGFA 3EKHA 4M2QA 1JSAA 2I94A 1CDPA 1ZOTB 2LVVA 2AUCA 5CSJA 1JUOA 1DJGA 4PHKA 5KU1A 1B9AA 3IF7A 5D69A 2M1UA 2BL0C 1YVHA 3EKJA 3VRQA 5ER5A 4NQGA 2BECA 1DGVA 1ALWA 2M7NA 2LVIA 3AKBA 1BT6A 2NCPA 3D10A 1JF2A 1CDNA 1CFFA 1TNPA 4YI8A 2WNDA 1AJ5A 2JNXA 4U8DA 1A03A 4R1EA 1QX2A 1UHKA 2LV7A 5ER4X 2HPSA 1CDLA 1BMOA 2ZFDA 3CR2A 3PN7B 1A29A 3TDIA 1DF0B 3JVTC 1JWDA 2I18A 1PULA 4P5OE 2Y1NA 2MLFC 1J1DA 5G08A 2BBMA 5CSFA 1KQMC 4PE4A 1MHOA 1NWDA 1NX0A 2Y1MA 1QX5B 2BCXA 2K7OA 1OZSA 2CT9A 1B7TY 1AP4A 1C7VA 3DVKA 2BL0B 3VRRA 5I8NA 2KFHA 2KI4C 2LC5A 1J55A 5HKZA 3BOWB 1SMGA 1MUXA 1YR5A 5I2LA 2LMTA 4JWQA 1GJYA 4DIRA 5AANA 1H8BA 1F71A 4CLNA 4MBEA 4MLWA 2R2IA 3I5HB 1JBAA 3TS5C 2M9GA 1SYMA 1UHNA 2AMIA 2KBMA 4GGFC 1NCZA 2KDHA 4XJKA 1M39A 2MA2A 5K89A 1DF0A 4PHMA 2KGBC 4AQIA 3LL8B 3SG6A 3JVTB 2G2BA 4GNKB 4OV2A 1U5IA 4P2YB 4NDCA 4OCIA 2ZN9A 2JT3A 1N2DA 1NCYA 1KFXS 1CLLA 2QACA 1BOCA 1IJ6A 3IQOA 1J7QA 1DMOA 2BCBA 4GPLB 3EVRA 3GK2A 1MXLC 2WCEA 3DF0B 1F70A 1Y6WA 1J1EA 1QLSA 1TIZA 2L4IA 3LCPC 1J7RA 1K9KA 1ZMZA 1OE9B 4HSZA 1XFZO 1IWQA 1KSMA 5HYDA 1UUSA 1CNPA 3NXAA 4QJ3B 3BUXB 2KQYA 3GK1A 1KWOB 2KAYA 1AHRA 1S5GY 1HQVA 1KK7Z 1S6IA 1M45A 4I5NB 3OB1B 4FQOA 1PSBA 2PVBA 2O60A 3I5GB 2LLUA 3TDUA 1EH2A 3QRXA 1R2UA 3CZTX 1TCOB 1LA3A 3EVUA 1BR1B 2F2PA 1TNQA 2K2AA 2CNPA 1TTXA 5CPVA 4TNCA 2L2EA 4NDBA 2BKHB 2LANA 4PE7A 2K7DA 4YBHB 2M1KB 2EGDA 1F8HA 1FF1A 1AJ4A 3SG5A 1XK4A 4ORCB 3OX5A 4PE1A 1YX7A 2NZ0A 1XVJA 1MQ1A 3HX4A 2JTZA 5I2OA 1CKKA 1UP5A 3EK8A 4E68A 1RJVA 1SNLA 3KO0A 1V1GA 2L5XB 3PN7C 1SL7A 1CLMA 4GBAA 3FS7A 4C0KA 4AOMA 1DJWA 1DJZA 2MRDA 3ZWHA 3SG7A 2M97A 4PALA 1TOPA 3NSOA 3BQ3A 2CCMA 2MJWB 4DCKA 2JU0A 1KK8B 3A4UB 2LNKA 4MVFA 1LXFC 2MLEC 5PALA 3A8RA 3BYAA 3SG4A 1G33A 2EC6B 4QJ5B 3DD4A 4FTGA 2B1UA 1BODA 1SCVA 2K0JA 2LP3A 2EHBA 1M31A 1SK6D 1XFUO 4MZLA 1QVIZ 3I5HC 4CPVA 2ZRSA 3K21A 1B7TZ 2A4JA 1DJHA 3H4SE 2P6BB 4Q04A 2ZN8A 4XJKB 1NX3A 1XFYO 1XFWO 2MAZA 3FWCA 1JFJA 1B8RA 1BR4B 5CSNA 2LLTA 1S26D 1U5IB 1VRKA 3CGAA 2HQ8A 2ZNEA 1LVCD 2GGZA 4MEWA 1QIWA 2JZIA 2K2FA 2F3YA 2JXCA 2M0RA 3VGOA 1Q80A 3SIBA 4PDZA 2BBNA 3GOFA 1KCYA 3O78A 2LM5A 1CFDA 2FJUB 4N5XA 2LAPA 4OKHA 1XK4C 2L98A 3F45A 2V53A 1YUTA 2LMUA 2LVJA 1MWNA 2LCPA 5DKRA 5GQQC 4XYNA 3AAKA 1EG4A 1F55A 1KWOC 1S36A 2JWWA 1IGVA 1NX1A 1OSAA 4ZCUA 1RTP1 2HF5A 3I5GC 1BU3A 1UURA 2F33A 3O6BA 3O4YA 4YRUA 4GAOA 2COLB 1K8UA 1RROA 2F2OA 1H4BA 3CLNA 2JT8A 1UWOA 4UPGA 2ZNDA 1CFPA 2LHIA 5J3XA 2FCDA 2F8PA 2IS9A 2GGMA 3KF9A 1KFXL 2KFGA 2OS8C 2GV5A 3D0YA 3FWBA 2SCPA 2MHHA 2PASA 2VRGA 1KQVA 1B47A 1CB1A 1PSRA 4WQ2A 1D1OA 1LINA 2KGRA 1M46A 4MRXA 2KYCA 3SG2A 1SBJA 4MRYA 1Y1UA 1R6PA 2Y4QA 1TNWA 2H61A 4N1GA 1A75A 5DKNA 1NPQA 4C0LA 2K8MB 5AERA 1C7WA 2WOSA 3PATA 1ALVA 2JPTA 2K7BA 3ICBA 2HETA 1OMVA 3AAJA 2OTGC 1J7PA 2M29A 3EK7A 2LLSA 2JTTA 2JRFA 4MSPA 1RK9A 1EL4A 1K9UA 3DVMA 5HKWA 4PCWA 1K9PA 2BE4A 1FI5A 2KSPA 2E30A 3M0WA 1PRWA 4OR9B 1W7JB 2NXQA 3NSLA 1KK8C 2KQ6A 1QTXA 5CSIA 5FYXA 2K61A 4L9MA 1TCFA 3BUMB 2JC2A 1IKUA 4YGBB 2OS8B 2LE9B 2EC6C 1JC2A 3I5IB 3BUOB 1XFXO 4DS7A 1PALA 3HCMA 1RECA 2BKIB 1OMRA 1NCXA 2Q91A 1SPYA 1WRLA 4ORAB 1N65A 1WLZA 4YGEB 5HKYA 1CFCA 1XA5A 1PVAA 3OHMB 1MF8B 4HRGA 5JOLA 1PVBA 1WLMA 1QASA 2HQWA 3MSEB 4JQ0D 2NLNA 1KFUS 2I2RE 1EXRA 1UHHA 3EVVA 2F3ZA 3SG3A 2PALA 2OTGB 2D8NA 1M63B 2TN4A 1IH0A 2LUXA 1UHIA 4NDDA 3OB2B 1YVLA 5AXIA 1L2OC 1YRUB 3I5FC 1DJXA 1FW4A 1F54A 3LLEA 2MBXA 1K2HA 1KK7Y 1QATA 1NIWA 2I7AA 1B8CA 2JOJA 2KI6C 1K94A 1QIVA 2K7CA 1DTLA 3WHUB 5I2QA 1QS7A 1BJFA 1NUBA 1QV0A 3CR5X 4PHNA 2H61C 3TUYC 4CFRA 2KOTA 3PLFB 2PSRA 1BG1A 4AQJA 4M2OA 1S6JA 1ZUZA 1DJYA 1OMDA 1A4PA 2AAOA 4PHJA 4HREE 1CDMA 4GFTA 1JF0A 1YX8A 2L50A 4USLA 1Y0VH 3KPXA 4I5LB 4QJ4B 1IQ3A 2L0PA 2WORA 1G8IA 3E3RA 2ZRTA 1B4CA 5HLVA 1SW8A 1SKTA 2ISDA 1XYDA 1V1FA 1BF5A 4BY5A 1YTZC 1XO5A 2M8UA 3WHTB 1F4QA 3CWGA 2H2KA 3DVEA 2DOQA 1L2OB 1NX2A 1TRFA 3D0YB 2M7LA 1SCMC 3I5FB 1KSOA 1SL8A 1L7ZA 4JPZB 1K93D 4N1FA 2JXLA 2KAVA 2NCOA 4D1EA 1HT9A 3O2PA 3CR4X 1J7OA 2QPTA 5KTYA 2KNEA 2WC8A 4MZKA 1K95A 1PK0D 2G9BA 2PRUA 4CFQA 3CTNA 2WCBA 2FOTA 2CBLA 2WCFA 3TUYB 1A75B 2E6WA 1FBVA 2KI6D 4PE0A 1WY9A 1A2XA 4GUKA 1FI6A 2CTNA 2KFFA 4I5JA 2JQ6A 1YUUA 3PALA 2CXJA 1GGZA 1NYAA 2LMVA 3BUWB 4C0JA 1QJTA 2FCEA 1CLBA 3TDZA 4CIDA 1NP8A 1QVIY 3EK4A 1DGUA 4OVNF 1CM4A 1W7IB 2Y5IA 1E8AA 1S5GZ 3FIAA 3RLZA 2LP2A 2LVKA 1WRKA 2OPOA 3I5IC 1QX7A 1SL9A 1C07A 1IJ5A 1N0YA 1SCMB 2L4HA 1DJIA 1B8LA 1RWYA 2BCAA 5IBWA 3KEVA 2KBIA 1WDCC 3NSIA 3PM8A 2LUCA 1OOJA 1DVIA 2PMYA 3GK4X 3AKAA 4ETOA 4F0ZB 4M2PA 4ORBB 3LK1A 5F6TA 1X02A 1QV1A 3JTDC 2O5GA 1SR6C 2Q4UA 4DUQA 3ZNIA 2KYFA 5JJGA 2JT0A 3RM1A 4MZJA 3SIAA 2M49B 1ZFSA 1IQ5A 4IL1A 1KQMB 1K90D 1TN4A 1K96A 1S1EA 1SY9A 1AVSA 1BLQA 2BE6A 5AEQA 5DKQA 3VRNA 3PFVA 3WNXB 4I5KA 1DT7B 2JNFA 4YGDB 3BOWA 5HLOA 1Y1XA 1RFJA 2KI4B 4A4CA 3VRPA 3SJSA 1YRTB 3DVJA 2SASA 5KSZA 1NSHA 1CMFA 1JFKA 1LKJA 1LA0A 5D7FA 1OZOA 1CMGA 2L51A 1WDCB 4WRIA 2KAXA 2ZKMX 1UHJA 4GGNA 3TS5B 2LHLA 4A4BA 4YI9A 3VROA 3KHEA 1KFUL 1FPWA 1MXEA 1QXPA 2JULA 3OX6A 3JTDB 1B1GA 1SR6B 3WXAA 1XFVO 1EG3A 4DRWA 4HRHA 3IQQA 1IG5A 1QLKA 4ZCVA 1AUIB 1MR8A 1EJ3A 3OP0A 1Y1AA 1CTRA 5BPJA 4BY4A 3NSKA 1WRZA 1TNXA 3CS1A 3DF0A 1AK8A 1GQMA 2M3WA 2RGIA 3PSRA 4WQ3A 1S6CA 4YGAA 1F4OA 1ZACA 1S3PA 3LK0A 4YGCB 1ODBA 1SRAA 4ICBA 4MN0A 3BXKA 1GGWA 1G4YR 1CM1A 1YUSA 5B8IB 1YURA 5TNCA 1OQPA 3BUNB 1IRJA 2KHNA 5AFPA 3C1VA
chains in the Genus database with same CATH superfamily
3TZ1A 4PT1A 4GGFA 3EKHA 4M2QA 1JSAA 2I94A 1CDPA 1ZOTB 2LVVA 2AUCA 3BFAA 5CSJA 1JUOA 1DJGA 4PHKA 5KU1A 1B9AA 3IF7A 5D69A 3K1EA 2M1UA 2BL0C 1YVHA 3EKJA 1DQEA 3VRQA 5ER5A 4NQGA 2BECA 1DGVA 1ALWA 2M7NA 2LVIA 3AKBA 1BT6A 2NCPA 1TUZA 3D10A 1JF2A 1CDNA 3D74A 1TNPA 4YI8A 1CFFA 2WNDA 1AJ5A 2JNXA 4U8DA 1A03A 4R1EA 1P28A 1QX2A 2WC5A 1UHKA 2LV7A 5ER4X 2HPSA 1CDLA 3S0AA 1BMOA 2ZFDA 3CR2A 3PN7B 1A29A 3TDIA 1DF0B 3JVTC 1LS8A 1JWDA 2I18A 1PULA 4P5OE 2Y1NA 2MLFC 1SSEB 3SS4A 1J1DA 5G08A 2BBMA 5CSFA 3FE6A 1KQMC 4PE4A 1MHOA 1NWDA 1NX0A 2Y1MA 1QX5B 2BCXA 2WCJA 2K7OA 1OZSA 2CT9A 1B7TY 1AP4A 1C7VA 3DVKA 2BL0B 2WCHA 3VRRA 5I8NA 2KFHA 1OOHA 2KI4C 2LC5A 1J55A 5HKZA 3BOWB 1SMGA 1MUXA 1YR5A 5I2LA 2LMTA 3D77A 1W9ZA 4JWQA 1GJYA 4DIRA 5AANA 1H8BA 1F71A 4CLNA 4MBEA 4MLWA 2R2IA 3I5HB 1JBAA 3TS5C 2M9GA 1SYMA 1UHNA 1OW4A 2AMIA 2KBMA 4GGFC 1NCZA 2KDHA 4XJKA 1M39A 2MA2A 3CZ0A 5K89A 1DF0A 4PHMA 2KGBC 4AQIA 3LL8B 3SG6A 3JVTB 2G2BA 4GNKB 3D76A 4OV2A 1U5IA 4P2YB 4NDCA 4OCIA 2ZN9A 2JT3A 1N2DA 1NCYA 1KFXS 1CLLA 2QACA 1BOCA 1IJ6A 3IQOA 1J7QA 1DMOA 2BCBA 4GPLB 3EVRA 3GK2A 3DXLA 1MXLC 2WCEA 3DF0B 1F70A 1Y6WA 1J1EA 1QLSA 1TIZA 2L4IA 3LCPC 3Q8IA 3SS3A 1J7RA 1K9KA 1ZMZA 1OE9B 2P71A 4HSZA 1XFZO 5FI2A 1IWQA 1KSMA 5HYDA 1UUSA 1CNPA 3NXAA 4QJ3B 3BUXB 2KQYA 3GK1A 1KWOB 2KAYA 1AHRA 1S5GY 1HQVA 1KK7Z 1S6IA 1M45A 4I5NB 2KLDA 3OB1B 4FQOA 1PSBA 2PVBA 2O60A 3I5GB 2LLUA 3DYEA 3TDUA 3QRXA 1EH2A 1OOGA 1R2UA 3CZTX 1TCOB 2BAPA 1LA3A 3EVUA 1BR1B 2F2PA 1TNQA 1C3YA 2K2AA 2CNPA 1TTXA 5CPVA 4TNCA 4ZCUA 2L2EA 2QEVA 4NDBA 2BKHB 2LANA 4PE7A 2K7DA 4YBHB 2M1KB 2EGDA 1F8HA 1FF1A 1AJ4A 1DEKA 3SG5A 1XK4A 4ORCB 4INWA 3S0GA 3OX5A 4PE1A 1YX7A 2NZ0A 3S0EA 1XVJA 1MQ1A 3HX4A 2JTZA 5I2OA 1Z4HA 1CKKA 1UP5A 3EK8A 4E68A 1RJVA 1SNLA 3KO0A 1V1GA 2L5XB 3PN7C 1SL7A 1CLMA 4GBAA 3FS7A 4C0KA 4AOMA 1DJWA 1DJZA 2MRDA 3ZWHA 3SG7A 2M97A 4PALA 1TOPA 3NSOA 3BQ3A 2CCMA 2MJWB 4DCKA 2JU0A 1KK8B 3A4UB 2LNKA 4MVFA 1LXFC 2MLEC 5PALA 3A8RA 3BYAA 3NHTA 1G33A 3SG4A 2EC6B 4QJ5B 5FI7A 3DD4A 4FTGA 2B1UA 1BODA 1SCVA 2WCKA 2K0JA 2LP3A 2EHBA 1M31A 1SK6D 1XFUO 4MZLA 1QVIZ 3I5HC 4CPVA 2ZRSA 3K21A 3UNWA 1B7TZ 2A4JA 2WCLA 1DJHA 3H4SE 2P6BB 4Q04A 2ZN8A 4XJKB 1NX3A 1XFYO 1XFWO 2MAZA 3FWCA 1JFJA 1B8RA 3NHIA 1BR4B 5CSNA 3BFBA 3S0DA 2LLTA 1VRKA 1U5IB 1S26D 3CGAA 2HQ8A 2ZNEA 3BJHA 1LVCD 2GGZA 4MEWA 1QIWA 2JZIA 2K2FA 2F3YA 2JXCA 2M0RA 3VGOA 1Q80A 2K60A 2L5YA 3L4AA 3SIBA 4PDZA 2BBNA 1IIOA 3GOFA 1KCYA 3O78A 2LM5A 1CFDA 4OZDA 2FJUB 4N5XA 2LAPA 3FE8A 4OKHA 1XK4C 2L98A 3F45A 2V53A 1YUTA 2LMUA 3DY9A 2LVJA 1MWNA 2LCPA 5DKRA 5GQQC 4XYNA 3AAKA 2WCMA 1EG4A 1F55A 1KWOC 1S36A 2JWWA 1IGVA 1NX1A 1OSAA 2WC6A 1RTP1 2HF5A 3I5GC 1BU3A 1UURA 2F33A 3O6BA 3O4YA 4YRUA 4GAOA 2COLB 1K8UA 1RROA 2F2OA 3OGNA 1H4BA 1Z2CB 3CLNA 2JT8A 1UWOA 4UPGA 2ZNDA 1T14A 1CFPA 3UO9A 2LHIA 5J3XA 2FCDA 2F8PA 2IS9A 2GGMA 3KF9A 1KFXL 2KFGA 2L2CA 2OS8C 2GV5A 3D0YA 3FWBA 2SCPA 2MHHA 2PASA 2VRGA 3B88A 1KQVA 3B7AA 1B47A 3VB1A 1CB1A 3PM2A 3B86A 1PSRA 4WQ2A 3RZSA 1D1OA 1LINA 2KGRA 2ERBA 1M46A 4MRXA 2KYCA 3SG2A 1SBJA 4MRYA 3R1OA 1Y1UA 3BFHA 1R6PA 2Y4QA 1TNWA 2H61A 4N1GA 1A75A 1TWOA 5DKNA 1NPQA 4C0LA 2K8MB 5AERA 3R1PA 1C7WA 2WOSA 3PATA 3N7HA 1ALVA 2JPTA 2K7BA 3ICBA 2HETA 1OMVA 3AAJA 2OTGC 1J7PA 2M29A 3EK7A 2LLSA 2JTTA 2JRFA 4MSPA 1RK9A 1EL4A 1K9UA 3DVMA 3L47A 5HKWA 4PCWA 1K9PA 2BE4A 1FI5A 2KSPA 2E30A 3M0WA 1PRWA 4OR9B 1W7JB 2NXQA 3NSLA 1KK8C 2KQ6A 1QTXA 5CSIA 5FYXA 2K61A 4L9MA 1TCFA 3BUMB 2JC2A 1IKUA 4YGBB 2OS8B 2LE9B 2EC6C 1JC2A 3I5IB 3BUOB 1XFXO 4DS7A 3EG5B 1PALA 3FE9A 1RECA 2BKIB 3HCMA 1OMRA 1NCXA 2Q91A 1SPYA 1WRLA 4ORAB 1N65A 1WLZA 4YGEB 5HKYA 3D73A 1CFCA 1XA5A 1PVAA 3OHMB 4IJ7A 1MF8B 2H8VA 4HRGA 1PVBA 1WLMA 1QASA 2HQWA 5JOLA 3MSEB 4JQ0D 2NLNA 1KFUS 2I2RE 1EXRA 1UHHA 3EVVA 2F3ZA 3PJIA 2YGUA 3SG3A 2PALA 5DICA 3L4LA 2OTGB 3B87A 2D8NA 1M63B 2QEHA 2TN4A 1IH0A 2LUXA 1UHIA 4NDDA 3OB2B 1YVLA 5AXIA 1L2OC 3V2LA 1YRUB 3I5FC 1DJXA 1FW4A 1F54A 3LLEA 2MBXA 1K2HA 1KK7Y 1QATA 1NIWA 2I7AA 1B8CA 2JOJA 2KI6C 1K94A 1ORGA 1QIVA 2K7CA 1DTLA 3WHUB 5I2QA 1QS7A 1BJFA 1NUBA 1QV0A 3CR5X 5HL1A 4PHNA 2H61C 3TUYC 3IVTA 3R72A 4CFRA 2KOTA 3PLFB 2PSRA 1BG1A 4AQJA 3CDNA 4M2OA 1S6JA 1ZUZA 1DJYA 1OMDA 1A4PA 1TUJA 2AAOA 4HREE 4JKTA 4PHJA 3CZ1A 1CDMA 4GFTA 1JF0A 1YX8A 2L50A 4USLA 1Y0VH 3KPXA 4I5LB 4QJ4B 1IQ3A 2L0PA 2WORA 1G8IA 3CYZA 3E3RA 2ZRTA 4JD9A 1B4CA 5HLVA 1SW8A 1SKTA 5EL2A 1XYDA 1V1FA 2ISDA 1BF5A 4BY5A 1YTZC 1XO5A 2M8UA 3WHTB 1F4QA 3CWGA 3B6XA 2H2KA 3DVEA 2DOQA 1L2OB 1NX2A 1TRFA 3D0YB 2M7LA 1SCMC 3I5FB 3SS5A 1KSOA 1SL8A 1L7ZA 4JPZB 1K93D 4N1FA 2JXLA 2KAVA 2NCOA 4D1EA 1HT9A 3O2PA 3CR4X 1DC1A 2QPTA 5KTYA 2KNEA 2WC8A 4MZKA 1J7OA 1K95A 1PK0D 2G9BA 2PRUA 2KPHA 3CTNA 4CFQA 2WCBA 2FOTA 2CBLA 2WCFA 3TUYB 1A75B 3D78A 2E6WA 1FBVA 2KI6D 4PE0A 1WY9A 1A2XA 4GUKA 1FI6A 2CTNA 2KFFA 3O4XA 4I5JA 4KYNA 2JQ6A 1YUUA 3PALA 2CXJA 1GGZA 1NYAA 2LMVA 3BUWB 4C0JA 1QJTA 2FCEA 1CLBA 3S0FA 3TDZA 2GTEA 4CIDA 1NP8A 1QVIY 3EK4A 1DGUA 4OVNF 1CM4A 1W7IB 2Y5IA 1E8AA 1S5GZ 3FIAA 3NGVA 3RLZA 2LP2A 2LVKA 1WRKA 2OPOA 3I5IC 1OOFA 1QX7A 1SL9A 1C07A 1IJ5A 1N0YA 1SCMB 2L4HA 1DJIA 1B8LA 1RWYA 2BCAA 5IBWA 2JPOA 3KEVA 2KBIA 1WDCC 3NSIA 3PM8A 2LUCA 1OOJA 1DVIA 2PMYA 3GK4X 3AKAA 4ETOA 5D3OA 4F0ZB 4M2PA 4ORBB 3LK1A 5F6TA 3S0BA 2QDIA 2FJYA 1X02A 1QV1A 3JTDC 2O5GA 1SR6C 2Q4UA 4DUQA 1OOIX 3ZNIA 2KYFA 2QEOA 5JJGA 2JT0A 3RM1A 2QEBA 4MZJA 3SIAA 2M49B 1ZFSA 1IQ5A 4IL1A 5I94A 1KQMB 1K90D 1TN4A 1K96A 1S1EA 1SY9A 1QWVA 2KLEA 1AVSA 1BLQA 2BE6A 5AEQA 5DKQA 2P70A 3VRNA 3OBVA 3PFVA 3WNXB 4I5KA 1DT7B 2JNFA 4YGDB 3BOWA 1DELA 5HLOA 1Y1XA 1RFJA 2KI4B 4A4CA 3VRPA 3SJSA 1YRTB 3DVJA 2SASA 5KSZA 1NSHA 1CMFA 1JFKA 1LKJA 3CZ2A 1LA0A 5D7FA 1OZOA 1CMGA 2L51A 1WDCB 1XFRA 2BNXA 4WRIA 2KAXA 2ZKMX 1UHJA 4GGNA 3TS5B 3DZTA 2LHLA 4A4BA 4YI9A 4FQTA 3VROA 3KHEA 1KFUL 1FPWA 1MXEA 1QXPA 2JULA 5FI6A 3OX6A 3JTDB 4INXA 1B1GA 1SR6B 3WXAA 1XFVO 1EG3A 4DRWA 3D75A 4HRHA 3IQQA 1IG5A 3CABA 1QLKA 4ZCVA 1AUIB 1MR8A 1EJ3A 3OP0A 1Y1AA 1CTRA 5BPJA 3R1VA 4BY4A 3NSKA 1WRZA 1TNXA 3CS1A 3DF0A 1C3ZA 1AK8A 1GQMA 2M3WA 2RGIA 3PSRA 2PQLA 4WQ3A 1S6CA 4YGAA 1F4OA 1ZACA 2PYQA 1S3PA 3LK0A 4YGCB 1ODBA 1SRAA 4ICBA 4MN0A 3BXKA 1GGWA 1G4YR 3QMEA 1CM1A 1GM0A 1YUSA 5B8IB 1YURA 5TNCA 1OQPA 3BUNB 1IRJA 2KHNA 5AFPA 4F7FA 3C1VA
chains in the Genus database with same CATH topology
3TZ1A 4GGFA 3EKHA 4M2QA 1JSAA 2I94A 1CDPA 1ZOTB 2LVVA 2AUCA 5CSJA 1JUOA 1DJGA 4PHKA 5KU1A 1B9AA 3IF7A 5D69A 2M1UA 2BL0C 1YVHA 3EKJA 3VRQA 5ER5A 4NQGA 2BECA 1DGVA 1ALWA 2M7NA 2LVIA 3AKBA 1BT6A 2NCPA 3D10A 1JF2A 1CDNA 1CFFA 1TNPA 4YI8A 2WNDA 1AJ5A 2JNXA 4U8DA 1A03A 4R1EA 1QX2A 1UHKA 2LV7A 5ER4X 2HPSA 1CDLA 1BMOA 2ZFDA 3CR2A 3PN7B 1A29A 3TDIA 1DF0B 3JVTC 1JWDA 2I18A 1PULA 4P5OE 2Y1NA 2MLFC 1J1DA 5G08A 2BBMA 5CSFA 1KQMC 4PE4A 1MHOA 1NWDA 1NX0A 2Y1MA 1QX5B 2BCXA 2K7OA 1OZSA 2CT9A 1B7TY 1AP4A 1C7VA 3DVKA 2BL0B 3VRRA 5I8NA 2KFHA 2KI4C 2LC5A 1J55A 5HKZA 3BOWB 1SMGA 1MUXA 1YR5A 5I2LA 2LMTA 4JWQA 1GJYA 4DIRA 5AANA 1H8BA 1F71A 4CLNA 4MBEA 4MLWA 2R2IA 3I5HB 1JBAA 3TS5C 2M9GA 1SYMA 1UHNA 2AMIA 2KBMA 4GGFC 1NCZA 2KDHA 4XJKA 1M39A 2MA2A 5K89A 1DF0A 4PHMA 2KGBC 4AQIA 3LL8B 3SG6A 3JVTB 2G2BA 4GNKB 4OV2A 1U5IA 4P2YB 4NDCA 4OCIA 2ZN9A 2JT3A 1N2DA 1NCYA 1KFXS 1CLLA 2QACA 1BOCA 1IJ6A 3IQOA 1J7QA 1DMOA 2BCBA 4GPLB 3EVRA 3GK2A 1MXLC 2WCEA 3DF0B 1F70A 1Y6WA 1J1EA 1QLSA 1TIZA 2L4IA 3LCPC 1J7RA 1K9KA 1ZMZA 1OE9B 4HSZA 1XFZO 1IWQA 1KSMA 5HYDA 1UUSA 1CNPA 3NXAA 4QJ3B 3BUXB 2KQYA 3GK1A 1KWOB 2KAYA 1AHRA 1S5GY 1HQVA 1KK7Z 1S6IA 1M45A 4I5NB 3OB1B 4FQOA 1PSBA 2PVBA 2O60A 3I5GB 2LLUA 3TDUA 1EH2A 3QRXA 1R2UA 3CZTX 1TCOB 1LA3A 3EVUA 1BR1B 2F2PA 1TNQA 2K2AA 2CNPA 1TTXA 5CPVA 4TNCA 2L2EA 4NDBA 2BKHB 2LANA 4PE7A 2K7DA 4YBHB 2M1KB 2EGDA 1F8HA 1FF1A 1AJ4A 3SG5A 1XK4A 4ORCB 3OX5A 4PE1A 1YX7A 2NZ0A 1XVJA 1MQ1A 3HX4A 2JTZA 5I2OA 1CKKA 1UP5A 3EK8A 4E68A 1RJVA 1SNLA 3KO0A 1V1GA 2L5XB 3PN7C 1SL7A 1CLMA 4GBAA 3FS7A 4C0KA 4AOMA 1DJWA 1DJZA 2MRDA 3ZWHA 3SG7A 2M97A 4PALA 1TOPA 3NSOA 3BQ3A 2CCMA 2MJWB 4DCKA 2JU0A 1KK8B 3A4UB 2LNKA 4MVFA 1LXFC 2MLEC 5PALA 3A8RA 3BYAA 3SG4A 1G33A 2EC6B 4QJ5B 3DD4A 4FTGA 2B1UA 1BODA 1SCVA 2K0JA 2LP3A 2EHBA 1M31A 1SK6D 1XFUO 4MZLA 1QVIZ 3I5HC 4CPVA 2ZRSA 3K21A 1B7TZ 2A4JA 1DJHA 3H4SE 2P6BB 4Q04A 2ZN8A 4XJKB 1NX3A 1XFYO 1XFWO 2MAZA 3FWCA 1JFJA 1B8RA 1BR4B 5CSNA 2LLTA 1S26D 1U5IB 1VRKA 3CGAA 2HQ8A 2ZNEA 1LVCD 2GGZA 4MEWA 1QIWA 2JZIA 2K2FA 2F3YA 2JXCA 2M0RA 3VGOA 1Q80A 3SIBA 4PDZA 2BBNA 3GOFA 1KCYA 3O78A 2LM5A 1CFDA 2FJUB 4N5XA 2LAPA 4OKHA 1XK4C 2L98A 3F45A 2V53A 1YUTA 2LMUA 2LVJA 1MWNA 2LCPA 5DKRA 5GQQC 4XYNA 3AAKA 1EG4A 1F55A 1KWOC 1S36A 2JWWA 1IGVA 1NX1A 1OSAA 4ZCUA 1RTP1 2HF5A 3I5GC 1BU3A 1UURA 2F33A 3O6BA 3O4YA 4YRUA 4GAOA 2COLB 1K8UA 1RROA 2F2OA 1H4BA 3CLNA 2JT8A 1UWOA 4UPGA 2ZNDA 1CFPA 2LHIA 5J3XA 2FCDA 2F8PA 2IS9A 2GGMA 3KF9A 1KFXL 2KFGA 2OS8C 2GV5A 3D0YA 3FWBA 2SCPA 2MHHA 2PASA 2VRGA 1KQVA 1B47A 1CB1A 1PSRA 4WQ2A 1D1OA 1LINA 2KGRA 1M46A 4MRXA 2KYCA 3SG2A 1SBJA 4MRYA 1Y1UA 1R6PA 2Y4QA 1TNWA 2H61A 4N1GA 1A75A 5DKNA 1NPQA 4C0LA 2K8MB 5AERA 1C7WA 2WOSA 3PATA 1ALVA 2JPTA 2K7BA 3ICBA 2HETA 1OMVA 3AAJA 2OTGC 1J7PA 2M29A 3EK7A 2LLSA 2JTTA 2JRFA 4MSPA 1RK9A 1EL4A 1K9UA 3DVMA 5HKWA 4PCWA 1K9PA 2BE4A 1FI5A 2KSPA 2E30A 3M0WA 1PRWA 4OR9B 1W7JB 2NXQA 3NSLA 1KK8C 2KQ6A 1QTXA 5CSIA 5FYXA 2K61A 4L9MA 1TCFA 3BUMB 2JC2A 1IKUA 4YGBB 2OS8B 2LE9B 2EC6C 1JC2A 3I5IB 3BUOB 1XFXO 4DS7A 1PALA 3HCMA 1RECA 2BKIB 1OMRA 1NCXA 2Q91A 1SPYA 1WRLA 4ORAB 1N65A 1WLZA 4YGEB 5HKYA 1CFCA 1XA5A 1PVAA 3OHMB 1MF8B 4HRGA 5JOLA 1PVBA 1WLMA 1QASA 2HQWA 3MSEB 4JQ0D 2NLNA 1KFUS 2I2RE 1EXRA 1UHHA 3EVVA 2F3ZA 3SG3A 2PALA 2OTGB 2D8NA 1M63B 2TN4A 1IH0A 2LUXA 1UHIA 4NDDA 3OB2B 1YVLA 5AXIA 1L2OC 1YRUB 3I5FC 1DJXA 1FW4A 1F54A 3LLEA 2MBXA 1K2HA 1KK7Y 1QATA 1NIWA 2I7AA 1B8CA 2JOJA 2KI6C 1K94A 1QIVA 2K7CA 1DTLA 3WHUB 5I2QA 1QS7A 1BJFA 1NUBA 1QV0A 3CR5X 4PHNA 2H61C 3TUYC 4CFRA 2KOTA 3PLFB 2PSRA 1BG1A 4AQJA 4M2OA 1S6JA 1ZUZA 1DJYA 1OMDA 1A4PA 2AAOA 4PHJA 4HREE 1CDMA 4GFTA 1JF0A 1YX8A 2L50A 4USLA 1Y0VH 3KPXA 4I5LB 4QJ4B 1IQ3A 2L0PA 2WORA 1G8IA 3E3RA 2ZRTA 1B4CA 5HLVA 1SW8A 1SKTA 2ISDA 1XYDA 1V1FA 1BF5A 4BY5A 1YTZC 1XO5A 2M8UA 3WHTB 1F4QA 3CWGA 2H2KA 3DVEA 2DOQA 1L2OB 1NX2A 1TRFA 3D0YB 2M7LA 1SCMC 3I5FB 1KSOA 1SL8A 1L7ZA 4JPZB 1K93D 4N1FA 2JXLA 2KAVA 2NCOA 4D1EA 1HT9A 3O2PA 3CR4X 1J7OA 2QPTA 5KTYA 2KNEA 2WC8A 4MZKA 1K95A 1PK0D 2G9BA 2PRUA 4CFQA 3CTNA 2WCBA 2FOTA 2CBLA 2WCFA 3TUYB 1A75B 2E6WA 1FBVA 2KI6D 4PE0A 1WY9A 1A2XA 4GUKA 1FI6A 2CTNA 2KFFA 4I5JA 2JQ6A 1YUUA 3PALA 2CXJA 1GGZA 1NYAA 2LMVA 3BUWB 4C0JA 1QJTA 2FCEA 1CLBA 3TDZA 4CIDA 1NP8A 1QVIY 3EK4A 1DGUA 4OVNF 1CM4A 1W7IB 2Y5IA 1E8AA 1S5GZ 3FIAA 3RLZA 2LP2A 2LVKA 1WRKA 2OPOA 3I5IC 1QX7A 1SL9A 1C07A 1IJ5A 1N0YA 1SCMB 2L4HA 1DJIA 1B8LA 1RWYA 2BCAA 5IBWA 3KEVA 2KBIA 1WDCC 3NSIA 3PM8A 2LUCA 1OOJA 1DVIA 2PMYA 3GK4X 3AKAA 4ETOA 4F0ZB 4M2PA 4ORBB 3LK1A 5F6TA 1X02A 1QV1A 3JTDC 2O5GA 1SR6C 2Q4UA 4DUQA 3ZNIA 2KYFA 5JJGA 2JT0A 3RM1A 4MZJA 3SIAA 2M49B 1ZFSA 1IQ5A 4IL1A 1KQMB 1K90D 1TN4A 1K96A 1S1EA 1SY9A 1AVSA 1BLQA 2BE6A 5AEQA 5DKQA 3VRNA 3PFVA 3WNXB 4I5KA 1DT7B 2JNFA 4YGDB 3BOWA 5HLOA 1Y1XA 1RFJA 2KI4B 4A4CA 3VRPA 3SJSA 1YRTB 3DVJA 2SASA 5KSZA 1NSHA 1CMFA 1JFKA 1LKJA 1LA0A 5D7FA 1OZOA 1CMGA 2L51A 1WDCB 4WRIA 2KAXA 2ZKMX 1UHJA 4GGNA 3TS5B 2LHLA 4A4BA 4YI9A 3VROA 3KHEA 1KFUL 1FPWA 1MXEA 1QXPA 2JULA 3OX6A 3JTDB 1B1GA 1SR6B 3WXAA 1XFVO 1EG3A 4DRWA 4HRHA 3IQQA 1IG5A 1QLKA 4ZCVA 1AUIB 1MR8A 1EJ3A 3OP0A 1Y1AA 1CTRA 5BPJA 4BY4A 3NSKA 1WRZA 1TNXA 3CS1A 3DF0A 1AK8A 1GQMA 2M3WA 2RGIA 3PSRA 4WQ3A 1S6CA 4YGAA 1F4OA 1ZACA 1S3PA 3LK0A 4YGCB 1ODBA 1SRAA 4ICBA 4MN0A 3BXKA 1GGWA 1G4YR 1CM1A 1YUSA 5B8IB 1YURA 5TNCA 1OQPA 3BUNB 1IRJA 2KHNA 5AFPA 3C1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZ1 A;  4GGF A;  3EKH A;  4M2Q A;  1JSA A;  2I94 A;  1CDP A;  1ZOT B;  2LVV A;  2AUC A;  5CSJ A;  1JUO A;  1DJG A;  4PHK A;  5KU1 A;  1B9A A;  3IF7 A;  5D69 A;  2M1U A;  2BL0 C;  1YVH A;  3EKJ A;  3VRQ A;  5ER5 A;  4NQG A;  2BEC A;  1DGV A;  1ALW A;  2M7N A;  2LVI A;  3AKB A;  1BT6 A;  2NCP A;  3D10 A;  1JF2 A;  1CDN A;  1CFF A;  1TNP A;  4YI8 A;  2WND A;  1AJ5 A;  2JNX A;  4U8D A;  1A03 A;  4R1E A;  1QX2 A;  1UHK A;  2LV7 A;  5ER4 X;  2HPS A;  1CDL A;  1BMO A;  2ZFD A;  3CR2 A;  3PN7 B;  1A29 A;  3TDI A;  1DF0 B;  3JVT C;  1JWD A;  2I18 A;  1PUL A;  4P5O E;  2Y1N A;  2MLF C;  1J1D A;  5G08 A;  2BBM A;  5CSF A;  1KQM C;  4PE4 A;  1MHO A;  1NWD A;  1NX0 A;  2Y1M A;  1QX5 B;  2BCX A;  2K7O A;  1OZS A;  2CT9 A;  1B7T Y;  1AP4 A;  1C7V A;  3DVK A;  2BL0 B;  3VRR A;  5I8N A;  2KFH A;  2KI4 C;  2LC5 A;  1J55 A;  5HKZ A;  3BOW B;  1SMG A;  1MUX A;  1YR5 A;  5I2L A;  2LMT A;  4JWQ A;  1GJY A;  4DIR A;  5AAN A;  1H8B A;  1F71 A;  4CLN A;  4MBE A;  4MLW A;  2R2I A;  3I5H B;  1JBA A;  3TS5 C;  2M9G A;  1SYM A;  1UHN A;  2AMI A;  2KBM A;  4GGF C;  1NCZ A;  2KDH A;  4XJK A;  1M39 A;  2MA2 A;  5K89 A;  1DF0 A;  4PHM A;  2KGB C;  4AQI A;  3LL8 B;  3SG6 A;  3JVT B;  2G2B A;  4GNK B;  4OV2 A;  1U5I A;  4P2Y B;  4NDC A;  4OCI A;  2ZN9 A;  2JT3 A;  1N2D A;  1NCY A;  1KFX S;  1CLL A;  2QAC A;  1BOC A;  1IJ6 A;  3IQO A;  1J7Q A;  1DMO A;  2BCB A;  4GPL B;  3EVR A;  3GK2 A;  1MXL C;  2WCE A;  3DF0 B;  1F70 A;  1Y6W A;  1J1E A;  1QLS A;  1TIZ A;  2L4I A;  3LCP C;  1J7R A;  1K9K A;  1ZMZ A;  1OE9 B;  4HSZ A;  1XFZ O;  1IWQ A;  1KSM A;  5HYD A;  1UUS A;  1CNP A;  3NXA A;  4QJ3 B;  3BUX B;  2KQY A;  3GK1 A;  1KWO B;  2KAY A;  1AHR A;  1S5G Y;  1HQV A;  1KK7 Z;  1S6I A;  1M45 A;  4I5N B;  3OB1 B;  4FQO A;  1PSB A;  2PVB A;  2O60 A;  3I5G B;  2LLU A;  3TDU A;  1EH2 A;  3QRX A;  1R2U A;  3CZT X;  1TCO B;  1LA3 A;  3EVU A;  1BR1 B;  2F2P A;  1TNQ A;  2K2A A;  2CNP A;  1TTX A;  5CPV A;  4TNC A;  2L2E A;  4NDB A;  2BKH B;  2LAN A;  4PE7 A;  2K7D A;  4YBH B;  2M1K B;  2EGD A;  1F8H A;  1FF1 A;  1AJ4 A;  3SG5 A;  1XK4 A;  4ORC B;  3OX5 A;  4PE1 A;  1YX7 A;  2NZ0 A;  1XVJ A;  1MQ1 A;  3HX4 A;  2JTZ A;  5I2O A;  1CKK A;  1UP5 A;  3EK8 A;  4E68 A;  1RJV A;  1SNL A;  3KO0 A;  1V1G A;  2L5X B;  3PN7 C;  1SL7 A;  1CLM A;  4GBA A;  3FS7 A;  4C0K A;  4AOM A;  1DJW A;  1DJZ A;  2MRD A;  3ZWH A;  3SG7 A;  2M97 A;  4PAL A;  1TOP A;  3NSO A;  3BQ3 A;  2CCM A;  2MJW B;  4DCK A;  2JU0 A;  1KK8 B;  3A4U B;  2LNK A;  4MVF A;  1LXF C;  2MLE C;  5PAL A;  3A8R A;  3BYA A;  3SG4 A;  1G33 A;  2EC6 B;  4QJ5 B;  3DD4 A;  4FTG A;  2B1U A;  1BOD A;  1SCV A;  2K0J A;  2LP3 A;  2EHB A;  1M31 A;  1SK6 D;  1XFU O;  4MZL A;  1QVI Z;  3I5H C;  4CPV A;  2ZRS A;  3K21 A;  1B7T Z;  2A4J A;  1DJH A;  3H4S E;  2P6B B;  4Q04 A;  2ZN8 A;  4XJK B;  1NX3 A;  1XFY O;  1XFW O;  2MAZ A;  3FWC A;  1JFJ A;  1B8R A;  1BR4 B;  5CSN A;  2LLT A;  1S26 D;  1U5I B;  1VRK A;  3CGA A;  2HQ8 A;  2ZNE A;  1LVC D;  2GGZ A;  4MEW A;  1QIW A;  2JZI A;  2K2F A;  2F3Y A;  2JXC A;  2M0R A;  3VGO A;  1Q80 A;  3SIB A;  4PDZ A;  2BBN A;  3GOF A;  1KCY A;  3O78 A;  2LM5 A;  1CFD A;  2FJU B;  4N5X A;  2LAP A;  4OKH A;  1XK4 C;  2L98 A;  3F45 A;  2V53 A;  1YUT A;  2LMU A;  2LVJ A;  1MWN A;  2LCP A;  5DKR A;  5GQQ C;  4XYN A;  3AAK A;  1EG4 A;  1F55 A;  1KWO C;  1S36 A;  2JWW A;  1IGV A;  1NX1 A;  1OSA A;  4ZCU A;  1RTP 1;  2HF5 A;  3I5G C;  1BU3 A;  1UUR A;  2F33 A;  3O6B A;  3O4Y A;  4YRU A;  4GAO A;  2COL B;  1K8U A;  1RRO A;  2F2O A;  1H4B A;  3CLN A;  2JT8 A;  1UWO A;  4UPG A;  2ZND A;  1CFP A;  2LHI A;  5J3X A;  2FCD A;  2F8P A;  2IS9 A;  2GGM A;  3KF9 A;  1KFX L;  2KFG A;  2OS8 C;  2GV5 A;  3D0Y A;  3FWB A;  2SCP A;  2MHH A;  2PAS A;  2VRG A;  1KQV A;  1B47 A;  1CB1 A;  1PSR A;  4WQ2 A;  1D1O A;  1LIN A;  2KGR A;  1M46 A;  4MRX A;  2KYC A;  3SG2 A;  1SBJ A;  4MRY A;  1Y1U A;  1R6P A;  2Y4Q A;  1TNW A;  2H61 A;  4N1G A;  1A75 A;  5DKN A;  1NPQ A;  4C0L A;  2K8M B;  5AER A;  1C7W A;  2WOS A;  3PAT A;  1ALV A;  2JPT A;  2K7B A;  3ICB A;  2HET A;  1OMV A;  3AAJ A;  2OTG C;  1J7P A;  2M29 A;  3EK7 A;  2LLS A;  2JTT A;  2JRF A;  4MSP A;  1RK9 A;  1EL4 A;  1K9U A;  3DVM A;  5HKW A;  4PCW A;  1K9P A;  2BE4 A;  1FI5 A;  2KSP A;  2E30 A;  3M0W A;  1PRW A;  4OR9 B;  1W7J B;  2NXQ A;  3NSL A;  1KK8 C;  2KQ6 A;  1QTX A;  5CSI A;  5FYX A;  2K61 A;  4L9M A;  1TCF A;  3BUM B;  2JC2 A;  1IKU A;  4YGB B;  2OS8 B;  2LE9 B;  2EC6 C;  1JC2 A;  3I5I B;  3BUO B;  1XFX O;  4DS7 A;  1PAL A;  3HCM A;  1REC A;  2BKI B;  1OMR A;  1NCX A;  2Q91 A;  1SPY A;  1WRL A;  4ORA B;  1N65 A;  1WLZ A;  4YGE B;  5HKY A;  1CFC A;  1XA5 A;  1PVA A;  3OHM B;  1MF8 B;  4HRG A;  5JOL A;  1PVB A;  1WLM A;  1QAS A;  2HQW A;  3MSE B;  4JQ0 D;  2NLN A;  1KFU S;  2I2R E;  1EXR A;  1UHH A;  3EVV A;  2F3Z A;  3SG3 A;  2PAL A;  2OTG B;  2D8N A;  1M63 B;  2TN4 A;  1IH0 A;  2LUX A;  1UHI A;  4NDD A;  3OB2 B;  1YVL A;  5AXI A;  1L2O C;  1YRU B;  3I5F C;  1DJX A;  1FW4 A;  1F54 A;  3LLE A;  2MBX A;  1K2H A;  1KK7 Y;  1QAT A;  1NIW A;  2I7A A;  1B8C A;  2JOJ A;  2KI6 C;  1K94 A;  1QIV A;  2K7C A;  1DTL A;  3WHU B;  5I2Q A;  1QS7 A;  1BJF A;  1NUB A;  1QV0 A;  3CR5 X;  4PHN A;  2H61 C;  3TUY C;  4CFR A;  2KOT A;  3PLF B;  2PSR A;  1BG1 A;  4AQJ A;  4M2O A;  1S6J A;  1ZUZ A;  1DJY A;  1OMD A;  1A4P A;  2AAO A;  4PHJ A;  4HRE E;  1CDM A;  4GFT A;  1JF0 A;  1YX8 A;  2L50 A;  4USL A;  1Y0V H;  3KPX A;  4I5L B;  4QJ4 B;  1IQ3 A;  2L0P A;  2WOR A;  1G8I A;  3E3R A;  2ZRT A;  1B4C A;  5HLV A;  1SW8 A;  1SKT A;  2ISD A;  1XYD A;  1V1F A;  1BF5 A;  4BY5 A;  1YTZ C;  1XO5 A;  2M8U A;  3WHT B;  1F4Q A;  3CWG A;  2H2K A;  3DVE A;  2DOQ A;  1L2O B;  1NX2 A;  1TRF A;  3D0Y B;  2M7L A;  1SCM C;  3I5F B;  1KSO A;  1SL8 A;  1L7Z A;  4JPZ B;  1K93 D;  4N1F A;  2JXL A;  2KAV A;  2NCO A;  4D1E A;  1HT9 A;  3O2P A;  3CR4 X;  1J7O A;  2QPT A;  5KTY A;  2KNE A;  2WC8 A;  4MZK A;  1K95 A;  1PK0 D;  2G9B A;  2PRU A;  4CFQ A;  3CTN A;  2WCB A;  2FOT A;  2CBL A;  2WCF A;  3TUY B;  1A75 B;  2E6W A;  1FBV A;  2KI6 D;  4PE0 A;  1WY9 A;  1A2X A;  4GUK A;  1FI6 A;  2CTN A;  2KFF A;  4I5J A;  2JQ6 A;  1YUU A;  3PAL A;  2CXJ A;  1GGZ A;  1NYA A;  2LMV A;  3BUW B;  4C0J A;  1QJT A;  2FCE A;  1CLB A;  3TDZ A;  4CID A;  1NP8 A;  1QVI Y;  3EK4 A;  1DGU A;  4OVN F;  1CM4 A;  1W7I B;  2Y5I A;  1E8A A;  1S5G Z;  3FIA A;  3RLZ A;  2LP2 A;  2LVK A;  1WRK A;  2OPO A;  3I5I C;  1QX7 A;  1SL9 A;  1C07 A;  1IJ5 A;  1N0Y A;  1SCM B;  2L4H A;  1DJI A;  1B8L A;  1RWY A;  2BCA A;  5IBW A;  3KEV A;  2KBI A;  1WDC C;  3NSI A;  3PM8 A;  2LUC A;  1OOJ A;  1DVI A;  2PMY A;  3GK4 X;  3AKA A;  4ETO A;  4F0Z B;  4M2P A;  4ORB B;  3LK1 A;  5F6T A;  1X02 A;  1QV1 A;  3JTD C;  2O5G A;  1SR6 C;  2Q4U A;  4DUQ A;  3ZNI A;  2KYF A;  5JJG A;  2JT0 A;  3RM1 A;  4MZJ A;  3SIA A;  2M49 B;  1ZFS A;  1IQ5 A;  4IL1 A;  1KQM B;  1K90 D;  1TN4 A;  1K96 A;  1S1E A;  1SY9 A;  1AVS A;  1BLQ A;  2BE6 A;  5AEQ A;  5DKQ A;  3VRN A;  3PFV A;  3WNX B;  4I5K A;  1DT7 B;  2JNF A;  4YGD B;  3BOW A;  5HLO A;  1Y1X A;  1RFJ A;  2KI4 B;  4A4C A;  3VRP A;  3SJS A;  1YRT B;  3DVJ A;  2SAS A;  5KSZ A;  1NSH A;  1CMF A;  1JFK A;  1LKJ A;  1LA0 A;  5D7F A;  1OZO A;  1CMG A;  2L51 A;  1WDC B;  4WRI A;  2KAX A;  2ZKM X;  1UHJ A;  4GGN A;  3TS5 B;  2LHL A;  4A4B A;  4YI9 A;  3VRO A;  3KHE A;  1KFU L;  1FPW A;  1MXE A;  1QXP A;  2JUL A;  3OX6 A;  3JTD B;  1B1G A;  1SR6 B;  3WXA A;  1XFV O;  1EG3 A;  4DRW A;  4HRH A;  3IQQ A;  1IG5 A;  1QLK A;  4ZCV A;  1AUI B;  1MR8 A;  1EJ3 A;  3OP0 A;  1Y1A A;  1CTR A;  5BPJ A;  4BY4 A;  3NSK A;  1WRZ A;  1TNX A;  3CS1 A;  3DF0 A;  1AK8 A;  1GQM A;  2M3W A;  2RGI A;  3PSR A;  4WQ3 A;  1S6C A;  4YGA A;  1F4O A;  1ZAC A;  1S3P A;  3LK0 A;  4YGC B;  1ODB A;  1SRA A;  4ICB A;  4MN0 A;  3BXK A;  1GGW A;  1G4Y R;  1CM1 A;  1YUS A;  5B8I B;  1YUR A;  5TNC A;  1OQP A;  3BUN B;  1IRJ A;  2KHN A;  5AFP A;  3C1V A; 
#chains in the Genus database with same CATH topology
 3TZ1 A;  4PT1 A;  4GGF A;  3EKH A;  4M2Q A;  1JSA A;  2I94 A;  1CDP A;  1ZOT B;  2LVV A;  2AUC A;  3BFA A;  5CSJ A;  1JUO A;  1DJG A;  4PHK A;  5KU1 A;  1B9A A;  3IF7 A;  5D69 A;  3K1E A;  2M1U A;  2BL0 C;  1YVH A;  3EKJ A;  1DQE A;  3VRQ A;  5ER5 A;  4NQG A;  2BEC A;  1DGV A;  1ALW A;  2M7N A;  2LVI A;  3AKB A;  1BT6 A;  2NCP A;  1TUZ A;  3D10 A;  1JF2 A;  1CDN A;  3D74 A;  1TNP A;  4YI8 A;  1CFF A;  2WND A;  1AJ5 A;  2JNX A;  4U8D A;  1A03 A;  4R1E A;  1P28 A;  1QX2 A;  2WC5 A;  1UHK A;  2LV7 A;  5ER4 X;  2HPS A;  1CDL A;  3S0A A;  1BMO A;  2ZFD A;  3CR2 A;  3PN7 B;  1A29 A;  3TDI A;  1DF0 B;  3JVT C;  1LS8 A;  1JWD A;  2I18 A;  1PUL A;  4P5O E;  2Y1N A;  2MLF C;  1SSE B;  3SS4 A;  1J1D A;  5G08 A;  2BBM A;  5CSF A;  3FE6 A;  1KQM C;  4PE4 A;  1MHO A;  1NWD A;  1NX0 A;  2Y1M A;  1QX5 B;  2BCX A;  2WCJ A;  2K7O A;  1OZS A;  2CT9 A;  1B7T Y;  1AP4 A;  1C7V A;  3DVK A;  2BL0 B;  2WCH A;  3VRR A;  5I8N A;  2KFH A;  1OOH A;  2KI4 C;  2LC5 A;  1J55 A;  5HKZ A;  3BOW B;  1SMG A;  1MUX A;  1YR5 A;  5I2L A;  2LMT A;  3D77 A;  1W9Z A;  4JWQ A;  1GJY A;  4DIR A;  5AAN A;  1H8B A;  1F71 A;  4CLN A;  4MBE A;  4MLW A;  2R2I A;  3I5H B;  1JBA A;  3TS5 C;  2M9G A;  1SYM A;  1UHN A;  1OW4 A;  2AMI A;  2KBM A;  4GGF C;  1NCZ A;  2KDH A;  4XJK A;  1M39 A;  2MA2 A;  3CZ0 A;  5K89 A;  1DF0 A;  4PHM A;  2KGB C;  4AQI A;  3LL8 B;  3SG6 A;  3JVT B;  2G2B A;  4GNK B;  3D76 A;  4OV2 A;  1U5I A;  4P2Y B;  4NDC A;  4OCI A;  2ZN9 A;  2JT3 A;  1N2D A;  1NCY A;  1KFX S;  1CLL A;  2QAC A;  1BOC A;  1IJ6 A;  3IQO A;  1J7Q A;  1DMO A;  2BCB A;  4GPL B;  3EVR A;  3GK2 A;  3DXL A;  1MXL C;  2WCE A;  3DF0 B;  1F70 A;  1Y6W A;  1J1E A;  1QLS A;  1TIZ A;  2L4I A;  3LCP C;  3Q8I A;  3SS3 A;  1J7R A;  1K9K A;  1ZMZ A;  1OE9 B;  2P71 A;  4HSZ A;  1XFZ O;  5FI2 A;  1IWQ A;  1KSM A;  5HYD A;  1UUS A;  1CNP A;  3NXA A;  4QJ3 B;  3BUX B;  2KQY A;  3GK1 A;  1KWO B;  2KAY A;  1AHR A;  1S5G Y;  1HQV A;  1KK7 Z;  1S6I A;  1M45 A;  4I5N B;  2KLD A;  3OB1 B;  4FQO A;  1PSB A;  2PVB A;  2O60 A;  3I5G B;  2LLU A;  3DYE A;  3TDU A;  3QRX A;  1EH2 A;  1OOG A;  1R2U A;  3CZT X;  1TCO B;  2BAP A;  1LA3 A;  3EVU A;  1BR1 B;  2F2P A;  1TNQ A;  1C3Y A;  2K2A A;  2CNP A;  1TTX A;  5CPV A;  4TNC A;  4ZCU A;  2L2E A;  2QEV A;  4NDB A;  2BKH B;  2LAN A;  4PE7 A;  2K7D A;  4YBH B;  2M1K B;  2EGD A;  1F8H A;  1FF1 A;  1AJ4 A;  1DEK A;  3SG5 A;  1XK4 A;  4ORC B;  4INW A;  3S0G A;  3OX5 A;  4PE1 A;  1YX7 A;  2NZ0 A;  3S0E A;  1XVJ A;  1MQ1 A;  3HX4 A;  2JTZ A;  5I2O A;  1Z4H A;  1CKK A;  1UP5 A;  3EK8 A;  4E68 A;  1RJV A;  1SNL A;  3KO0 A;  1V1G A;  2L5X B;  3PN7 C;  1SL7 A;  1CLM A;  4GBA A;  3FS7 A;  4C0K A;  4AOM A;  1DJW A;  1DJZ A;  2MRD A;  3ZWH A;  3SG7 A;  2M97 A;  4PAL A;  1TOP A;  3NSO A;  3BQ3 A;  2CCM A;  2MJW B;  4DCK A;  2JU0 A;  1KK8 B;  3A4U B;  2LNK A;  4MVF A;  1LXF C;  2MLE C;  5PAL A;  3A8R A;  3BYA A;  3NHT A;  1G33 A;  3SG4 A;  2EC6 B;  4QJ5 B;  5FI7 A;  3DD4 A;  4FTG A;  2B1U A;  1BOD A;  1SCV A;  2WCK A;  2K0J A;  2LP3 A;  2EHB A;  1M31 A;  1SK6 D;  1XFU O;  4MZL A;  1QVI Z;  3I5H C;  4CPV A;  2ZRS A;  3K21 A;  3UNW A;  1B7T Z;  2A4J A;  2WCL A;  1DJH A;  3H4S E;  2P6B B;  4Q04 A;  2ZN8 A;  4XJK B;  1NX3 A;  1XFY O;  1XFW O;  2MAZ A;  3FWC A;  1JFJ A;  1B8R A;  3NHI A;  1BR4 B;  5CSN A;  3BFB A;  3S0D A;  2LLT A;  1VRK A;  1U5I B;  1S26 D;  3CGA A;  2HQ8 A;  2ZNE A;  3BJH A;  1LVC D;  2GGZ A;  4MEW A;  1QIW A;  2JZI A;  2K2F A;  2F3Y A;  2JXC A;  2M0R A;  3VGO A;  1Q80 A;  2K60 A;  2L5Y A;  3L4A A;  3SIB A;  4PDZ A;  2BBN A;  1IIO A;  3GOF A;  1KCY A;  3O78 A;  2LM5 A;  1CFD A;  4OZD A;  2FJU B;  4N5X A;  2LAP A;  3FE8 A;  4OKH A;  1XK4 C;  2L98 A;  3F45 A;  2V53 A;  1YUT A;  2LMU A;  3DY9 A;  2LVJ A;  1MWN A;  2LCP A;  5DKR A;  5GQQ C;  4XYN A;  3AAK A;  2WCM A;  1EG4 A;  1F55 A;  1KWO C;  1S36 A;  2JWW A;  1IGV A;  1NX1 A;  1OSA A;  2WC6 A;  1RTP 1;  2HF5 A;  3I5G C;  1BU3 A;  1UUR A;  2F33 A;  3O6B A;  3O4Y A;  4YRU A;  4GAO A;  2COL B;  1K8U A;  1RRO A;  2F2O A;  3OGN A;  1H4B A;  1Z2C B;  3CLN A;  2JT8 A;  1UWO A;  4UPG A;  2ZND A;  1T14 A;  1CFP A;  3UO9 A;  2LHI A;  5J3X A;  2FCD A;  2F8P A;  2IS9 A;  2GGM A;  3KF9 A;  1KFX L;  2KFG A;  2L2C A;  2OS8 C;  2GV5 A;  3D0Y A;  3FWB A;  2SCP A;  2MHH A;  2PAS A;  2VRG A;  3B88 A;  1KQV A;  3B7A A;  1B47 A;  3VB1 A;  1CB1 A;  3PM2 A;  3B86 A;  1PSR A;  4WQ2 A;  3RZS A;  1D1O A;  1LIN A;  2KGR A;  2ERB A;  1M46 A;  4MRX A;  2KYC A;  3SG2 A;  1SBJ A;  4MRY A;  3R1O A;  1Y1U A;  3BFH A;  1R6P A;  2Y4Q A;  1TNW A;  2H61 A;  4N1G A;  1A75 A;  1TWO A;  5DKN A;  1NPQ A;  4C0L A;  2K8M B;  5AER A;  3R1P A;  1C7W A;  2WOS A;  3PAT A;  3N7H A;  1ALV A;  2JPT A;  2K7B A;  3ICB A;  2HET A;  1OMV A;  3AAJ A;  2OTG C;  1J7P A;  2M29 A;  3EK7 A;  2LLS A;  2JTT A;  2JRF A;  4MSP A;  1RK9 A;  1EL4 A;  1K9U A;  3DVM A;  3L47 A;  5HKW A;  4PCW A;  1K9P A;  2BE4 A;  1FI5 A;  2KSP A;  2E30 A;  3M0W A;  1PRW A;  4OR9 B;  1W7J B;  2NXQ A;  3NSL A;  1KK8 C;  2KQ6 A;  1QTX A;  5CSI A;  5FYX A;  2K61 A;  4L9M A;  1TCF A;  3BUM B;  2JC2 A;  1IKU A;  4YGB B;  2OS8 B;  2LE9 B;  2EC6 C;  1JC2 A;  3I5I B;  3BUO B;  1XFX O;  4DS7 A;  3EG5 B;  1PAL A;  3FE9 A;  1REC A;  2BKI B;  3HCM A;  1OMR A;  1NCX A;  2Q91 A;  1SPY A;  1WRL A;  4ORA B;  1N65 A;  1WLZ A;  4YGE B;  5HKY A;  3D73 A;  1CFC A;  1XA5 A;  1PVA A;  3OHM B;  4IJ7 A;  1MF8 B;  2H8V A;  4HRG A;  1PVB A;  1WLM A;  1QAS A;  2HQW A;  5JOL A;  3MSE B;  4JQ0 D;  2NLN A;  1KFU S;  2I2R E;  1EXR A;  1UHH A;  3EVV A;  2F3Z A;  3PJI A;  2YGU A;  3SG3 A;  2PAL A;  5DIC A;  3L4L A;  2OTG B;  3B87 A;  2D8N A;  1M63 B;  2QEH A;  2TN4 A;  1IH0 A;  2LUX A;  1UHI A;  4NDD A;  3OB2 B;  1YVL A;  5AXI A;  1L2O C;  3V2L A;  1YRU B;  3I5F C;  1DJX A;  1FW4 A;  1F54 A;  3LLE A;  2MBX A;  1K2H A;  1KK7 Y;  1QAT A;  1NIW A;  2I7A A;  1B8C A;  2JOJ A;  2KI6 C;  1K94 A;  1ORG A;  1QIV A;  2K7C A;  1DTL A;  3WHU B;  5I2Q A;  1QS7 A;  1BJF A;  1NUB A;  1QV0 A;  3CR5 X;  5HL1 A;  4PHN A;  2H61 C;  3TUY C;  3IVT A;  3R72 A;  4CFR A;  2KOT A;  3PLF B;  2PSR A;  1BG1 A;  4AQJ A;  3CDN A;  4M2O A;  1S6J A;  1ZUZ A;  1DJY A;  1OMD A;  1A4P A;  1TUJ A;  2AAO A;  4HRE E;  4JKT A;  4PHJ A;  3CZ1 A;  1CDM A;  4GFT A;  1JF0 A;  1YX8 A;  2L50 A;  4USL A;  1Y0V H;  3KPX A;  4I5L B;  4QJ4 B;  1IQ3 A;  2L0P A;  2WOR A;  1G8I A;  3CYZ A;  3E3R A;  2ZRT A;  4JD9 A;  1B4C A;  5HLV A;  1SW8 A;  1SKT A;  5EL2 A;  1XYD A;  1V1F A;  2ISD A;  1BF5 A;  4BY5 A;  1YTZ C;  1XO5 A;  2M8U A;  3WHT B;  1F4Q A;  3CWG A;  3B6X A;  2H2K A;  3DVE A;  2DOQ A;  1L2O B;  1NX2 A;  1TRF A;  3D0Y B;  2M7L A;  1SCM C;  3I5F B;  3SS5 A;  1KSO A;  1SL8 A;  1L7Z A;  4JPZ B;  1K93 D;  4N1F A;  2JXL A;  2KAV A;  2NCO A;  4D1E A;  1HT9 A;  3O2P A;  3CR4 X;  1DC1 A;  2QPT A;  5KTY A;  2KNE A;  2WC8 A;  4MZK A;  1J7O A;  1K95 A;  1PK0 D;  2G9B A;  2PRU A;  2KPH A;  3CTN A;  4CFQ A;  2WCB A;  2FOT A;  2CBL A;  2WCF A;  3TUY B;  1A75 B;  3D78 A;  2E6W A;  1FBV A;  2KI6 D;  4PE0 A;  1WY9 A;  1A2X A;  4GUK A;  1FI6 A;  2CTN A;  2KFF A;  3O4X A;  4I5J A;  4KYN A;  2JQ6 A;  1YUU A;  3PAL A;  2CXJ A;  1GGZ A;  1NYA A;  2LMV A;  3BUW B;  4C0J A;  1QJT A;  2FCE A;  1CLB A;  3S0F A;  3TDZ A;  2GTE A;  4CID A;  1NP8 A;  1QVI Y;  3EK4 A;  1DGU A;  4OVN F;  1CM4 A;  1W7I B;  2Y5I A;  1E8A A;  1S5G Z;  3FIA A;  3NGV A;  3RLZ A;  2LP2 A;  2LVK A;  1WRK A;  2OPO A;  3I5I C;  1OOF A;  1QX7 A;  1SL9 A;  1C07 A;  1IJ5 A;  1N0Y A;  1SCM B;  2L4H A;  1DJI A;  1B8L A;  1RWY A;  2BCA A;  5IBW A;  2JPO A;  3KEV A;  2KBI A;  1WDC C;  3NSI A;  3PM8 A;  2LUC A;  1OOJ A;  1DVI A;  2PMY A;  3GK4 X;  3AKA A;  4ETO A;  5D3O A;  4F0Z B;  4M2P A;  4ORB B;  3LK1 A;  5F6T A;  3S0B A;  2QDI A;  2FJY A;  1X02 A;  1QV1 A;  3JTD C;  2O5G A;  1SR6 C;  2Q4U A;  4DUQ A;  1OOI X;  3ZNI A;  2KYF A;  2QEO A;  5JJG A;  2JT0 A;  3RM1 A;  2QEB A;  4MZJ A;  3SIA A;  2M49 B;  1ZFS A;  1IQ5 A;  4IL1 A;  5I94 A;  1KQM B;  1K90 D;  1TN4 A;  1K96 A;  1S1E A;  1SY9 A;  1QWV A;  2KLE A;  1AVS A;  1BLQ A;  2BE6 A;  5AEQ A;  5DKQ A;  2P70 A;  3VRN A;  3OBV A;  3PFV A;  3WNX B;  4I5K A;  1DT7 B;  2JNF A;  4YGD B;  3BOW A;  1DEL A;  5HLO A;  1Y1X A;  1RFJ A;  2KI4 B;  4A4C A;  3VRP A;  3SJS A;  1YRT B;  3DVJ A;  2SAS A;  5KSZ A;  1NSH A;  1CMF A;  1JFK A;  1LKJ A;  3CZ2 A;  1LA0 A;  5D7F A;  1OZO A;  1CMG A;  2L51 A;  1WDC B;  1XFR A;  2BNX A;  4WRI A;  2KAX A;  2ZKM X;  1UHJ A;  4GGN A;  3TS5 B;  3DZT A;  2LHL A;  4A4B A;  4YI9 A;  4FQT A;  3VRO A;  3KHE A;  1KFU L;  1FPW A;  1MXE A;  1QXP A;  2JUL A;  5FI6 A;  3OX6 A;  3JTD B;  4INX A;  1B1G A;  1SR6 B;  3WXA A;  1XFV O;  1EG3 A;  4DRW A;  3D75 A;  4HRH A;  3IQQ A;  1IG5 A;  3CAB A;  1QLK A;  4ZCV A;  1AUI B;  1MR8 A;  1EJ3 A;  3OP0 A;  1Y1A A;  1CTR A;  5BPJ A;  3R1V A;  4BY4 A;  3NSK A;  1WRZ A;  1TNX A;  3CS1 A;  3DF0 A;  1C3Z A;  1AK8 A;  1GQM A;  2M3W A;  2RGI A;  3PSR A;  2PQL A;  4WQ3 A;  1S6C A;  4YGA A;  1F4O A;  1ZAC A;  2PYQ A;  1S3P A;  3LK0 A;  4YGC B;  1ODB A;  1SRA A;  4ICB A;  4MN0 A;  3BXK A;  1GGW A;  1G4Y R;  3QME A;  1CM1 A;  1GM0 A;  1YUS A;  5B8I B;  1YUR A;  5TNC A;  1OQP A;  3BUN B;  1IRJ A;  2KHN A;  5AFP A;  4F7F A;  3C1V A; 
#chains in the Genus database with same CATH homology
 3TZ1 A;  4GGF A;  3EKH A;  4M2Q A;  1JSA A;  2I94 A;  1CDP A;  1ZOT B;  2LVV A;  2AUC A;  5CSJ A;  1JUO A;  1DJG A;  4PHK A;  5KU1 A;  1B9A A;  3IF7 A;  5D69 A;  2M1U A;  2BL0 C;  1YVH A;  3EKJ A;  3VRQ A;  5ER5 A;  4NQG A;  2BEC A;  1DGV A;  1ALW A;  2M7N A;  2LVI A;  3AKB A;  1BT6 A;  2NCP A;  3D10 A;  1JF2 A;  1CDN A;  1CFF A;  1TNP A;  4YI8 A;  2WND A;  1AJ5 A;  2JNX A;  4U8D A;  1A03 A;  4R1E A;  1QX2 A;  1UHK A;  2LV7 A;  5ER4 X;  2HPS A;  1CDL A;  1BMO A;  2ZFD A;  3CR2 A;  3PN7 B;  1A29 A;  3TDI A;  1DF0 B;  3JVT C;  1JWD A;  2I18 A;  1PUL A;  4P5O E;  2Y1N A;  2MLF C;  1J1D A;  5G08 A;  2BBM A;  5CSF A;  1KQM C;  4PE4 A;  1MHO A;  1NWD A;  1NX0 A;  2Y1M A;  1QX5 B;  2BCX A;  2K7O A;  1OZS A;  2CT9 A;  1B7T Y;  1AP4 A;  1C7V A;  3DVK A;  2BL0 B;  3VRR A;  5I8N A;  2KFH A;  2KI4 C;  2LC5 A;  1J55 A;  5HKZ A;  3BOW B;  1SMG A;  1MUX A;  1YR5 A;  5I2L A;  2LMT A;  4JWQ A;  1GJY A;  4DIR A;  5AAN A;  1H8B A;  1F71 A;  4CLN A;  4MBE A;  4MLW A;  2R2I A;  3I5H B;  1JBA A;  3TS5 C;  2M9G A;  1SYM A;  1UHN A;  2AMI A;  2KBM A;  4GGF C;  1NCZ A;  2KDH A;  4XJK A;  1M39 A;  2MA2 A;  5K89 A;  1DF0 A;  4PHM A;  2KGB C;  4AQI A;  3LL8 B;  3SG6 A;  3JVT B;  2G2B A;  4GNK B;  4OV2 A;  1U5I A;  4P2Y B;  4NDC A;  4OCI A;  2ZN9 A;  2JT3 A;  1N2D A;  1NCY A;  1KFX S;  1CLL A;  2QAC A;  1BOC A;  1IJ6 A;  3IQO A;  1J7Q A;  1DMO A;  2BCB A;  4GPL B;  3EVR A;  3GK2 A;  1MXL C;  2WCE A;  3DF0 B;  1F70 A;  1Y6W A;  1J1E A;  1QLS A;  1TIZ A;  2L4I A;  3LCP C;  1J7R A;  1K9K A;  1ZMZ A;  1OE9 B;  4HSZ A;  1XFZ O;  1IWQ A;  1KSM A;  5HYD A;  1UUS A;  1CNP A;  3NXA A;  4QJ3 B;  3BUX B;  2KQY A;  3GK1 A;  1KWO B;  2KAY A;  1AHR A;  1S5G Y;  1HQV A;  1KK7 Z;  1S6I A;  1M45 A;  4I5N B;  3OB1 B;  4FQO A;  1PSB A;  2PVB A;  2O60 A;  3I5G B;  2LLU A;  3TDU A;  1EH2 A;  3QRX A;  1R2U A;  3CZT X;  1TCO B;  1LA3 A;  3EVU A;  1BR1 B;  2F2P A;  1TNQ A;  2K2A A;  2CNP A;  1TTX A;  5CPV A;  4TNC A;  2L2E A;  4NDB A;  2BKH B;  2LAN A;  4PE7 A;  2K7D A;  4YBH B;  2M1K B;  2EGD A;  1F8H A;  1FF1 A;  1AJ4 A;  3SG5 A;  1XK4 A;  4ORC B;  3OX5 A;  4PE1 A;  1YX7 A;  2NZ0 A;  1XVJ A;  1MQ1 A;  3HX4 A;  2JTZ A;  5I2O A;  1CKK A;  1UP5 A;  3EK8 A;  4E68 A;  1RJV A;  1SNL A;  3KO0 A;  1V1G A;  2L5X B;  3PN7 C;  1SL7 A;  1CLM A;  4GBA A;  3FS7 A;  4C0K A;  4AOM A;  1DJW A;  1DJZ A;  2MRD A;  3ZWH A;  3SG7 A;  2M97 A;  4PAL A;  1TOP A;  3NSO A;  3BQ3 A;  2CCM A;  2MJW B;  4DCK A;  2JU0 A;  1KK8 B;  3A4U B;  2LNK A;  4MVF A;  1LXF C;  2MLE C;  5PAL A;  3A8R A;  3BYA A;  3SG4 A;  1G33 A;  2EC6 B;  4QJ5 B;  3DD4 A;  4FTG A;  2B1U A;  1BOD A;  1SCV A;  2K0J A;  2LP3 A;  2EHB A;  1M31 A;  1SK6 D;  1XFU O;  4MZL A;  1QVI Z;  3I5H C;  4CPV A;  2ZRS A;  3K21 A;  1B7T Z;  2A4J A;  1DJH A;  3H4S E;  2P6B B;  4Q04 A;  2ZN8 A;  4XJK B;  1NX3 A;  1XFY O;  1XFW O;  2MAZ A;  3FWC A;  1JFJ A;  1B8R A;  1BR4 B;  5CSN A;  2LLT A;  1S26 D;  1U5I B;  1VRK A;  3CGA A;  2HQ8 A;  2ZNE A;  1LVC D;  2GGZ A;  4MEW A;  1QIW A;  2JZI A;  2K2F A;  2F3Y A;  2JXC A;  2M0R A;  3VGO A;  1Q80 A;  3SIB A;  4PDZ A;  2BBN A;  3GOF A;  1KCY A;  3O78 A;  2LM5 A;  1CFD A;  2FJU B;  4N5X A;  2LAP A;  4OKH A;  1XK4 C;  2L98 A;  3F45 A;  2V53 A;  1YUT A;  2LMU A;  2LVJ A;  1MWN A;  2LCP A;  5DKR A;  5GQQ C;  4XYN A;  3AAK A;  1EG4 A;  1F55 A;  1KWO C;  1S36 A;  2JWW A;  1IGV A;  1NX1 A;  1OSA A;  4ZCU A;  1RTP 1;  2HF5 A;  3I5G C;  1BU3 A;  1UUR A;  2F33 A;  3O6B A;  3O4Y A;  4YRU A;  4GAO A;  2COL B;  1K8U A;  1RRO A;  2F2O A;  1H4B A;  3CLN A;  2JT8 A;  1UWO A;  4UPG A;  2ZND A;  1CFP A;  2LHI A;  5J3X A;  2FCD A;  2F8P A;  2IS9 A;  2GGM A;  3KF9 A;  1KFX L;  2KFG A;  2OS8 C;  2GV5 A;  3D0Y A;  3FWB A;  2SCP A;  2MHH A;  2PAS A;  2VRG A;  1KQV A;  1B47 A;  1CB1 A;  1PSR A;  4WQ2 A;  1D1O A;  1LIN A;  2KGR A;  1M46 A;  4MRX A;  2KYC A;  3SG2 A;  1SBJ A;  4MRY A;  1Y1U A;  1R6P A;  2Y4Q A;  1TNW A;  2H61 A;  4N1G A;  1A75 A;  5DKN A;  1NPQ A;  4C0L A;  2K8M B;  5AER A;  1C7W A;  2WOS A;  3PAT A;  1ALV A;  2JPT A;  2K7B A;  3ICB A;  2HET A;  1OMV A;  3AAJ A;  2OTG C;  1J7P A;  2M29 A;  3EK7 A;  2LLS A;  2JTT A;  2JRF A;  4MSP A;  1RK9 A;  1EL4 A;  1K9U A;  3DVM A;  5HKW A;  4PCW A;  1K9P A;  2BE4 A;  1FI5 A;  2KSP A;  2E30 A;  3M0W A;  1PRW A;  4OR9 B;  1W7J B;  2NXQ A;  3NSL A;  1KK8 C;  2KQ6 A;  1QTX A;  5CSI A;  5FYX A;  2K61 A;  4L9M A;  1TCF A;  3BUM B;  2JC2 A;  1IKU A;  4YGB B;  2OS8 B;  2LE9 B;  2EC6 C;  1JC2 A;  3I5I B;  3BUO B;  1XFX O;  4DS7 A;  1PAL A;  3HCM A;  1REC A;  2BKI B;  1OMR A;  1NCX A;  2Q91 A;  1SPY A;  1WRL A;  4ORA B;  1N65 A;  1WLZ A;  4YGE B;  5HKY A;  1CFC A;  1XA5 A;  1PVA A;  3OHM B;  1MF8 B;  4HRG A;  5JOL A;  1PVB A;  1WLM A;  1QAS A;  2HQW A;  3MSE B;  4JQ0 D;  2NLN A;  1KFU S;  2I2R E;  1EXR A;  1UHH A;  3EVV A;  2F3Z A;  3SG3 A;  2PAL A;  2OTG B;  2D8N A;  1M63 B;  2TN4 A;  1IH0 A;  2LUX A;  1UHI A;  4NDD A;  3OB2 B;  1YVL A;  5AXI A;  1L2O C;  1YRU B;  3I5F C;  1DJX A;  1FW4 A;  1F54 A;  3LLE A;  2MBX A;  1K2H A;  1KK7 Y;  1QAT A;  1NIW A;  2I7A A;  1B8C A;  2JOJ A;  2KI6 C;  1K94 A;  1QIV A;  2K7C A;  1DTL A;  3WHU B;  5I2Q A;  1QS7 A;  1BJF A;  1NUB A;  1QV0 A;  3CR5 X;  4PHN A;  2H61 C;  3TUY C;  4CFR A;  2KOT A;  3PLF B;  2PSR A;  1BG1 A;  4AQJ A;  4M2O A;  1S6J A;  1ZUZ A;  1DJY A;  1OMD A;  1A4P A;  2AAO A;  4PHJ A;  4HRE E;  1CDM A;  4GFT A;  1JF0 A;  1YX8 A;  2L50 A;  4USL A;  1Y0V H;  3KPX A;  4I5L B;  4QJ4 B;  1IQ3 A;  2L0P A;  2WOR A;  1G8I A;  3E3R A;  2ZRT A;  1B4C A;  5HLV A;  1SW8 A;  1SKT A;  2ISD A;  1XYD A;  1V1F A;  1BF5 A;  4BY5 A;  1YTZ C;  1XO5 A;  2M8U A;  3WHT B;  1F4Q A;  3CWG A;  2H2K A;  3DVE A;  2DOQ A;  1L2O B;  1NX2 A;  1TRF A;  3D0Y B;  2M7L A;  1SCM C;  3I5F B;  1KSO A;  1SL8 A;  1L7Z A;  4JPZ B;  1K93 D;  4N1F A;  2JXL A;  2KAV A;  2NCO A;  4D1E A;  1HT9 A;  3O2P A;  3CR4 X;  1J7O A;  2QPT A;  5KTY A;  2KNE A;  2WC8 A;  4MZK A;  1K95 A;  1PK0 D;  2G9B A;  2PRU A;  4CFQ A;  3CTN A;  2WCB A;  2FOT A;  2CBL A;  2WCF A;  3TUY B;  1A75 B;  2E6W A;  1FBV A;  2KI6 D;  4PE0 A;  1WY9 A;  1A2X A;  4GUK A;  1FI6 A;  2CTN A;  2KFF A;  4I5J A;  2JQ6 A;  1YUU A;  3PAL A;  2CXJ A;  1GGZ A;  1NYA A;  2LMV A;  3BUW B;  4C0J A;  1QJT A;  2FCE A;  1CLB A;  3TDZ A;  4CID A;  1NP8 A;  1QVI Y;  3EK4 A;  1DGU A;  4OVN F;  1CM4 A;  1W7I B;  2Y5I A;  1E8A A;  1S5G Z;  3FIA A;  3RLZ A;  2LP2 A;  2LVK A;  1WRK A;  2OPO A;  3I5I C;  1QX7 A;  1SL9 A;  1C07 A;  1IJ5 A;  1N0Y A;  1SCM B;  2L4H A;  1DJI A;  1B8L A;  1RWY A;  2BCA A;  5IBW A;  3KEV A;  2KBI A;  1WDC C;  3NSI A;  3PM8 A;  2LUC A;  1OOJ A;  1DVI A;  2PMY A;  3GK4 X;  3AKA A;  4ETO A;  4F0Z B;  4M2P A;  4ORB B;  3LK1 A;  5F6T A;  1X02 A;  1QV1 A;  3JTD C;  2O5G A;  1SR6 C;  2Q4U A;  4DUQ A;  3ZNI A;  2KYF A;  5JJG A;  2JT0 A;  3RM1 A;  4MZJ A;  3SIA A;  2M49 B;  1ZFS A;  1IQ5 A;  4IL1 A;  1KQM B;  1K90 D;  1TN4 A;  1K96 A;  1S1E A;  1SY9 A;  1AVS A;  1BLQ A;  2BE6 A;  5AEQ A;  5DKQ A;  3VRN A;  3PFV A;  3WNX B;  4I5K A;  1DT7 B;  2JNF A;  4YGD B;  3BOW A;  5HLO A;  1Y1X A;  1RFJ A;  2KI4 B;  4A4C A;  3VRP A;  3SJS A;  1YRT B;  3DVJ A;  2SAS A;  5KSZ A;  1NSH A;  1CMF A;  1JFK A;  1LKJ A;  1LA0 A;  5D7F A;  1OZO A;  1CMG A;  2L51 A;  1WDC B;  4WRI A;  2KAX A;  2ZKM X;  1UHJ A;  4GGN A;  3TS5 B;  2LHL A;  4A4B A;  4YI9 A;  3VRO A;  3KHE A;  1KFU L;  1FPW A;  1MXE A;  1QXP A;  2JUL A;  3OX6 A;  3JTD B;  1B1G A;  1SR6 B;  3WXA A;  1XFV O;  1EG3 A;  4DRW A;  4HRH A;  3IQQ A;  1IG5 A;  1QLK A;  4ZCV A;  1AUI B;  1MR8 A;  1EJ3 A;  3OP0 A;  1Y1A A;  1CTR A;  5BPJ A;  4BY4 A;  3NSK A;  1WRZ A;  1TNX A;  3CS1 A;  3DF0 A;  1AK8 A;  1GQM A;  2M3W A;  2RGI A;  3PSR A;  4WQ3 A;  1S6C A;  4YGA A;  1F4O A;  1ZAC A;  1S3P A;  3LK0 A;  4YGC B;  1ODB A;  1SRA A;  4ICB A;  4MN0 A;  3BXK A;  1GGW A;  1G4Y R;  1CM1 A;  1YUS A;  5B8I B;  1YUR A;  5TNC A;  1OQP A;  3BUN B;  1IRJ A;  2KHN A;  5AFP A;  3C1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...