1FF1A

Structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfl
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR SUBSTRATE 15
publication title Molecular mechanism of NPF recognition by EH domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ff1A00
1NYAA 2F8PA 1YTZC 1K93D 1KSMA 1DJGA 1X02A 5AERA 2OS8B 1RK9A 3GK2A 2ZN8A 5HKZA 1QASA 2LANA 3EK7A 4A4CA 3I5GB 1IJ6A 4ZCUA 5KSZA 1PVAA 2QPTA 1IRJA 1DF0B 1OZOA 3CR4X 1QX5B 2BKIB 3DVJA 2WCEA 2JU0A 3EKHA 3GK1A 5BPJA 1AVSA 1A29A 1S36A 4YGDB 3SIAA 1M63B 1CTRA 4IL1A 5ER4X 4D1EA 1B7TY 2KNEA 3CS1A 3VGOA 1SRAA 1F54A 3LLEA 1F70A 3VROA 1CLLA 1DJXA 2JPTA 3TDZA 1JF2A 2M9GA 1WDCB 3SG3A 1SL9A 1CMFA 3OP0A 3PN7B 4PDZA 1J1EA 1K96A 1H8BA 3AKBA 2E30A 1SL8A 1F4OA 4HRHA 4PALA 5K89A 3TS5C 1OQPA 4GFTA 1SPYA 5DKQA 1CFCA 1IKUA 2JOJA 2K8MB 1YX7A 1GJYA 2M97A 4GPLB 3I5HC 3KO0A 1WLZA 4GGFC 5AXIA 1RECA 2AUCA 2JXLA 2O60A 3EVRA 3NSIA 5GQQC 1ZMZA 3M0WA 3VRNA 5HKYA 1B8CA 2L4HA 3SG5A 1DJIA 2BBNA 1G8IA 2MLFC 2KYCA 4GUKA 3F45A 3EVVA 4MSPA 2H61C 2Q4UA 2PSRA 1EG4A 2K7OA 3PLFB 3NSKA 1TTXA 1PRWA 1AUIB 1GGWA 1HT9A 1MQ1A 1YVLA 1R6PA 1Q80A 2D8NA 4JPZB 3DF0A 3JTDC 1F8HA 3D0YA 1NUBA 1BLQA 1KQMC 2EGDA 2KBIA 2G9BA 2L98A 1UHIA 2F3YA 4QJ4B 1J7QA 2O5GA 2IS9A 2TN4A 1XYDA 5KTYA 2Y4QA 1RWYA 1CMGA 1WLMA 3FS7A 1Y1UA 4C0LA 3HCMA 1J7PA 1FI5A 3KF9A 5FYXA 3OX6A 2WNDA 1V1GA 2BE6A 4OR9B 1JSAA 1SCVA 2M8UA 2LP2A 4A4BA 3D0YB 1CKKA 4OVNF 3O6BA 2K7BA 4PE0A 4E68A 1YR5A 2Y1MA 1W7IB 1A03A 2JC2A 1CFDA 2M3WA 2Y5IA 4XJKA 3IQQA 4QJ5B 3BUNB 1K90D 5DKNA 1L2OC 1OMDA 3BUXB 4MZKA 1CLBA 2RGIA 4M2OA 4ORCB 1N65A 2NCOA 1K94A 1G33A 1GQMA 1HQVA 1NX3A 2MJWB 2JT8A 3GK4X 1Y6WA 3JTDB 2HF5A 5JJGA 5AANA 1N2DA 2LVJA 2BL0C 3WHUB 1BG1A 1TIZA 4I5NB 3SJSA 2F2OA 2ZNDA 1SK6D 1WRZA 1ZUZA 3OX5A 4YBHB 2AAOA 4I5KA 4XJKB 5B8IB 1EH2A 4NQGA 4PE1A 1B8RA 2LHLA 1Y1AA 2EHBA 1K95A 2I2RE 3JVTC 3K21A 1K9UA 3CR5X 5CSNA 1K9PA 2JULA 1CFPA 1NIWA 2HPSA 1C7WA 1MF8B 1W7JB 1CM4A 1NX0A 2HQ8A 1KWOB 3CWGA 1TNXA 2ZNEA 4ORBB 1UP5A 1SR6C 1FF1A 3A8RA 1M45A 2I7AA 2SASA 4PHJA 2JRFA 1PSBA 1DJZA 2L50A 1LA0A 2LAPA 1JFKA 1QVIY 2KHNA 3SG6A 1MUXA 2PMYA 1SMGA 2LUCA 5JOLA 2KSPA 3TUYB 2DOQA 2LNKA 4MBEA 2P6BB 1A75A 1NP8A 4NDBA 3I5FB 1SCMB 1JF0A 1B8LA 5D69A 1J7RA 1NCYA 1V1FA 2BE4A 1S5GY 2OTGC 3TDUA 1XFZO 1DJYA 1IGVA 1K8UA 2CT9A 3JVTB 4XYNA 1LINA 4YGBB 4AQJA 1S3PA 1NWDA 2B1UA 2F3ZA 1QXPA 2WCBA 2HQWA 2Q91A 4HREE 5IBWA 1LXFC 1TN4A 1EL4A 5J3XA 3CLNA 3D10A 2L2EA 2M0RA 2LV7A 2KI4B 2AMIA 3SG2A 2COLB 1A75B 2BCAA 4CFQA 4L9MA 3LK1A 1XK4C 4UPGA 1LKJA 4DCKA 2K61A 1S26D 2MRDA 3BXKA 2VRGA 2ISDA 3BQ3A 1NPQA 1DGVA 2K7DA 4YRUA 3AKAA 4MVFA 2BBMA 4P5OE 3KEVA 2CNPA 1QLKA 4GBAA 1OE9B 2LP3A 3HX4A 4HRGA 2KGBC 5AFPA 1WRLA 1LVCD 1MXEA 1TCOB 2CTNA 2H61A 5PALA 1S1EA 1CM1A 2WOSA 2BCBA 4JQ0D 2KFHA 3BUOB 1B7TZ 1CDLA 1UHKA 4CPVA 1CFFA 1XFXO 2I94A 2LMTA 1UURA 4GNKB 3SG7A 3CTNA 2ZRSA 2EC6C 1F4QA 3TS5B 3WHTB 2ZN9A 1UHJA 3GOFA 2BECA 3I5IC 3I5HB 2KAVA 1ZFSA 1IH0A 1TNPA 4JWQA 1YRUB 3TDIA 3OHMB 5I2QA 1H4BA 2M49B 4CFRA 2M1KB 2JZIA 3OB1B 4YI8A 4OKHA 2LLSA 2WC8A 1BMOA 2L4IA 4AQIA 2LLTA 1EJ3A 1PULA 1QX2A 2M1UA 1S6CA 1FW4A 4DUQA 1DJWA 1KQMB 2SCPA 3KHEA 1NX2A 1UUSA 1YX8A 2E6WA 2LVKA 3AAKA 1F71A 3WNXB 2OS8C 1A4PA 1CLMA 2L51A 1J1DA 2LM5A 2FOTA 2K2FA 5HKWA 1DVIA 1ZACA 4GGNA 5G08A 1QATA 3I5GC 2Y1NA 4AOMA 4C0KA 2JXCA 2LVIA 5TNCA 3TZ1A 1ALWA 1ODBA 1B1GA 1SNLA 2I18A 4OV2A 3VRQA 2JNFA 1IQ5A 1UHHA 1JUOA 1MR8A 2F33A 1EG3A 2GV5A 3AAJA 4YGCB 3I5IB 1C07A 1CDPA 1U5IA 1QV1A 3DD4A 3O4YA 1SW8A 2WORA 1AK8A 1G4YR 4MRXA 4MN0A 1UWOA 1WDCC 4WQ3A 4MZJA 1K2HA 1AJ5A 3PN7C 1JFJA 3MSEB 1IJ5A 1J55A 1KK8C 2L5XB 1YVHA 4PCWA 1QJTA 1L2OB 3NSLA 2NLNA 2JNXA 4I5LB 1BR1B 2MA2A 1DGUA 1FBVA 2PALA 1TRFA 3VRPA 2NCPA 1BF5A 1QLSA 2HETA 1TCFA 3DVEA 4PE4A 1BJFA 1KFUS 2BL0B 2K0JA 1MHOA 2KFFA 2F2PA 1SL7A 3NSOA 1QS7A 1DMOA 2PVBA 2JT3A 1ALVA 4CLNA 1U5IB 2LE9B 2LCPA 2MLEC 5CSIA 1AJ4A 1UHNA 2JTTA 5AEQA 5HLVA 3ZNIA 1OSAA 2JT0A 2NZ0A 4YGAA 2QACA 1S6JA 3PSRA 3SIBA 3A4UB 2MHHA 1CB1A 3FIAA 4WRIA 2KI6C 1KK7Y 5DKRA 2PASA 2KAYA 2KI6D 4N1FA 1IWQA 1XFYO 2KFGA 3BUMB 2KQYA 1JC2A 1PK0D 3IF7A 2A4JA 5CPVA 1BOCA 1BT6A 1XVJA 1NCXA 1RFJA 1SYMA 2OPOA 3O78A 5CSFA 1JWDA 1M39A 1SR6B 3BYAA 2FCDA 4R1EA 2NXQA 4DIRA 3LL8B 3SG4A 1B47A 5D7FA 4OCIA 3CZTX 2JWWA 2LLUA 1KK8B 2ZKMX 1QV0A 4C0JA 3WXAA 4YI9A 1OZSA 2KDHA 1KFXL 1QTXA 2FCEA 2LMVA 1QVIZ 1RTP1 3ZWHA 1SBJA 3PFVA 3CGAA 4GGFA 1AP4A 1XFWO 2K2AA 1KFUL 4PHMA 3DVMA 1B9AA 1XK4A 3LCPC 1JBAA 4GAOA 1YURA 1YRTB 1NX1A 1OMRA 2FJUB 1NCZA 3H4SE 3BOWA 3RM1A 4DRWA 1YUSA 1KSOA 2OTGB 1S5GZ 1QX7A 4FQOA 1XA5A 1XFVO 5KU1A 1EXRA 1VRKA 1F55A 5F6TA 3RLZA 3PALA 1E8AA 2KGRA 4M2QA 4QJ3B 1KK7Z 4PHNA 1R2UA 4U8DA 4BY5A 4N5XA 2WCFA 2GGZA 2BCXA 2H2KA 3ICBA 4USLA 4BY4A 2CBLA 2CCMA 1WY9A 5HLOA 1TOPA 1KQVA 1CDMA 2G2BA 3LK0A 3BOWB 1IQ3A 1K9KA 4F0ZB 1A2XA 3FWCA 4DS7A 5CSJA 3IQOA 1KWOC 3DF0B 4TNCA 4HSZA 1AHRA 1TNQA 4PHKA 1BODA 4MEWA 2LHIA 1S6IA 1XO5A 2KAXA 3DVKA 3O2PA 3QRXA 2LMUA 1DTLA 2JTZA 1RJVA 2M7LA 4FTGA 1YUUA 1DJHA 1YUTA 2MBXA 1QIVA 2KBMA 1GGZA 2BKHB 1DT7B 4ORAB 1MWNA 1PSRA 1OMVA 4YGEB 1FI6A 1WRKA 2KQ6A 1QIWA 1M46A 2KYFA 4CIDA 1SKTA 1NSHA 2JQ6A 1M31A 2LC5A 2LVVA 2M29A 2ZRTA 3E3RA 4N1GA 2V53A 5I2OA 1CDNA 2ZFDA 1PVBA 3TUYC 4MLWA 2PRUA 1FPWA 5I8NA 3BUWB 3EK4A 2EC6B 1TNWA 3FWBA 1RROA 1Y0VH 1IG5A 3C1VA 3PM8A 1OOJA 1Y1XA 3EKJA 2R2IA 3I5FC 4NDCA 1SCMC 3CR2A 4PE7A 1KCYA 2K7CA 1D1OA 2GGMA 4MRYA 3VRRA 5HYDA 1ZOTB 4WQ2A 2MAZA 3NXAA 1C7VA 5I2LA 3EVUA 1PALA 2M7NA 4I5JA 3KPXA 4ZCVA 4P2YB 1B4CA 1XFUO 1MXLC 1BR4B 1DF0A 4M2PA 4ETOA 1KFXS 2CXJA 4ICBA 2KOTA 4NDDA 1J7OA 3OB2B 2LUXA 1N0YA 1SY9A 2L0PA 1LA3A 4Q04A 2KI4C 3PATA 1CNPA 5ER5A 1L7ZA 1BU3A 4MZLA 3EK8A
chains in the Genus database with same CATH superfamily
3BFAA 1NYAA 2F8PA 1T14A 3Q8IA 1YTZC 1K93D 1TUJA 1KSMA 1DJGA 1X02A 5AERA 2OS8B 1RK9A 3GK2A 2ZN8A 5HKZA 1QASA 3CABA 2LANA 3EK7A 4A4CA 3I5GB 1IJ6A 4ZCUA 5KSZA 1PVAA 2QPTA 1IRJA 1DF0B 1OZOA 3CR4X 1QX5B 2QEOA 2BKIB 3DVJA 2WCEA 2JU0A 3EKHA 3GK1A 3SS3A 5BPJA 1AVSA 1A29A 1S36A 4YGDB 4OZDA 1M63B 3SIAA 1CTRA 4IL1A 5ER4X 4D1EA 1B7TY 2KNEA 3CS1A 3IVTA 4FQTA 3VGOA 1SRAA 1F54A 3LLEA 1F70A 3VROA 1CLLA 1DJXA 2JPTA 3TDZA 1JF2A 2M9GA 1WDCB 3SG3A 1SL9A 1CMFA 3OP0A 3PN7B 3FE9A 4PDZA 1J1EA 1K96A 1H8BA 3AKBA 2E30A 1SL8A 1F4OA 4HRHA 4PALA 5K89A 3TS5C 2P71A 1OQPA 4GFTA 1SPYA 5DKQA 1CFCA 1IKUA 2JOJA 2K8MB 1YX7A 1GJYA 2M97A 4GPLB 3I5HC 3KO0A 1WLZA 4GGFC 5AXIA 1RECA 2AUCA 2JXLA 2KLEA 2O60A 2PQLA 3EVRA 1ZMZA 3M0WA 1W9ZA 3NSIA 5HKYA 1B8CA 2L4HA 3SG5A 1DJIA 2BBNA 1G8IA 2MLFC 2KYCA 3R1VA 4GUKA 3F45A 3S0DA 3EVVA 4MSPA 2H61C 2Q4UA 2PSRA 1EG4A 2K7OA 3PLFB 3NSKA 1TTXA 1PRWA 1AUIB 1GGWA 1HT9A 1MQ1A 1YVLA 1R6PA 1Q80A 2D8NA 1OOHA 4JPZB 3DF0A 3JTDC 1F8HA 3D0YA 1IIOA 3OGNA 1NUBA 1BLQA 1KQMC 2EGDA 2KBIA 2G9BA 2L98A 2WCJA 3NHIA 1UHIA 2F3YA 4QJ4B 1J7QA 2O5GA 2IS9A 2TN4A 1XYDA 5KTYA 2Y4QA 1RWYA 1CMGA 1WLMA 3FS7A 1Y1UA 4C0LA 3HCMA 1J7PA 1FI5A 3KF9A 5FYXA 3OX6A 2WNDA 1V1GA 2BE6A 4OR9B 1JSAA 1SCVA 2M8UA 2LP2A 4A4BA 3D0YB 3S0FA 1CKKA 3S0EA 4OVNF 3O6BA 2K7BA 4PE0A 4E68A 1YR5A 2Y1MA 1TUZA 1W7IB 3D73A 1A03A 2JC2A 4PT1A 1CFDA 2M3WA 2Y5IA 4XJKA 3IQQA 4QJ5B 2BAPA 3BUNB 3EG5B 1K90D 3D74A 3S0GA 5DKNA 1L2OC 1OMDA 3BUXB 4MZKA 3UNWA 1CLBA 2RGIA 3L4LA 3O4XA 1N65A 4M2OA 4ORCB 2NCOA 1K94A 1G33A 1GQMA 3D75A 1HQVA 1NX3A 2MJWB 2JT8A 3GK4X 1Y6WA 3JTDB 2HF5A 5JJGA 5AANA 1N2DA 2LVJA 3QMEA 4JD9A 2BL0C 3WHUB 5FI6A 5HL1A 1BG1A 1TIZA 3VRNA 4I5NB 3SJSA 2F2OA 2ZNDA 1SK6D 1WRZA 1ZUZA 3OX5A 4F7FA 4YBHB 2AAOA 4I5KA 4XJKB 5B8IB 1EH2A 4NQGA 2ERBA 4PE1A 1B8RA 2LHLA 3CZ1A 1Y1AA 3D77A 2EHBA 1K95A 2I2RE 3JVTC 3K21A 1K9UA 3CR5X 5CSNA 1K9PA 2JULA 1CFPA 1NIWA 2HPSA 1C7WA 1MF8B 1W7JB 1CM4A 1NX0A 2HQ8A 1KWOB 3CWGA 4INXA 1TNXA 2ZNEA 4ORBB 1UP5A 1SR6C 1FF1A 3A8RA 1M45A 2I7AA 2SASA 1C3YA 2H8VA 4PHJA 2JRFA 1PSBA 1DJZA 2L50A 3CDNA 1LA0A 2LAPA 1JFKA 1QVIY 2KHNA 3SG6A 1OW4A 1MUXA 2PMYA 3D78A 1SMGA 2KLDA 2LUCA 5D3OA 5JOLA 2KSPA 3TUYB 2DOQA 2LNKA 4MBEA 2P6BB 1A75A 1NP8A 4NDBA 3I5FB 3RZSA 1SCMB 1JF0A 1B8LA 5D69A 1J7RA 1NCYA 1V1FA 1SSEB 2BE4A 2L2CA 1S5GY 1LS8A 2OTGC 3TDUA 1DC1A 1XFZO 1DJYA 1IGVA 1K8UA 2WC5A 2CT9A 3JVTB 4XYNA 1LINA 4YGBB 4AQJA 1S3PA 1NWDA 2B1UA 2F3ZA 1QXPA 2WCBA 2HQWA 2Q91A 4HREE 5IBWA 3S0BA 1LXFC 1TN4A 1EL4A 2WCHA 5J3XA 3CLNA 3D10A 2L2EA 2M0RA 2LV7A 2KI4B 2AMIA 3SG2A 2COLB 3NHTA 1A75B 2BCAA 4CFQA 4L9MA 3LK1A 1XK4C 4UPGA 1LKJA 4DCKA 2K61A 1S26D 2MRDA 3BXKA 2VRGA 2WCLA 3BQ3A 2ISDA 1NPQA 1DGVA 2K7DA 4YRUA 3AKAA 4MVFA 2BBMA 4P5OE 3CYZA 3S0AA 3KEVA 2CNPA 1QLKA 4GBAA 1OE9B 3SS5A 2LP3A 3HX4A 4HRGA 2KGBC 5FI7A 5AFPA 1WRLA 1LVCD 1MXEA 1TCOB 2CTNA 2H61A 5PALA 1S1EA 1CM1A 1XFRA 2WOSA 2BCBA 3L4AA 2KFHA 4JQ0D 3BUOB 1B7TZ 1CDLA 1UHKA 4CPVA 1CFFA 1XFXO 2I94A 2LMTA 1UURA 4GNKB 3SG7A 3CTNA 2ZRSA 2PYQA 2EC6C 3D76A 1F4QA 3TS5B 3WHTB 2ZN9A 3DXLA 1UHJA 3GOFA 2BECA 3I5IC 1P28A 2KAVA 2QEVA 3I5HB 1ZFSA 1IH0A 1TNPA 4JWQA 1YRUB 2QEBA 3TDIA 3OHMB 5I2QA 1H4BA 2M49B 5EL2A 4CFRA 1ORGA 2M1KB 2JZIA 3OB1B 1DELA 4YI8A 1DEKA 4OKHA 2LLSA 2WC8A 1BMOA 2L4IA 2QEHA 4AQIA 2LLTA 1EJ3A 1PULA 1QX2A 2M1UA 1S6CA 1FW4A 4DUQA 1DJWA 1KQMB 5FI2A 2SCPA 3KHEA 3N7HA 1NX2A 1UUSA 1YX8A 2E6WA 2LVKA 3AAKA 1F71A 3WNXB 3FE8A 2OS8C 1A4PA 1CLMA 2L51A 1J1DA 2LM5A 2FOTA 2K2FA 2WCMA 5HKWA 1DVIA 1ZACA 3B6XA 4GGNA 1QATA 2WCKA 3I5GC 5G08A 2Y1NA 4AOMA 4C0KA 2JXCA 2LVIA 5TNCA 3TZ1A 1ALWA 1ODBA 1B1GA 1SNLA 2I18A 4OV2A 3VRQA 2JNFA 2JPOA 1IQ5A 1UHHA 1JUOA 1MR8A 2F33A 1EG3A 2GV5A 3AAJA 4YGCB 3I5IB 1C07A 1CDPA 1U5IA 1QV1A 1TWOA 3DD4A 1SW8A 2WORA 3O4YA 1AK8A 1G4YR 4MRXA 4MN0A 3DY9A 1UWOA 1WDCC 4WQ3A 4MZJA 1K2HA 1AJ5A 3PN7C 1JFJA 3MSEB 3R1OA 1IJ5A 1J55A 1KK8C 2L5XB 1YVHA 3B86A 1QJTA 1L2OB 3NSLA 2NLNA 2JNXA 4I5LB 1BR1B 2MA2A 1DGUA 1FBVA 2PALA 1TRFA 3NGVA 3PJIA 3VRPA 2NCPA 1BF5A 1QLSA 2HETA 1TCFA 3DVEA 3BFHA 4PE4A 3BFBA 3CZ2A 1BJFA 1KFUS 2BL0B 2K0JA 1MHOA 2KFFA 2F2PA 1SL7A 3NSOA 1QS7A 1DMOA 2PVBA 2JT3A 1ALVA 4CLNA 1U5IB 2LE9B 2LCPA 2MLEC 5CSIA 1AJ4A 1UHNA 2JTTA 5AEQA 5HLVA 3ZNIA 1OSAA 2JT0A 2NZ0A 4YGAA 2QACA 3DYEA 1S6JA 3PSRA 3SIBA 3A4UB 2MHHA 1CB1A 1C3ZA 3FIAA 4WRIA 2KI6C 1KK7Y 5DKRA 2PASA 2KAYA 2KI6D 4N1FA 2K60A 4IJ7A 1IWQA 1XFYO 2KFGA 3BUMB 2KQYA 1JC2A 1PK0D 3IF7A 2A4JA 5CPVA 1BOCA 1BT6A 1XVJA 1SYMA 1NCXA 1RFJA 2OPOA 3O78A 5CSFA 1JWDA 1M39A 1SR6B 3BYAA 2FCDA 4R1EA 2NXQA 4DIRA 3LL8B 3SG4A 1Z4HA 1B47A 1OOFA 5D7FA 3V2LA 4OCIA 3CZTX 2JWWA 2LLUA 3B87A 1KK8B 2ZKMX 1QV0A 4C0JA 3WXAA 4YI9A 3K1EA 1OZSA 2KDHA 1KFXL 1QTXA 2FCEA 2LMVA 1QVIZ 1RTP1 3ZWHA 1SBJA 3PFVA 3CGAA 4GGFA 1AP4A 1XFWO 2K2AA 1KFUL 4PHMA 2WC6A 3DVMA 3VB1A 1B9AA 1XK4A 3LCPC 1JBAA 1GM0A 4GAOA 1YURA 1YRTB 3R1PA 1NX1A 1OMRA 2FJUB 1NCZA 3H4SE 3BOWA 3RM1A 4DRWA 1YUSA 1KSOA 2OTGB 1S5GZ 1QX7A 4FQOA 3CZ0A 1XA5A 1XFVO 5KU1A 1Z2CB 1EXRA 1VRKA 1F55A 5F6TA 3RLZA 3PALA 1E8AA 2KGRA 4M2QA 4QJ3B 1KK7Z 2YGUA 4PHNA 1R2UA 4U8DA 4BY5A 1OOIX 4N5XA 1OOGA 2P70A 5DICA 2WCFA 2GGZA 2BCXA 2H2KA 3ICBA 4USLA 4BY4A 3DZTA 2QDIA 2CBLA 2CCMA 3R72A 1WY9A 5HLOA 1TOPA 1KQVA 1CDMA 2G2BA 4KYNA 3LK0A 3B88A 3BOWB 1IQ3A 1K9KA 4F0ZB 1A2XA 3FE6A 3FWCA 4DS7A 5CSJA 3IQOA 1KWOC 3DF0B 4TNCA 4HSZA 1AHRA 1TNQA 4PHKA 1BODA 4MEWA 2LHIA 1S6IA 1XO5A 2KAXA 3DVKA 3O2PA 2KPHA 2LMUA 1DTLA 2JTZA 3QRXA 1RJVA 5GQQC 2M7LA 4FTGA 1YUUA 1DJHA 1YUTA 2MBXA 3OBVA 1QIVA 2KBMA 1GGZA 2BKHB 2GTEA 1DQEA 1DT7B 4ORAB 1MWNA 1PSRA 1OMVA 4YGEB 1FI6A 1WRKA 2KQ6A 1QIWA 1M46A 3B7AA 4JKTA 2KYFA 4CIDA 4INWA 1SKTA 1NSHA 2JQ6A 1M31A 2LC5A 2LVVA 2M29A 2ZRTA 3E3RA 4N1GA 2V53A 5I2OA 1CDNA 2ZFDA 1PVBA 3TUYC 2FJYA 2PRUA 4MLWA 1FPWA 5I8NA 3BUWB 3EK4A 2EC6B 1TNWA 3FWBA 1RROA 1Y0VH 1IG5A 3C1VA 3PM8A 1OOJA 1Y1XA 3EKJA 2R2IA 3I5FC 4NDCA 1SCMC 3CR2A 3PM2A 4PE7A 1KCYA 2K7CA 1D1OA 2GGMA 4MRYA 3VRRA 5HYDA 1ZOTB 3UO9A 4WQ2A 2MAZA 3NXAA 1C7VA 5I2LA 3EVUA 1PALA 2M7NA 4I5JA 3BJHA 3KPXA 4ZCVA 5I94A 4P2YB 1B4CA 1XFUO 2L5YA 1MXLC 1BR4B 1DF0A 4M2PA 4ETOA 1KFXS 2CXJA 4ICBA 2KOTA 4NDDA 3SS4A 1J7OA 2BNXA 3OB2B 2LUXA 1N0YA 1SY9A 2L0PA 1QWVA 3L47A 1LA3A 4Q04A 2KI4C 3PATA 1CNPA 5ER5A 1L7ZA 1BU3A 4PCWA 4MZLA 3EK8A
chains in the Genus database with same CATH topology
1NYAA 2F8PA 1YTZC 1K93D 1KSMA 1DJGA 1X02A 5AERA 2OS8B 1RK9A 3GK2A 2ZN8A 5HKZA 1QASA 2LANA 3EK7A 4A4CA 3I5GB 1IJ6A 4ZCUA 5KSZA 1PVAA 2QPTA 1IRJA 1DF0B 1OZOA 3CR4X 1QX5B 2BKIB 3DVJA 2WCEA 2JU0A 3EKHA 3GK1A 5BPJA 1AVSA 1A29A 1S36A 4YGDB 3SIAA 1M63B 1CTRA 4IL1A 5ER4X 4D1EA 1B7TY 2KNEA 3CS1A 3VGOA 1SRAA 1F54A 3LLEA 1F70A 3VROA 1CLLA 1DJXA 2JPTA 3TDZA 1JF2A 2M9GA 1WDCB 3SG3A 1SL9A 1CMFA 3OP0A 3PN7B 4PDZA 1J1EA 1K96A 1H8BA 3AKBA 2E30A 1SL8A 1F4OA 4HRHA 4PALA 5K89A 3TS5C 1OQPA 4GFTA 1SPYA 5DKQA 1CFCA 1IKUA 2JOJA 2K8MB 1YX7A 1GJYA 2M97A 4GPLB 3I5HC 3KO0A 1WLZA 4GGFC 5AXIA 1RECA 2AUCA 2JXLA 2O60A 3EVRA 3NSIA 5GQQC 1ZMZA 3M0WA 3VRNA 5HKYA 1B8CA 2L4HA 3SG5A 1DJIA 2BBNA 1G8IA 2MLFC 2KYCA 4GUKA 3F45A 3EVVA 4MSPA 2H61C 2Q4UA 2PSRA 1EG4A 2K7OA 3PLFB 3NSKA 1TTXA 1PRWA 1AUIB 1GGWA 1HT9A 1MQ1A 1YVLA 1R6PA 1Q80A 2D8NA 4JPZB 3DF0A 3JTDC 1F8HA 3D0YA 1NUBA 1BLQA 1KQMC 2EGDA 2KBIA 2G9BA 2L98A 1UHIA 2F3YA 4QJ4B 1J7QA 2O5GA 2IS9A 2TN4A 1XYDA 5KTYA 2Y4QA 1RWYA 1CMGA 1WLMA 3FS7A 1Y1UA 4C0LA 3HCMA 1J7PA 1FI5A 3KF9A 5FYXA 3OX6A 2WNDA 1V1GA 2BE6A 4OR9B 1JSAA 1SCVA 2M8UA 2LP2A 4A4BA 3D0YB 1CKKA 4OVNF 3O6BA 2K7BA 4PE0A 4E68A 1YR5A 2Y1MA 1W7IB 1A03A 2JC2A 1CFDA 2M3WA 2Y5IA 4XJKA 3IQQA 4QJ5B 3BUNB 1K90D 5DKNA 1L2OC 1OMDA 3BUXB 4MZKA 1CLBA 2RGIA 4M2OA 4ORCB 1N65A 2NCOA 1K94A 1G33A 1GQMA 1HQVA 1NX3A 2MJWB 2JT8A 3GK4X 1Y6WA 3JTDB 2HF5A 5JJGA 5AANA 1N2DA 2LVJA 2BL0C 3WHUB 1BG1A 1TIZA 4I5NB 3SJSA 2F2OA 2ZNDA 1SK6D 1WRZA 1ZUZA 3OX5A 4YBHB 2AAOA 4I5KA 4XJKB 5B8IB 1EH2A 4NQGA 4PE1A 1B8RA 2LHLA 1Y1AA 2EHBA 1K95A 2I2RE 3JVTC 3K21A 1K9UA 3CR5X 5CSNA 1K9PA 2JULA 1CFPA 1NIWA 2HPSA 1C7WA 1MF8B 1W7JB 1CM4A 1NX0A 2HQ8A 1KWOB 3CWGA 1TNXA 2ZNEA 4ORBB 1UP5A 1SR6C 1FF1A 3A8RA 1M45A 2I7AA 2SASA 4PHJA 2JRFA 1PSBA 1DJZA 2L50A 1LA0A 2LAPA 1JFKA 1QVIY 2KHNA 3SG6A 1MUXA 2PMYA 1SMGA 2LUCA 5JOLA 2KSPA 3TUYB 2DOQA 2LNKA 4MBEA 2P6BB 1A75A 1NP8A 4NDBA 3I5FB 1SCMB 1JF0A 1B8LA 5D69A 1J7RA 1NCYA 1V1FA 2BE4A 1S5GY 2OTGC 3TDUA 1XFZO 1DJYA 1IGVA 1K8UA 2CT9A 3JVTB 4XYNA 1LINA 4YGBB 4AQJA 1S3PA 1NWDA 2B1UA 2F3ZA 1QXPA 2WCBA 2HQWA 2Q91A 4HREE 5IBWA 1LXFC 1TN4A 1EL4A 5J3XA 3CLNA 3D10A 2L2EA 2M0RA 2LV7A 2KI4B 2AMIA 3SG2A 2COLB 1A75B 2BCAA 4CFQA 4L9MA 3LK1A 1XK4C 4UPGA 1LKJA 4DCKA 2K61A 1S26D 2MRDA 3BXKA 2VRGA 2ISDA 3BQ3A 1NPQA 1DGVA 2K7DA 4YRUA 3AKAA 4MVFA 2BBMA 4P5OE 3KEVA 2CNPA 1QLKA 4GBAA 1OE9B 2LP3A 3HX4A 4HRGA 2KGBC 5AFPA 1WRLA 1LVCD 1MXEA 1TCOB 2CTNA 2H61A 5PALA 1S1EA 1CM1A 2WOSA 2BCBA 4JQ0D 2KFHA 3BUOB 1B7TZ 1CDLA 1UHKA 4CPVA 1CFFA 1XFXO 2I94A 2LMTA 1UURA 4GNKB 3SG7A 3CTNA 2ZRSA 2EC6C 1F4QA 3TS5B 3WHTB 2ZN9A 1UHJA 3GOFA 2BECA 3I5IC 3I5HB 2KAVA 1ZFSA 1IH0A 1TNPA 4JWQA 1YRUB 3TDIA 3OHMB 5I2QA 1H4BA 2M49B 4CFRA 2M1KB 2JZIA 3OB1B 4YI8A 4OKHA 2LLSA 2WC8A 1BMOA 2L4IA 4AQIA 2LLTA 1EJ3A 1PULA 1QX2A 2M1UA 1S6CA 1FW4A 4DUQA 1DJWA 1KQMB 2SCPA 3KHEA 1NX2A 1UUSA 1YX8A 2E6WA 2LVKA 3AAKA 1F71A 3WNXB 2OS8C 1A4PA 1CLMA 2L51A 1J1DA 2LM5A 2FOTA 2K2FA 5HKWA 1DVIA 1ZACA 4GGNA 5G08A 1QATA 3I5GC 2Y1NA 4AOMA 4C0KA 2JXCA 2LVIA 5TNCA 3TZ1A 1ALWA 1ODBA 1B1GA 1SNLA 2I18A 4OV2A 3VRQA 2JNFA 1IQ5A 1UHHA 1JUOA 1MR8A 2F33A 1EG3A 2GV5A 3AAJA 4YGCB 3I5IB 1C07A 1CDPA 1U5IA 1QV1A 3DD4A 3O4YA 1SW8A 2WORA 1AK8A 1G4YR 4MRXA 4MN0A 1UWOA 1WDCC 4WQ3A 4MZJA 1K2HA 1AJ5A 3PN7C 1JFJA 3MSEB 1IJ5A 1J55A 1KK8C 2L5XB 1YVHA 4PCWA 1QJTA 1L2OB 3NSLA 2NLNA 2JNXA 4I5LB 1BR1B 2MA2A 1DGUA 1FBVA 2PALA 1TRFA 3VRPA 2NCPA 1BF5A 1QLSA 2HETA 1TCFA 3DVEA 4PE4A 1BJFA 1KFUS 2BL0B 2K0JA 1MHOA 2KFFA 2F2PA 1SL7A 3NSOA 1QS7A 1DMOA 2PVBA 2JT3A 1ALVA 4CLNA 1U5IB 2LE9B 2LCPA 2MLEC 5CSIA 1AJ4A 1UHNA 2JTTA 5AEQA 5HLVA 3ZNIA 1OSAA 2JT0A 2NZ0A 4YGAA 2QACA 1S6JA 3PSRA 3SIBA 3A4UB 2MHHA 1CB1A 3FIAA 4WRIA 2KI6C 1KK7Y 5DKRA 2PASA 2KAYA 2KI6D 4N1FA 1IWQA 1XFYO 2KFGA 3BUMB 2KQYA 1JC2A 1PK0D 3IF7A 2A4JA 5CPVA 1BOCA 1BT6A 1XVJA 1NCXA 1RFJA 1SYMA 2OPOA 3O78A 5CSFA 1JWDA 1M39A 1SR6B 3BYAA 2FCDA 4R1EA 2NXQA 4DIRA 3LL8B 3SG4A 1B47A 5D7FA 4OCIA 3CZTX 2JWWA 2LLUA 1KK8B 2ZKMX 1QV0A 4C0JA 3WXAA 4YI9A 1OZSA 2KDHA 1KFXL 1QTXA 2FCEA 2LMVA 1QVIZ 1RTP1 3ZWHA 1SBJA 3PFVA 3CGAA 4GGFA 1AP4A 1XFWO 2K2AA 1KFUL 4PHMA 3DVMA 1B9AA 1XK4A 3LCPC 1JBAA 4GAOA 1YURA 1YRTB 1NX1A 1OMRA 2FJUB 1NCZA 3H4SE 3BOWA 3RM1A 4DRWA 1YUSA 1KSOA 2OTGB 1S5GZ 1QX7A 4FQOA 1XA5A 1XFVO 5KU1A 1EXRA 1VRKA 1F55A 5F6TA 3RLZA 3PALA 1E8AA 2KGRA 4M2QA 4QJ3B 1KK7Z 4PHNA 1R2UA 4U8DA 4BY5A 4N5XA 2WCFA 2GGZA 2BCXA 2H2KA 3ICBA 4USLA 4BY4A 2CBLA 2CCMA 1WY9A 5HLOA 1TOPA 1KQVA 1CDMA 2G2BA 3LK0A 3BOWB 1IQ3A 1K9KA 4F0ZB 1A2XA 3FWCA 4DS7A 5CSJA 3IQOA 1KWOC 3DF0B 4TNCA 4HSZA 1AHRA 1TNQA 4PHKA 1BODA 4MEWA 2LHIA 1S6IA 1XO5A 2KAXA 3DVKA 3O2PA 3QRXA 2LMUA 1DTLA 2JTZA 1RJVA 2M7LA 4FTGA 1YUUA 1DJHA 1YUTA 2MBXA 1QIVA 2KBMA 1GGZA 2BKHB 1DT7B 4ORAB 1MWNA 1PSRA 1OMVA 4YGEB 1FI6A 1WRKA 2KQ6A 1QIWA 1M46A 2KYFA 4CIDA 1SKTA 1NSHA 2JQ6A 1M31A 2LC5A 2LVVA 2M29A 2ZRTA 3E3RA 4N1GA 2V53A 5I2OA 1CDNA 2ZFDA 1PVBA 3TUYC 4MLWA 2PRUA 1FPWA 5I8NA 3BUWB 3EK4A 2EC6B 1TNWA 3FWBA 1RROA 1Y0VH 1IG5A 3C1VA 3PM8A 1OOJA 1Y1XA 3EKJA 2R2IA 3I5FC 4NDCA 1SCMC 3CR2A 4PE7A 1KCYA 2K7CA 1D1OA 2GGMA 4MRYA 3VRRA 5HYDA 1ZOTB 4WQ2A 2MAZA 3NXAA 1C7VA 5I2LA 3EVUA 1PALA 2M7NA 4I5JA 3KPXA 4ZCVA 4P2YB 1B4CA 1XFUO 1MXLC 1BR4B 1DF0A 4M2PA 4ETOA 1KFXS 2CXJA 4ICBA 2KOTA 4NDDA 1J7OA 3OB2B 2LUXA 1N0YA 1SY9A 2L0PA 1LA3A 4Q04A 2KI4C 3PATA 1CNPA 5ER5A 1L7ZA 1BU3A 4MZLA 3EK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYA A;  2F8P A;  1YTZ C;  1K93 D;  1KSM A;  1DJG A;  1X02 A;  5AER A;  2OS8 B;  1RK9 A;  3GK2 A;  2ZN8 A;  5HKZ A;  1QAS A;  2LAN A;  3EK7 A;  4A4C A;  3I5G B;  1IJ6 A;  4ZCU A;  5KSZ A;  1PVA A;  2QPT A;  1IRJ A;  1DF0 B;  1OZO A;  3CR4 X;  1QX5 B;  2BKI B;  3DVJ A;  2WCE A;  2JU0 A;  3EKH A;  3GK1 A;  5BPJ A;  1AVS A;  1A29 A;  1S36 A;  4YGD B;  3SIA A;  1M63 B;  1CTR A;  4IL1 A;  5ER4 X;  4D1E A;  1B7T Y;  2KNE A;  3CS1 A;  3VGO A;  1SRA A;  1F54 A;  3LLE A;  1F70 A;  3VRO A;  1CLL A;  1DJX A;  2JPT A;  3TDZ A;  1JF2 A;  2M9G A;  1WDC B;  3SG3 A;  1SL9 A;  1CMF A;  3OP0 A;  3PN7 B;  4PDZ A;  1J1E A;  1K96 A;  1H8B A;  3AKB A;  2E30 A;  1SL8 A;  1F4O A;  4HRH A;  4PAL A;  5K89 A;  3TS5 C;  1OQP A;  4GFT A;  1SPY A;  5DKQ A;  1CFC A;  1IKU A;  2JOJ A;  2K8M B;  1YX7 A;  1GJY A;  2M97 A;  4GPL B;  3I5H C;  3KO0 A;  1WLZ A;  4GGF C;  5AXI A;  1REC A;  2AUC A;  2JXL A;  2O60 A;  3EVR A;  3NSI A;  5GQQ C;  1ZMZ A;  3M0W A;  3VRN A;  5HKY A;  1B8C A;  2L4H A;  3SG5 A;  1DJI A;  2BBN A;  1G8I A;  2MLF C;  2KYC A;  4GUK A;  3F45 A;  3EVV A;  4MSP A;  2H61 C;  2Q4U A;  2PSR A;  1EG4 A;  2K7O A;  3PLF B;  3NSK A;  1TTX A;  1PRW A;  1AUI B;  1GGW A;  1HT9 A;  1MQ1 A;  1YVL A;  1R6P A;  1Q80 A;  2D8N A;  4JPZ B;  3DF0 A;  3JTD C;  1F8H A;  3D0Y A;  1NUB A;  1BLQ A;  1KQM C;  2EGD A;  2KBI A;  2G9B A;  2L98 A;  1UHI A;  2F3Y A;  4QJ4 B;  1J7Q A;  2O5G A;  2IS9 A;  2TN4 A;  1XYD A;  5KTY A;  2Y4Q A;  1RWY A;  1CMG A;  1WLM A;  3FS7 A;  1Y1U A;  4C0L A;  3HCM A;  1J7P A;  1FI5 A;  3KF9 A;  5FYX A;  3OX6 A;  2WND A;  1V1G A;  2BE6 A;  4OR9 B;  1JSA A;  1SCV A;  2M8U A;  2LP2 A;  4A4B A;  3D0Y B;  1CKK A;  4OVN F;  3O6B A;  2K7B A;  4PE0 A;  4E68 A;  1YR5 A;  2Y1M A;  1W7I B;  1A03 A;  2JC2 A;  1CFD A;  2M3W A;  2Y5I A;  4XJK A;  3IQQ A;  4QJ5 B;  3BUN B;  1K90 D;  5DKN A;  1L2O C;  1OMD A;  3BUX B;  4MZK A;  1CLB A;  2RGI A;  4M2O A;  4ORC B;  1N65 A;  2NCO A;  1K94 A;  1G33 A;  1GQM A;  1HQV A;  1NX3 A;  2MJW B;  2JT8 A;  3GK4 X;  1Y6W A;  3JTD B;  2HF5 A;  5JJG A;  5AAN A;  1N2D A;  2LVJ A;  2BL0 C;  3WHU B;  1BG1 A;  1TIZ A;  4I5N B;  3SJS A;  2F2O A;  2ZND A;  1SK6 D;  1WRZ A;  1ZUZ A;  3OX5 A;  4YBH B;  2AAO A;  4I5K A;  4XJK B;  5B8I B;  1EH2 A;  4NQG A;  4PE1 A;  1B8R A;  2LHL A;  1Y1A A;  2EHB A;  1K95 A;  2I2R E;  3JVT C;  3K21 A;  1K9U A;  3CR5 X;  5CSN A;  1K9P A;  2JUL A;  1CFP A;  1NIW A;  2HPS A;  1C7W A;  1MF8 B;  1W7J B;  1CM4 A;  1NX0 A;  2HQ8 A;  1KWO B;  3CWG A;  1TNX A;  2ZNE A;  4ORB B;  1UP5 A;  1SR6 C;  1FF1 A;  3A8R A;  1M45 A;  2I7A A;  2SAS A;  4PHJ A;  2JRF A;  1PSB A;  1DJZ A;  2L50 A;  1LA0 A;  2LAP A;  1JFK A;  1QVI Y;  2KHN A;  3SG6 A;  1MUX A;  2PMY A;  1SMG A;  2LUC A;  5JOL A;  2KSP A;  3TUY B;  2DOQ A;  2LNK A;  4MBE A;  2P6B B;  1A75 A;  1NP8 A;  4NDB A;  3I5F B;  1SCM B;  1JF0 A;  1B8L A;  5D69 A;  1J7R A;  1NCY A;  1V1F A;  2BE4 A;  1S5G Y;  2OTG C;  3TDU A;  1XFZ O;  1DJY A;  1IGV A;  1K8U A;  2CT9 A;  3JVT B;  4XYN A;  1LIN A;  4YGB B;  4AQJ A;  1S3P A;  1NWD A;  2B1U A;  2F3Z A;  1QXP A;  2WCB A;  2HQW A;  2Q91 A;  4HRE E;  5IBW A;  1LXF C;  1TN4 A;  1EL4 A;  5J3X A;  3CLN A;  3D10 A;  2L2E A;  2M0R A;  2LV7 A;  2KI4 B;  2AMI A;  3SG2 A;  2COL B;  1A75 B;  2BCA A;  4CFQ A;  4L9M A;  3LK1 A;  1XK4 C;  4UPG A;  1LKJ A;  4DCK A;  2K61 A;  1S26 D;  2MRD A;  3BXK A;  2VRG A;  2ISD A;  3BQ3 A;  1NPQ A;  1DGV A;  2K7D A;  4YRU A;  3AKA A;  4MVF A;  2BBM A;  4P5O E;  3KEV A;  2CNP A;  1QLK A;  4GBA A;  1OE9 B;  2LP3 A;  3HX4 A;  4HRG A;  2KGB C;  5AFP A;  1WRL A;  1LVC D;  1MXE A;  1TCO B;  2CTN A;  2H61 A;  5PAL A;  1S1E A;  1CM1 A;  2WOS A;  2BCB A;  4JQ0 D;  2KFH A;  3BUO B;  1B7T Z;  1CDL A;  1UHK A;  4CPV A;  1CFF A;  1XFX O;  2I94 A;  2LMT A;  1UUR A;  4GNK B;  3SG7 A;  3CTN A;  2ZRS A;  2EC6 C;  1F4Q A;  3TS5 B;  3WHT B;  2ZN9 A;  1UHJ A;  3GOF A;  2BEC A;  3I5I C;  3I5H B;  2KAV A;  1ZFS A;  1IH0 A;  1TNP A;  4JWQ A;  1YRU B;  3TDI A;  3OHM B;  5I2Q A;  1H4B A;  2M49 B;  4CFR A;  2M1K B;  2JZI A;  3OB1 B;  4YI8 A;  4OKH A;  2LLS A;  2WC8 A;  1BMO A;  2L4I A;  4AQI A;  2LLT A;  1EJ3 A;  1PUL A;  1QX2 A;  2M1U A;  1S6C A;  1FW4 A;  4DUQ A;  1DJW A;  1KQM B;  2SCP A;  3KHE A;  1NX2 A;  1UUS A;  1YX8 A;  2E6W A;  2LVK A;  3AAK A;  1F71 A;  3WNX B;  2OS8 C;  1A4P A;  1CLM A;  2L51 A;  1J1D A;  2LM5 A;  2FOT A;  2K2F A;  5HKW A;  1DVI A;  1ZAC A;  4GGN A;  5G08 A;  1QAT A;  3I5G C;  2Y1N A;  4AOM A;  4C0K A;  2JXC A;  2LVI A;  5TNC A;  3TZ1 A;  1ALW A;  1ODB A;  1B1G A;  1SNL A;  2I18 A;  4OV2 A;  3VRQ A;  2JNF A;  1IQ5 A;  1UHH A;  1JUO A;  1MR8 A;  2F33 A;  1EG3 A;  2GV5 A;  3AAJ A;  4YGC B;  3I5I B;  1C07 A;  1CDP A;  1U5I A;  1QV1 A;  3DD4 A;  3O4Y A;  1SW8 A;  2WOR A;  1AK8 A;  1G4Y R;  4MRX A;  4MN0 A;  1UWO A;  1WDC C;  4WQ3 A;  4MZJ A;  1K2H A;  1AJ5 A;  3PN7 C;  1JFJ A;  3MSE B;  1IJ5 A;  1J55 A;  1KK8 C;  2L5X B;  1YVH A;  4PCW A;  1QJT A;  1L2O B;  3NSL A;  2NLN A;  2JNX A;  4I5L B;  1BR1 B;  2MA2 A;  1DGU A;  1FBV A;  2PAL A;  1TRF A;  3VRP A;  2NCP A;  1BF5 A;  1QLS A;  2HET A;  1TCF A;  3DVE A;  4PE4 A;  1BJF A;  1KFU S;  2BL0 B;  2K0J A;  1MHO A;  2KFF A;  2F2P A;  1SL7 A;  3NSO A;  1QS7 A;  1DMO A;  2PVB A;  2JT3 A;  1ALV A;  4CLN A;  1U5I B;  2LE9 B;  2LCP A;  2MLE C;  5CSI A;  1AJ4 A;  1UHN A;  2JTT A;  5AEQ A;  5HLV A;  3ZNI A;  1OSA A;  2JT0 A;  2NZ0 A;  4YGA A;  2QAC A;  1S6J A;  3PSR A;  3SIB A;  3A4U B;  2MHH A;  1CB1 A;  3FIA A;  4WRI A;  2KI6 C;  1KK7 Y;  5DKR A;  2PAS A;  2KAY A;  2KI6 D;  4N1F A;  1IWQ A;  1XFY O;  2KFG A;  3BUM B;  2KQY A;  1JC2 A;  1PK0 D;  3IF7 A;  2A4J A;  5CPV A;  1BOC A;  1BT6 A;  1XVJ A;  1NCX A;  1RFJ A;  1SYM A;  2OPO A;  3O78 A;  5CSF A;  1JWD A;  1M39 A;  1SR6 B;  3BYA A;  2FCD A;  4R1E A;  2NXQ A;  4DIR A;  3LL8 B;  3SG4 A;  1B47 A;  5D7F A;  4OCI A;  3CZT X;  2JWW A;  2LLU A;  1KK8 B;  2ZKM X;  1QV0 A;  4C0J A;  3WXA A;  4YI9 A;  1OZS A;  2KDH A;  1KFX L;  1QTX A;  2FCE A;  2LMV A;  1QVI Z;  1RTP 1;  3ZWH A;  1SBJ A;  3PFV A;  3CGA A;  4GGF A;  1AP4 A;  1XFW O;  2K2A A;  1KFU L;  4PHM A;  3DVM A;  1B9A A;  1XK4 A;  3LCP C;  1JBA A;  4GAO A;  1YUR A;  1YRT B;  1NX1 A;  1OMR A;  2FJU B;  1NCZ A;  3H4S E;  3BOW A;  3RM1 A;  4DRW A;  1YUS A;  1KSO A;  2OTG B;  1S5G Z;  1QX7 A;  4FQO A;  1XA5 A;  1XFV O;  5KU1 A;  1EXR A;  1VRK A;  1F55 A;  5F6T A;  3RLZ A;  3PAL A;  1E8A A;  2KGR A;  4M2Q A;  4QJ3 B;  1KK7 Z;  4PHN A;  1R2U A;  4U8D A;  4BY5 A;  4N5X A;  2WCF A;  2GGZ A;  2BCX A;  2H2K A;  3ICB A;  4USL A;  4BY4 A;  2CBL A;  2CCM A;  1WY9 A;  5HLO A;  1TOP A;  1KQV A;  1CDM A;  2G2B A;  3LK0 A;  3BOW B;  1IQ3 A;  1K9K A;  4F0Z B;  1A2X A;  3FWC A;  4DS7 A;  5CSJ A;  3IQO A;  1KWO C;  3DF0 B;  4TNC A;  4HSZ A;  1AHR A;  1TNQ A;  4PHK A;  1BOD A;  4MEW A;  2LHI A;  1S6I A;  1XO5 A;  2KAX A;  3DVK A;  3O2P A;  3QRX A;  2LMU A;  1DTL A;  2JTZ A;  1RJV A;  2M7L A;  4FTG A;  1YUU A;  1DJH A;  1YUT A;  2MBX A;  1QIV A;  2KBM A;  1GGZ A;  2BKH B;  1DT7 B;  4ORA B;  1MWN A;  1PSR A;  1OMV A;  4YGE B;  1FI6 A;  1WRK A;  2KQ6 A;  1QIW A;  1M46 A;  2KYF A;  4CID A;  1SKT A;  1NSH A;  2JQ6 A;  1M31 A;  2LC5 A;  2LVV A;  2M29 A;  2ZRT A;  3E3R A;  4N1G A;  2V53 A;  5I2O A;  1CDN A;  2ZFD A;  1PVB A;  3TUY C;  4MLW A;  2PRU A;  1FPW A;  5I8N A;  3BUW B;  3EK4 A;  2EC6 B;  1TNW A;  3FWB A;  1RRO A;  1Y0V H;  1IG5 A;  3C1V A;  3PM8 A;  1OOJ A;  1Y1X A;  3EKJ A;  2R2I A;  3I5F C;  4NDC A;  1SCM C;  3CR2 A;  4PE7 A;  1KCY A;  2K7C A;  1D1O A;  2GGM A;  4MRY A;  3VRR A;  5HYD A;  1ZOT B;  4WQ2 A;  2MAZ A;  3NXA A;  1C7V A;  5I2L A;  3EVU A;  1PAL A;  2M7N A;  4I5J A;  3KPX A;  4ZCV A;  4P2Y B;  1B4C A;  1XFU O;  1MXL C;  1BR4 B;  1DF0 A;  4M2P A;  4ETO A;  1KFX S;  2CXJ A;  4ICB A;  2KOT A;  4NDD A;  1J7O A;  3OB2 B;  2LUX A;  1N0Y A;  1SY9 A;  2L0P A;  1LA3 A;  4Q04 A;  2KI4 C;  3PAT A;  1CNP A;  5ER5 A;  1L7Z A;  1BU3 A;  4MZL A;  3EK8 A; 
#chains in the Genus database with same CATH topology
 3BFA A;  1NYA A;  2F8P A;  1T14 A;  3Q8I A;  1YTZ C;  1K93 D;  1TUJ A;  1KSM A;  1DJG A;  1X02 A;  5AER A;  2OS8 B;  1RK9 A;  3GK2 A;  2ZN8 A;  5HKZ A;  1QAS A;  3CAB A;  2LAN A;  3EK7 A;  4A4C A;  3I5G B;  1IJ6 A;  4ZCU A;  5KSZ A;  1PVA A;  2QPT A;  1IRJ A;  1DF0 B;  1OZO A;  3CR4 X;  1QX5 B;  2QEO A;  2BKI B;  3DVJ A;  2WCE A;  2JU0 A;  3EKH A;  3GK1 A;  3SS3 A;  5BPJ A;  1AVS A;  1A29 A;  1S36 A;  4YGD B;  4OZD A;  1M63 B;  3SIA A;  1CTR A;  4IL1 A;  5ER4 X;  4D1E A;  1B7T Y;  2KNE A;  3CS1 A;  3IVT A;  4FQT A;  3VGO A;  1SRA A;  1F54 A;  3LLE A;  1F70 A;  3VRO A;  1CLL A;  1DJX A;  2JPT A;  3TDZ A;  1JF2 A;  2M9G A;  1WDC B;  3SG3 A;  1SL9 A;  1CMF A;  3OP0 A;  3PN7 B;  3FE9 A;  4PDZ A;  1J1E A;  1K96 A;  1H8B A;  3AKB A;  2E30 A;  1SL8 A;  1F4O A;  4HRH A;  4PAL A;  5K89 A;  3TS5 C;  2P71 A;  1OQP A;  4GFT A;  1SPY A;  5DKQ A;  1CFC A;  1IKU A;  2JOJ A;  2K8M B;  1YX7 A;  1GJY A;  2M97 A;  4GPL B;  3I5H C;  3KO0 A;  1WLZ A;  4GGF C;  5AXI A;  1REC A;  2AUC A;  2JXL A;  2KLE A;  2O60 A;  2PQL A;  3EVR A;  1ZMZ A;  3M0W A;  1W9Z A;  3NSI A;  5HKY A;  1B8C A;  2L4H A;  3SG5 A;  1DJI A;  2BBN A;  1G8I A;  2MLF C;  2KYC A;  3R1V A;  4GUK A;  3F45 A;  3S0D A;  3EVV A;  4MSP A;  2H61 C;  2Q4U A;  2PSR A;  1EG4 A;  2K7O A;  3PLF B;  3NSK A;  1TTX A;  1PRW A;  1AUI B;  1GGW A;  1HT9 A;  1MQ1 A;  1YVL A;  1R6P A;  1Q80 A;  2D8N A;  1OOH A;  4JPZ B;  3DF0 A;  3JTD C;  1F8H A;  3D0Y A;  1IIO A;  3OGN A;  1NUB A;  1BLQ A;  1KQM C;  2EGD A;  2KBI A;  2G9B A;  2L98 A;  2WCJ A;  3NHI A;  1UHI A;  2F3Y A;  4QJ4 B;  1J7Q A;  2O5G A;  2IS9 A;  2TN4 A;  1XYD A;  5KTY A;  2Y4Q A;  1RWY A;  1CMG A;  1WLM A;  3FS7 A;  1Y1U A;  4C0L A;  3HCM A;  1J7P A;  1FI5 A;  3KF9 A;  5FYX A;  3OX6 A;  2WND A;  1V1G A;  2BE6 A;  4OR9 B;  1JSA A;  1SCV A;  2M8U A;  2LP2 A;  4A4B A;  3D0Y B;  3S0F A;  1CKK A;  3S0E A;  4OVN F;  3O6B A;  2K7B A;  4PE0 A;  4E68 A;  1YR5 A;  2Y1M A;  1TUZ A;  1W7I B;  3D73 A;  1A03 A;  2JC2 A;  4PT1 A;  1CFD A;  2M3W A;  2Y5I A;  4XJK A;  3IQQ A;  4QJ5 B;  2BAP A;  3BUN B;  3EG5 B;  1K90 D;  3D74 A;  3S0G A;  5DKN A;  1L2O C;  1OMD A;  3BUX B;  4MZK A;  3UNW A;  1CLB A;  2RGI A;  3L4L A;  3O4X A;  1N65 A;  4M2O A;  4ORC B;  2NCO A;  1K94 A;  1G33 A;  1GQM A;  3D75 A;  1HQV A;  1NX3 A;  2MJW B;  2JT8 A;  3GK4 X;  1Y6W A;  3JTD B;  2HF5 A;  5JJG A;  5AAN A;  1N2D A;  2LVJ A;  3QME A;  4JD9 A;  2BL0 C;  3WHU B;  5FI6 A;  5HL1 A;  1BG1 A;  1TIZ A;  3VRN A;  4I5N B;  3SJS A;  2F2O A;  2ZND A;  1SK6 D;  1WRZ A;  1ZUZ A;  3OX5 A;  4F7F A;  4YBH B;  2AAO A;  4I5K A;  4XJK B;  5B8I B;  1EH2 A;  4NQG A;  2ERB A;  4PE1 A;  1B8R A;  2LHL A;  3CZ1 A;  1Y1A A;  3D77 A;  2EHB A;  1K95 A;  2I2R E;  3JVT C;  3K21 A;  1K9U A;  3CR5 X;  5CSN A;  1K9P A;  2JUL A;  1CFP A;  1NIW A;  2HPS A;  1C7W A;  1MF8 B;  1W7J B;  1CM4 A;  1NX0 A;  2HQ8 A;  1KWO B;  3CWG A;  4INX A;  1TNX A;  2ZNE A;  4ORB B;  1UP5 A;  1SR6 C;  1FF1 A;  3A8R A;  1M45 A;  2I7A A;  2SAS A;  1C3Y A;  2H8V A;  4PHJ A;  2JRF A;  1PSB A;  1DJZ A;  2L50 A;  3CDN A;  1LA0 A;  2LAP A;  1JFK A;  1QVI Y;  2KHN A;  3SG6 A;  1OW4 A;  1MUX A;  2PMY A;  3D78 A;  1SMG A;  2KLD A;  2LUC A;  5D3O A;  5JOL A;  2KSP A;  3TUY B;  2DOQ A;  2LNK A;  4MBE A;  2P6B B;  1A75 A;  1NP8 A;  4NDB A;  3I5F B;  3RZS A;  1SCM B;  1JF0 A;  1B8L A;  5D69 A;  1J7R A;  1NCY A;  1V1F A;  1SSE B;  2BE4 A;  2L2C A;  1S5G Y;  1LS8 A;  2OTG C;  3TDU A;  1DC1 A;  1XFZ O;  1DJY A;  1IGV A;  1K8U A;  2WC5 A;  2CT9 A;  3JVT B;  4XYN A;  1LIN A;  4YGB B;  4AQJ A;  1S3P A;  1NWD A;  2B1U A;  2F3Z A;  1QXP A;  2WCB A;  2HQW A;  2Q91 A;  4HRE E;  5IBW A;  3S0B A;  1LXF C;  1TN4 A;  1EL4 A;  2WCH A;  5J3X A;  3CLN A;  3D10 A;  2L2E A;  2M0R A;  2LV7 A;  2KI4 B;  2AMI A;  3SG2 A;  2COL B;  3NHT A;  1A75 B;  2BCA A;  4CFQ A;  4L9M A;  3LK1 A;  1XK4 C;  4UPG A;  1LKJ A;  4DCK A;  2K61 A;  1S26 D;  2MRD A;  3BXK A;  2VRG A;  2WCL A;  3BQ3 A;  2ISD A;  1NPQ A;  1DGV A;  2K7D A;  4YRU A;  3AKA A;  4MVF A;  2BBM A;  4P5O E;  3CYZ A;  3S0A A;  3KEV A;  2CNP A;  1QLK A;  4GBA A;  1OE9 B;  3SS5 A;  2LP3 A;  3HX4 A;  4HRG A;  2KGB C;  5FI7 A;  5AFP A;  1WRL A;  1LVC D;  1MXE A;  1TCO B;  2CTN A;  2H61 A;  5PAL A;  1S1E A;  1CM1 A;  1XFR A;  2WOS A;  2BCB A;  3L4A A;  2KFH A;  4JQ0 D;  3BUO B;  1B7T Z;  1CDL A;  1UHK A;  4CPV A;  1CFF A;  1XFX O;  2I94 A;  2LMT A;  1UUR A;  4GNK B;  3SG7 A;  3CTN A;  2ZRS A;  2PYQ A;  2EC6 C;  3D76 A;  1F4Q A;  3TS5 B;  3WHT B;  2ZN9 A;  3DXL A;  1UHJ A;  3GOF A;  2BEC A;  3I5I C;  1P28 A;  2KAV A;  2QEV A;  3I5H B;  1ZFS A;  1IH0 A;  1TNP A;  4JWQ A;  1YRU B;  2QEB A;  3TDI A;  3OHM B;  5I2Q A;  1H4B A;  2M49 B;  5EL2 A;  4CFR A;  1ORG A;  2M1K B;  2JZI A;  3OB1 B;  1DEL A;  4YI8 A;  1DEK A;  4OKH A;  2LLS A;  2WC8 A;  1BMO A;  2L4I A;  2QEH A;  4AQI A;  2LLT A;  1EJ3 A;  1PUL A;  1QX2 A;  2M1U A;  1S6C A;  1FW4 A;  4DUQ A;  1DJW A;  1KQM B;  5FI2 A;  2SCP A;  3KHE A;  3N7H A;  1NX2 A;  1UUS A;  1YX8 A;  2E6W A;  2LVK A;  3AAK A;  1F71 A;  3WNX B;  3FE8 A;  2OS8 C;  1A4P A;  1CLM A;  2L51 A;  1J1D A;  2LM5 A;  2FOT A;  2K2F A;  2WCM A;  5HKW A;  1DVI A;  1ZAC A;  3B6X A;  4GGN A;  1QAT A;  2WCK A;  3I5G C;  5G08 A;  2Y1N A;  4AOM A;  4C0K A;  2JXC A;  2LVI A;  5TNC A;  3TZ1 A;  1ALW A;  1ODB A;  1B1G A;  1SNL A;  2I18 A;  4OV2 A;  3VRQ A;  2JNF A;  2JPO A;  1IQ5 A;  1UHH A;  1JUO A;  1MR8 A;  2F33 A;  1EG3 A;  2GV5 A;  3AAJ A;  4YGC B;  3I5I B;  1C07 A;  1CDP A;  1U5I A;  1QV1 A;  1TWO A;  3DD4 A;  1SW8 A;  2WOR A;  3O4Y A;  1AK8 A;  1G4Y R;  4MRX A;  4MN0 A;  3DY9 A;  1UWO A;  1WDC C;  4WQ3 A;  4MZJ A;  1K2H A;  1AJ5 A;  3PN7 C;  1JFJ A;  3MSE B;  3R1O A;  1IJ5 A;  1J55 A;  1KK8 C;  2L5X B;  1YVH A;  3B86 A;  1QJT A;  1L2O B;  3NSL A;  2NLN A;  2JNX A;  4I5L B;  1BR1 B;  2MA2 A;  1DGU A;  1FBV A;  2PAL A;  1TRF A;  3NGV A;  3PJI A;  3VRP A;  2NCP A;  1BF5 A;  1QLS A;  2HET A;  1TCF A;  3DVE A;  3BFH A;  4PE4 A;  3BFB A;  3CZ2 A;  1BJF A;  1KFU S;  2BL0 B;  2K0J A;  1MHO A;  2KFF A;  2F2P A;  1SL7 A;  3NSO A;  1QS7 A;  1DMO A;  2PVB A;  2JT3 A;  1ALV A;  4CLN A;  1U5I B;  2LE9 B;  2LCP A;  2MLE C;  5CSI A;  1AJ4 A;  1UHN A;  2JTT A;  5AEQ A;  5HLV A;  3ZNI A;  1OSA A;  2JT0 A;  2NZ0 A;  4YGA A;  2QAC A;  3DYE A;  1S6J A;  3PSR A;  3SIB A;  3A4U B;  2MHH A;  1CB1 A;  1C3Z A;  3FIA A;  4WRI A;  2KI6 C;  1KK7 Y;  5DKR A;  2PAS A;  2KAY A;  2KI6 D;  4N1F A;  2K60 A;  4IJ7 A;  1IWQ A;  1XFY O;  2KFG A;  3BUM B;  2KQY A;  1JC2 A;  1PK0 D;  3IF7 A;  2A4J A;  5CPV A;  1BOC A;  1BT6 A;  1XVJ A;  1SYM A;  1NCX A;  1RFJ A;  2OPO A;  3O78 A;  5CSF A;  1JWD A;  1M39 A;  1SR6 B;  3BYA A;  2FCD A;  4R1E A;  2NXQ A;  4DIR A;  3LL8 B;  3SG4 A;  1Z4H A;  1B47 A;  1OOF A;  5D7F A;  3V2L A;  4OCI A;  3CZT X;  2JWW A;  2LLU A;  3B87 A;  1KK8 B;  2ZKM X;  1QV0 A;  4C0J A;  3WXA A;  4YI9 A;  3K1E A;  1OZS A;  2KDH A;  1KFX L;  1QTX A;  2FCE A;  2LMV A;  1QVI Z;  1RTP 1;  3ZWH A;  1SBJ A;  3PFV A;  3CGA A;  4GGF A;  1AP4 A;  1XFW O;  2K2A A;  1KFU L;  4PHM A;  2WC6 A;  3DVM A;  3VB1 A;  1B9A A;  1XK4 A;  3LCP C;  1JBA A;  1GM0 A;  4GAO A;  1YUR A;  1YRT B;  3R1P A;  1NX1 A;  1OMR A;  2FJU B;  1NCZ A;  3H4S E;  3BOW A;  3RM1 A;  4DRW A;  1YUS A;  1KSO A;  2OTG B;  1S5G Z;  1QX7 A;  4FQO A;  3CZ0 A;  1XA5 A;  1XFV O;  5KU1 A;  1Z2C B;  1EXR A;  1VRK A;  1F55 A;  5F6T A;  3RLZ A;  3PAL A;  1E8A A;  2KGR A;  4M2Q A;  4QJ3 B;  1KK7 Z;  2YGU A;  4PHN A;  1R2U A;  4U8D A;  4BY5 A;  1OOI X;  4N5X A;  1OOG A;  2P70 A;  5DIC A;  2WCF A;  2GGZ A;  2BCX A;  2H2K A;  3ICB A;  4USL A;  4BY4 A;  3DZT A;  2QDI A;  2CBL A;  2CCM A;  3R72 A;  1WY9 A;  5HLO A;  1TOP A;  1KQV A;  1CDM A;  2G2B A;  4KYN A;  3LK0 A;  3B88 A;  3BOW B;  1IQ3 A;  1K9K A;  4F0Z B;  1A2X A;  3FE6 A;  3FWC A;  4DS7 A;  5CSJ A;  3IQO A;  1KWO C;  3DF0 B;  4TNC A;  4HSZ A;  1AHR A;  1TNQ A;  4PHK A;  1BOD A;  4MEW A;  2LHI A;  1S6I A;  1XO5 A;  2KAX A;  3DVK A;  3O2P A;  2KPH A;  2LMU A;  1DTL A;  2JTZ A;  3QRX A;  1RJV A;  5GQQ C;  2M7L A;  4FTG A;  1YUU A;  1DJH A;  1YUT A;  2MBX A;  3OBV A;  1QIV A;  2KBM A;  1GGZ A;  2BKH B;  2GTE A;  1DQE A;  1DT7 B;  4ORA B;  1MWN A;  1PSR A;  1OMV A;  4YGE B;  1FI6 A;  1WRK A;  2KQ6 A;  1QIW A;  1M46 A;  3B7A A;  4JKT A;  2KYF A;  4CID A;  4INW A;  1SKT A;  1NSH A;  2JQ6 A;  1M31 A;  2LC5 A;  2LVV A;  2M29 A;  2ZRT A;  3E3R A;  4N1G A;  2V53 A;  5I2O A;  1CDN A;  2ZFD A;  1PVB A;  3TUY C;  2FJY A;  2PRU A;  4MLW A;  1FPW A;  5I8N A;  3BUW B;  3EK4 A;  2EC6 B;  1TNW A;  3FWB A;  1RRO A;  1Y0V H;  1IG5 A;  3C1V A;  3PM8 A;  1OOJ A;  1Y1X A;  3EKJ A;  2R2I A;  3I5F C;  4NDC A;  1SCM C;  3CR2 A;  3PM2 A;  4PE7 A;  1KCY A;  2K7C A;  1D1O A;  2GGM A;  4MRY A;  3VRR A;  5HYD A;  1ZOT B;  3UO9 A;  4WQ2 A;  2MAZ A;  3NXA A;  1C7V A;  5I2L A;  3EVU A;  1PAL A;  2M7N A;  4I5J A;  3BJH A;  3KPX A;  4ZCV A;  5I94 A;  4P2Y B;  1B4C A;  1XFU O;  2L5Y A;  1MXL C;  1BR4 B;  1DF0 A;  4M2P A;  4ETO A;  1KFX S;  2CXJ A;  4ICB A;  2KOT A;  4NDD A;  3SS4 A;  1J7O A;  2BNX A;  3OB2 B;  2LUX A;  1N0Y A;  1SY9 A;  2L0P A;  1QWV A;  3L47 A;  1LA3 A;  4Q04 A;  2KI4 C;  3PAT A;  1CNP A;  5ER5 A;  1L7Z A;  1BU3 A;  4PCW A;  4MZL A;  3EK8 A; 
#chains in the Genus database with same CATH homology
 1NYA A;  2F8P A;  1YTZ C;  1K93 D;  1KSM A;  1DJG A;  1X02 A;  5AER A;  2OS8 B;  1RK9 A;  3GK2 A;  2ZN8 A;  5HKZ A;  1QAS A;  2LAN A;  3EK7 A;  4A4C A;  3I5G B;  1IJ6 A;  4ZCU A;  5KSZ A;  1PVA A;  2QPT A;  1IRJ A;  1DF0 B;  1OZO A;  3CR4 X;  1QX5 B;  2BKI B;  3DVJ A;  2WCE A;  2JU0 A;  3EKH A;  3GK1 A;  5BPJ A;  1AVS A;  1A29 A;  1S36 A;  4YGD B;  3SIA A;  1M63 B;  1CTR A;  4IL1 A;  5ER4 X;  4D1E A;  1B7T Y;  2KNE A;  3CS1 A;  3VGO A;  1SRA A;  1F54 A;  3LLE A;  1F70 A;  3VRO A;  1CLL A;  1DJX A;  2JPT A;  3TDZ A;  1JF2 A;  2M9G A;  1WDC B;  3SG3 A;  1SL9 A;  1CMF A;  3OP0 A;  3PN7 B;  4PDZ A;  1J1E A;  1K96 A;  1H8B A;  3AKB A;  2E30 A;  1SL8 A;  1F4O A;  4HRH A;  4PAL A;  5K89 A;  3TS5 C;  1OQP A;  4GFT A;  1SPY A;  5DKQ A;  1CFC A;  1IKU A;  2JOJ A;  2K8M B;  1YX7 A;  1GJY A;  2M97 A;  4GPL B;  3I5H C;  3KO0 A;  1WLZ A;  4GGF C;  5AXI A;  1REC A;  2AUC A;  2JXL A;  2O60 A;  3EVR A;  3NSI A;  5GQQ C;  1ZMZ A;  3M0W A;  3VRN A;  5HKY A;  1B8C A;  2L4H A;  3SG5 A;  1DJI A;  2BBN A;  1G8I A;  2MLF C;  2KYC A;  4GUK A;  3F45 A;  3EVV A;  4MSP A;  2H61 C;  2Q4U A;  2PSR A;  1EG4 A;  2K7O A;  3PLF B;  3NSK A;  1TTX A;  1PRW A;  1AUI B;  1GGW A;  1HT9 A;  1MQ1 A;  1YVL A;  1R6P A;  1Q80 A;  2D8N A;  4JPZ B;  3DF0 A;  3JTD C;  1F8H A;  3D0Y A;  1NUB A;  1BLQ A;  1KQM C;  2EGD A;  2KBI A;  2G9B A;  2L98 A;  1UHI A;  2F3Y A;  4QJ4 B;  1J7Q A;  2O5G A;  2IS9 A;  2TN4 A;  1XYD A;  5KTY A;  2Y4Q A;  1RWY A;  1CMG A;  1WLM A;  3FS7 A;  1Y1U A;  4C0L A;  3HCM A;  1J7P A;  1FI5 A;  3KF9 A;  5FYX A;  3OX6 A;  2WND A;  1V1G A;  2BE6 A;  4OR9 B;  1JSA A;  1SCV A;  2M8U A;  2LP2 A;  4A4B A;  3D0Y B;  1CKK A;  4OVN F;  3O6B A;  2K7B A;  4PE0 A;  4E68 A;  1YR5 A;  2Y1M A;  1W7I B;  1A03 A;  2JC2 A;  1CFD A;  2M3W A;  2Y5I A;  4XJK A;  3IQQ A;  4QJ5 B;  3BUN B;  1K90 D;  5DKN A;  1L2O C;  1OMD A;  3BUX B;  4MZK A;  1CLB A;  2RGI A;  4M2O A;  4ORC B;  1N65 A;  2NCO A;  1K94 A;  1G33 A;  1GQM A;  1HQV A;  1NX3 A;  2MJW B;  2JT8 A;  3GK4 X;  1Y6W A;  3JTD B;  2HF5 A;  5JJG A;  5AAN A;  1N2D A;  2LVJ A;  2BL0 C;  3WHU B;  1BG1 A;  1TIZ A;  4I5N B;  3SJS A;  2F2O A;  2ZND A;  1SK6 D;  1WRZ A;  1ZUZ A;  3OX5 A;  4YBH B;  2AAO A;  4I5K A;  4XJK B;  5B8I B;  1EH2 A;  4NQG A;  4PE1 A;  1B8R A;  2LHL A;  1Y1A A;  2EHB A;  1K95 A;  2I2R E;  3JVT C;  3K21 A;  1K9U A;  3CR5 X;  5CSN A;  1K9P A;  2JUL A;  1CFP A;  1NIW A;  2HPS A;  1C7W A;  1MF8 B;  1W7J B;  1CM4 A;  1NX0 A;  2HQ8 A;  1KWO B;  3CWG A;  1TNX A;  2ZNE A;  4ORB B;  1UP5 A;  1SR6 C;  1FF1 A;  3A8R A;  1M45 A;  2I7A A;  2SAS A;  4PHJ A;  2JRF A;  1PSB A;  1DJZ A;  2L50 A;  1LA0 A;  2LAP A;  1JFK A;  1QVI Y;  2KHN A;  3SG6 A;  1MUX A;  2PMY A;  1SMG A;  2LUC A;  5JOL A;  2KSP A;  3TUY B;  2DOQ A;  2LNK A;  4MBE A;  2P6B B;  1A75 A;  1NP8 A;  4NDB A;  3I5F B;  1SCM B;  1JF0 A;  1B8L A;  5D69 A;  1J7R A;  1NCY A;  1V1F A;  2BE4 A;  1S5G Y;  2OTG C;  3TDU A;  1XFZ O;  1DJY A;  1IGV A;  1K8U A;  2CT9 A;  3JVT B;  4XYN A;  1LIN A;  4YGB B;  4AQJ A;  1S3P A;  1NWD A;  2B1U A;  2F3Z A;  1QXP A;  2WCB A;  2HQW A;  2Q91 A;  4HRE E;  5IBW A;  1LXF C;  1TN4 A;  1EL4 A;  5J3X A;  3CLN A;  3D10 A;  2L2E A;  2M0R A;  2LV7 A;  2KI4 B;  2AMI A;  3SG2 A;  2COL B;  1A75 B;  2BCA A;  4CFQ A;  4L9M A;  3LK1 A;  1XK4 C;  4UPG A;  1LKJ A;  4DCK A;  2K61 A;  1S26 D;  2MRD A;  3BXK A;  2VRG A;  2ISD A;  3BQ3 A;  1NPQ A;  1DGV A;  2K7D A;  4YRU A;  3AKA A;  4MVF A;  2BBM A;  4P5O E;  3KEV A;  2CNP A;  1QLK A;  4GBA A;  1OE9 B;  2LP3 A;  3HX4 A;  4HRG A;  2KGB C;  5AFP A;  1WRL A;  1LVC D;  1MXE A;  1TCO B;  2CTN A;  2H61 A;  5PAL A;  1S1E A;  1CM1 A;  2WOS A;  2BCB A;  4JQ0 D;  2KFH A;  3BUO B;  1B7T Z;  1CDL A;  1UHK A;  4CPV A;  1CFF A;  1XFX O;  2I94 A;  2LMT A;  1UUR A;  4GNK B;  3SG7 A;  3CTN A;  2ZRS A;  2EC6 C;  1F4Q A;  3TS5 B;  3WHT B;  2ZN9 A;  1UHJ A;  3GOF A;  2BEC A;  3I5I C;  3I5H B;  2KAV A;  1ZFS A;  1IH0 A;  1TNP A;  4JWQ A;  1YRU B;  3TDI A;  3OHM B;  5I2Q A;  1H4B A;  2M49 B;  4CFR A;  2M1K B;  2JZI A;  3OB1 B;  4YI8 A;  4OKH A;  2LLS A;  2WC8 A;  1BMO A;  2L4I A;  4AQI A;  2LLT A;  1EJ3 A;  1PUL A;  1QX2 A;  2M1U A;  1S6C A;  1FW4 A;  4DUQ A;  1DJW A;  1KQM B;  2SCP A;  3KHE A;  1NX2 A;  1UUS A;  1YX8 A;  2E6W A;  2LVK A;  3AAK A;  1F71 A;  3WNX B;  2OS8 C;  1A4P A;  1CLM A;  2L51 A;  1J1D A;  2LM5 A;  2FOT A;  2K2F A;  5HKW A;  1DVI A;  1ZAC A;  4GGN A;  5G08 A;  1QAT A;  3I5G C;  2Y1N A;  4AOM A;  4C0K A;  2JXC A;  2LVI A;  5TNC A;  3TZ1 A;  1ALW A;  1ODB A;  1B1G A;  1SNL A;  2I18 A;  4OV2 A;  3VRQ A;  2JNF A;  1IQ5 A;  1UHH A;  1JUO A;  1MR8 A;  2F33 A;  1EG3 A;  2GV5 A;  3AAJ A;  4YGC B;  3I5I B;  1C07 A;  1CDP A;  1U5I A;  1QV1 A;  3DD4 A;  3O4Y A;  1SW8 A;  2WOR A;  1AK8 A;  1G4Y R;  4MRX A;  4MN0 A;  1UWO A;  1WDC C;  4WQ3 A;  4MZJ A;  1K2H A;  1AJ5 A;  3PN7 C;  1JFJ A;  3MSE B;  1IJ5 A;  1J55 A;  1KK8 C;  2L5X B;  1YVH A;  4PCW A;  1QJT A;  1L2O B;  3NSL A;  2NLN A;  2JNX A;  4I5L B;  1BR1 B;  2MA2 A;  1DGU A;  1FBV A;  2PAL A;  1TRF A;  3VRP A;  2NCP A;  1BF5 A;  1QLS A;  2HET A;  1TCF A;  3DVE A;  4PE4 A;  1BJF A;  1KFU S;  2BL0 B;  2K0J A;  1MHO A;  2KFF A;  2F2P A;  1SL7 A;  3NSO A;  1QS7 A;  1DMO A;  2PVB A;  2JT3 A;  1ALV A;  4CLN A;  1U5I B;  2LE9 B;  2LCP A;  2MLE C;  5CSI A;  1AJ4 A;  1UHN A;  2JTT A;  5AEQ A;  5HLV A;  3ZNI A;  1OSA A;  2JT0 A;  2NZ0 A;  4YGA A;  2QAC A;  1S6J A;  3PSR A;  3SIB A;  3A4U B;  2MHH A;  1CB1 A;  3FIA A;  4WRI A;  2KI6 C;  1KK7 Y;  5DKR A;  2PAS A;  2KAY A;  2KI6 D;  4N1F A;  1IWQ A;  1XFY O;  2KFG A;  3BUM B;  2KQY A;  1JC2 A;  1PK0 D;  3IF7 A;  2A4J A;  5CPV A;  1BOC A;  1BT6 A;  1XVJ A;  1NCX A;  1RFJ A;  1SYM A;  2OPO A;  3O78 A;  5CSF A;  1JWD A;  1M39 A;  1SR6 B;  3BYA A;  2FCD A;  4R1E A;  2NXQ A;  4DIR A;  3LL8 B;  3SG4 A;  1B47 A;  5D7F A;  4OCI A;  3CZT X;  2JWW A;  2LLU A;  1KK8 B;  2ZKM X;  1QV0 A;  4C0J A;  3WXA A;  4YI9 A;  1OZS A;  2KDH A;  1KFX L;  1QTX A;  2FCE A;  2LMV A;  1QVI Z;  1RTP 1;  3ZWH A;  1SBJ A;  3PFV A;  3CGA A;  4GGF A;  1AP4 A;  1XFW O;  2K2A A;  1KFU L;  4PHM A;  3DVM A;  1B9A A;  1XK4 A;  3LCP C;  1JBA A;  4GAO A;  1YUR A;  1YRT B;  1NX1 A;  1OMR A;  2FJU B;  1NCZ A;  3H4S E;  3BOW A;  3RM1 A;  4DRW A;  1YUS A;  1KSO A;  2OTG B;  1S5G Z;  1QX7 A;  4FQO A;  1XA5 A;  1XFV O;  5KU1 A;  1EXR A;  1VRK A;  1F55 A;  5F6T A;  3RLZ A;  3PAL A;  1E8A A;  2KGR A;  4M2Q A;  4QJ3 B;  1KK7 Z;  4PHN A;  1R2U A;  4U8D A;  4BY5 A;  4N5X A;  2WCF A;  2GGZ A;  2BCX A;  2H2K A;  3ICB A;  4USL A;  4BY4 A;  2CBL A;  2CCM A;  1WY9 A;  5HLO A;  1TOP A;  1KQV A;  1CDM A;  2G2B A;  3LK0 A;  3BOW B;  1IQ3 A;  1K9K A;  4F0Z B;  1A2X A;  3FWC A;  4DS7 A;  5CSJ A;  3IQO A;  1KWO C;  3DF0 B;  4TNC A;  4HSZ A;  1AHR A;  1TNQ A;  4PHK A;  1BOD A;  4MEW A;  2LHI A;  1S6I A;  1XO5 A;  2KAX A;  3DVK A;  3O2P A;  3QRX A;  2LMU A;  1DTL A;  2JTZ A;  1RJV A;  2M7L A;  4FTG A;  1YUU A;  1DJH A;  1YUT A;  2MBX A;  1QIV A;  2KBM A;  1GGZ A;  2BKH B;  1DT7 B;  4ORA B;  1MWN A;  1PSR A;  1OMV A;  4YGE B;  1FI6 A;  1WRK A;  2KQ6 A;  1QIW A;  1M46 A;  2KYF A;  4CID A;  1SKT A;  1NSH A;  2JQ6 A;  1M31 A;  2LC5 A;  2LVV A;  2M29 A;  2ZRT A;  3E3R A;  4N1G A;  2V53 A;  5I2O A;  1CDN A;  2ZFD A;  1PVB A;  3TUY C;  4MLW A;  2PRU A;  1FPW A;  5I8N A;  3BUW B;  3EK4 A;  2EC6 B;  1TNW A;  3FWB A;  1RRO A;  1Y0V H;  1IG5 A;  3C1V A;  3PM8 A;  1OOJ A;  1Y1X A;  3EKJ A;  2R2I A;  3I5F C;  4NDC A;  1SCM C;  3CR2 A;  4PE7 A;  1KCY A;  2K7C A;  1D1O A;  2GGM A;  4MRY A;  3VRR A;  5HYD A;  1ZOT B;  4WQ2 A;  2MAZ A;  3NXA A;  1C7V A;  5I2L A;  3EVU A;  1PAL A;  2M7N A;  4I5J A;  3KPX A;  4ZCV A;  4P2Y B;  1B4C A;  1XFU O;  1MXL C;  1BR4 B;  1DF0 A;  4M2P A;  4ETO A;  1KFX S;  2CXJ A;  4ICB A;  2KOT A;  4NDD A;  1J7O A;  3OB2 B;  2LUX A;  1N0Y A;  1SY9 A;  2L0P A;  1LA3 A;  4Q04 A;  2KI4 C;  3PAT A;  1CNP A;  5ER5 A;  1L7Z A;  1BU3 A;  4MZL A;  3EK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...