1FI5A

Nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords PROTEIN (TROPONIN C)
publication title Solution structures of the C-terminal domain of cardiac troponin C free and bound to the N-terminal domain of cardiac troponin I.
pubmed doi rcsb
source organism Gallus gallus
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi5A00
3EVVA 2MBXA 1KK7Z 1S6IA 2LAPA 1XFUO 1J7PA 1DJGA 3KHEA 2NXQA 3JTDC 4GBAA 4MLWA 1XK4A 1NCYA 1K9PA 2LC5A 5JOLA 3TZ1A 1MQ1A 4CFQA 1TOPA 2JRFA 2F8PA 1UP5A 2KGRA 2R2IA 5DKNA 1A4PA 1CLLA 2P6BB 3I5HC 1TTXA 1N0YA 4ICBA 2BL0B 3TS5C 1F4QA 2OPOA 1SMGA 1NWDA 3I5FC 2LLSA 1KSMA 1RTP1 3IQQA 1NP8A 2CCMA 3NXAA 5ER5A 1BJFA 1KCYA 2KYFA 2HQ8A 1QXPA 4OCIA 2MA2A 2BCAA 1M39A 2WC8A 2LVIA 4YGBB 1RWYA 4FTGA 3EK7A 1BF5A 1DGVA 3CLNA 2MLFC 1M46A 2KOTA 5HKZA 1NYAA 4CPVA 4ZCUA 5BPJA 2V53A 1YX7A 3JVTB 1HT9A 1BR1B 1QLKA 2M49B 4PE0A 1JBAA 4HRHA 1XFZO 2KAVA 2HQWA 2CTNA 1DF0A 1JF2A 5J3XA 2BE6A 3AAKA 2LP2A 1CFDA 4DIRA 1IH0A 1CDMA 4HSZA 1SL8A 2SCPA 2K7DA 3CR4X 3GK4X 1C7WA 1PULA 2LVJA 2MRDA 2WCFA 1GQMA 3CGAA 4OKHA 1IWQA 2GGZA 2BL0C 2K7CA 1LA3A 1K90D 2ZN8A 4PE4A 5I2LA 1PSRA 1ZFSA 2ZRTA 1NPQA 1M31A 2KHNA 2H61C 4MZLA 3BYAA 2M7LA 1B4CA 1FPWA 1G8IA 2PVBA 2F3YA 2LVVA 1EXRA 2PSRA 3TDUA 1IJ5A 1CM4A 4YBHB 1JC2A 1J7RA 1MR8A 5KU1A 1N2DA 1B9AA 4QJ4B 2O60A 3CR5X 4QJ5B 4N1GA 1L7ZA 4I5NB 2M0RA 1B8LA 1YX8A 1DJXA 2KFGA 1K95A 1KK7Y 2GV5A 1SK6D 4YGCB 2BBNA 3WNXB 2LUXA 3PM8A 1B47A 3JVTC 2L4HA 1LVCD 3FWCA 4ZCVA 2JNXA 2EC6B 2SASA 4C0KA 1FI6A 1ZOTB 4CIDA 1AK8A 1EG3A 3F45A 1QV1A 2AAOA 3MSEB 3O6BA 3PALA 1KFXS 4BY5A 1V1GA 1RFJA 1J1DA 1QIVA 3RLZA 1PRWA 1QTXA 2F33A 1U5IB 3NSOA 1B1GA 1VRKA 2M9GA 3EK4A 4L9MA 1WY9A 1XFVO 1NSHA 1TRFA 2KAYA 1EG4A 4MBEA 1ODBA 1CM1A 2ISDA 5DKQA 3KPXA 4OV2A 1XFXO 2LV7A 1BLQA 3FWBA 3BXKA 2EGDA 4CFRA 4CLNA 1KSOA 2JXLA 4ORAB 5CSFA 2BECA 3VGOA 2K2FA 1MUXA 1K9UA 4MZJA 1JWDA 1UHIA 4NDCA 3LK1A 1J1EA 1WDCB 2IS9A 3OB2B 2KI6C 4N1FA 4YGAA 1B8RA 1XFYO 2KYCA 5FYXA 3PN7C 1M63B 3CR2A 1BG1A 1CKKA 3K21A 1K8UA 4MVFA 3H4SE 3KO0A 1XVJA 2LNKA 3FS7A 5HLVA 5HKYA 1DJIA 1MWNA 1YURA 1K2HA 2ZN9A 1QIWA 1NX3A 1WLZA 2CNPA 2RGIA 3BUNB 1EJ3A 2EC6C 1OMRA 2JOJA 2KQYA 2PASA 5B8IB 2JPTA 4PHJA 2Y5IA 4DS7A 1WRKA 2BCBA 3IQOA 2ZKMX 2HETA 2PRUA 5JJGA 2A4JA 4ORCB 1DJZA 3CZTX 1TCFA 3SG6A 3BUMB 3EKHA 1FBVA 4C0JA 4E68A 4YGEB 1UHHA 1IGVA 4WQ3A 1LINA 2KI4B 1S5GZ 3SG3A 1SYMA 2JQ6A 2CBLA 3D0YB 5HYDA 1B7TZ 1Y0VH 1KQVA 1W7IB 1ALVA 2LMVA 2MAZA 1W7JB 1WDCC 2TN4A 2WCEA 1F54A 4BY4A 1MHOA 2KNEA 1K93D 3VRNA 1QV0A 1KFXL 3KEVA 2FJUB 1KFUL 4YGDB 4JQ0D 1A75A 1SL7A 3WXAA 1PVBA 1U5IA 3A4UB 3OHMB 2NLNA 2GGMA 3PATA 1CDLA 1DJYA 3SIAA 3LL8B 1AJ4A 4P5OE 1FI5A 1BU3A 2E6WA 1GGWA 1TCOB 4WQ2A 4DRWA 4PCWA 3TDZA 2LCPA 1UHNA 3PLFB 3SG2A 1DJHA 5GQQC 3NSIA 1DT7B 1WRZA 3I5IB 5HKWA 4MZKA 1WRLA 1IQ5A 4PHNA 1QASA 1SL9A 1YUUA 2BE4A 1G33A 3BUWB 4PDZA 4FQOA 3GOFA 2KI4C 1NCXA 3ZWHA 3SG4A 1UWOA 1CNPA 2L0PA 2Q4UA 2K7BA 1KQMB 4NQGA 3ZNIA 2KSPA 1TNXA 1LXFC 4USLA 1A2XA 2MLEC 4MRYA 1AJ5A 1X02A 2FCDA 3PN7B 1HQVA 2K2AA 2LUCA 3SG5A 1FF1A 3A8RA 1CLMA 1WLMA 1JF0A 1PALA 2JZIA 2L98A 1UHKA 2H61A 1YUTA 1ZUZA 1OMDA 1QX2A 2M97A 2JTTA 4GGFC 3CS1A 2VRGA 1M45A 1SPYA 3WHUB 3DD4A 3LK0A 4I5KA 1KWOB 3D0YA 2KBMA 2LM5A 3IF7A 2BBMA 5I2OA 1MXLC 4MRXA 5IBWA 3VRQA 3OP0A 3I5IC 1R2UA 2JULA 3VRRA 1F55A 2H2KA 1SNLA 2I18A 2WCBA 1SCVA 1L2OB 1ZMZA 2F3ZA 3ICBA 1H8BA 1YTZC 1S5GY 5TNCA 5PALA 3HX4A 3PFVA 3SG7A 2I94A 1J7QA 2D8NA 1B7TY 1GGZA 1SW8A 1K94A 1SY9A 1GJYA 1XA5A 2WNDA 4MEWA 1TNWA 4YRUA 1BODA 1CTRA 3NSLA 4M2OA 1KQMC 2JXCA 1YRTB 1NX0A 2K61A 2I7AA 3AKAA 4DCKA 2MJWB 2B1UA 1C07A 1UURA 2LHIA 4JWQA 3VROA 1E8AA 1JFJA 1CFFA 1OQPA 5K89A 4PHKA 1C7VA 4GUKA 1SR6B 3EKJA 2K8MB 1CMGA 2ZNDA 1DVIA 1XK4C 4F0ZB 1LA0A 1JFKA 4GNKB 2K7OA 5AANA 1AP4A 2E30A 1YVLA 2F2PA 2Y1MA 1NCZA 5ER4X 1IQ3A 4OR9B 4IL1A 1A03A 2JU0A 3GK1A 1KWOC 3BOWB 1TNPA 1TN4A 2BKIB 4N5XA 5AEQA 1LKJA 1YVHA 1CLBA 1SBJA 4D1EA 2ZFDA 1QATA 1QJTA 1YUSA 1RJVA 3DF0B 1F70A 1IRJA 1S6JA 4A4BA 1S26D 1SKTA 1L2OC 3RM1A 1UHJA 5CPVA 5CSIA 5G08A 4PE7A 2BKHB 1CB1A 1JSAA 4NDDA 2NCOA 3OX5A 4XJKB 1ALWA 1PK0D 2LLTA 1F4OA 2I2RE 3TDIA 2Q91A 2JT8A 3O2PA 1PVAA 1TIZA 1S6CA 4HRGA 4R1EA 2HPSA 1OOJA 2ZRSA 2L4IA 3OX6A 1QVIY 4JPZB 1Q80A 1OE9B 2MHHA 3E3RA 4U8DA 4AOMA 2LMTA 5D7FA 1D1OA 1SR6C 4Q04A 2EHBA 2JNFA 3KF9A 1CMFA 2L5XB 1Y1XA 4MN0A 1EL4A 1OSAA 5F6TA 4P2YB 3LLEA 3BUOB 2JTZA 1K9KA 3CTNA 3DVKA 1DGUA 2M1KB 1QLSA 3I5GB 2FOTA 1KK8B 2CXJA 1BR4B 2KAXA 1CDPA 2PALA 1MXEA 5AERA 1SRAA 2PMYA 2COLB 1Y6WA 2KFFA 2AUCA 3NSKA 1H4BA 3DVJA 4M2PA 4DUQA 2OTGB 2F2OA 2WOSA 4ETOA 1NIWA 3SIBA 2L50A 1PSBA 2LMUA 1V1FA 1YRUB 1TNQA 3DVEA 1FW4A 4YI8A 3C1VA 1OZOA 2NCPA 2LVKA 5DKRA 1IJ6A 3M0WA 2LANA 3BOWA 3GK2A 5KSZA 2CT9A 3BUXB 3O78A 1DMOA 2JC2A 4OVNF 4PALA 2OS8B 2O5GA 2L2EA 2QACA 2KQ6A 1CFCA 3OB1B 2ZNEA 4YI9A 3TUYB 1UUSA 1QVIZ 1B8CA 5KTYA 5AFPA 3DF0A 2AMIA 1MF8B 1S3PA 2M29A 3DVMA 2QPTA 4TNCA 1IG5A 1CFPA 2Y4QA 1N65A 1RECA 1NUBA 2JWWA 2KDHA 5CSNA 1DTLA 1DJWA 1JUOA 3D10A 4ORBB 1Y1UA 4WRIA 1J7OA 2KGBC 1RROA 4XJKA 4AQJA 1F71A 3I5GC 1KK8C 1SCMB 2JT0A 1BMOA 1S36A 1RK9A 2G2BA 2LLUA 4PE1A 1YR5A 4C0LA 5I2QA 1F8HA 4GGNA 4I5LB 1CDNA 1A29A 2L51A 2M7NA 2OTGC 3JTDB 3EK8A 4QJ3B 5I8NA 1BOCA 1J55A 1S1EA 3BQ3A 3O4YA 2M3WA 1AVSA 1ZACA 3WHTB 3VRPA 4AQIA 4GGFA 1QS7A 2KFHA 1AUIB 1KFUS 5D69A 1AHRA 3I5HB 2WORA 5HLOA 1A75B 3PSRA 2KI6D 5CSJA 4A4CA 1OZSA 4I5JA 3TS5B 1XO5A 3EVUA 3CWGA 1IKUA 2DOQA 3AKBA 3I5FB 2OS8C 2KBIA 3FIAA 3LCPC 2LP3A 3TUYC 2G9BA 1BT6A 2JT3A 3HCMA 3AAJA 5AXIA 1DF0B 2HF5A 1QX5B 1XYDA 1NX1A 1K96A 1NX2A 2LHLA 2M8UA 1G4YR 3EVRA 3QRXA 4UPGA 2NZ0A 4PHMA 4XYNA 4GAOA 1XFWO 4GPLB 1Y1AA 4M2QA 2LE9B 2K0JA 1R6PA 4HREE 2FCEA 4MSPA 4GFTA 4NDBA 1OMVA 2BCXA 1QX7A 2M1UA 2Y1NA 1EH2A 1SCMC 3SJSA
chains in the Genus database with same CATH superfamily
5FI7A 3EVVA 2MBXA 1KK7Z 1S6IA 2LAPA 3QMEA 1XFUO 1J7PA 3CYZA 1DJGA 1TWOA 3KHEA 2NXQA 3JTDC 4GBAA 4MLWA 1XK4A 1NCYA 1K9PA 2LC5A 5JOLA 3TZ1A 5HL1A 1MQ1A 1Z2CB 1TOPA 4CFQA 2JRFA 2F8PA 1UP5A 2KGRA 2R2IA 5DKNA 1A4PA 1CLLA 2P6BB 3I5HC 1TTXA 3S0GA 1N0YA 3L4LA 2BL0B 4ICBA 3TS5C 1F4QA 2OPOA 1SMGA 1NWDA 3I5FC 3PJIA 2LLSA 1KSMA 4JKTA 1RTP1 3IQQA 1NP8A 2CCMA 3NXAA 5ER5A 1BJFA 1OOGA 1KCYA 2KYFA 2HQ8A 1QXPA 4OCIA 2MA2A 3CZ1A 3SS4A 2BCAA 3CABA 1M39A 2WC8A 2LVIA 5DICA 4YGBB 1RWYA 3B88A 3CDNA 4FTGA 3EK7A 1BF5A 1DGVA 3CLNA 2MLFC 1M46A 2KOTA 5HKZA 1NYAA 4CPVA 4ZCUA 5BPJA 2V53A 1YX7A 3JVTB 1HT9A 1BR1B 1QLKA 2M49B 4PE0A 3IVTA 1JBAA 4HRHA 1XFZO 2KAVA 3B6XA 2HQWA 2CTNA 1DF0A 1JF2A 5J3XA 2BE6A 2K60A 2LP2A 1CFDA 3AAKA 4DIRA 1CDMA 1IH0A 2WCMA 4HSZA 1SL8A 2SCPA 1ORGA 2K7DA 3CR4X 3GK4X 1C7WA 1PULA 2LVJA 2MRDA 2WCFA 1GQMA 3CGAA 4OKHA 1IWQA 2GGZA 2BL0C 2K7CA 1LA3A 1K90D 2ZN8A 4PE4A 3SS3A 5I2LA 1PSRA 1ZFSA 2ZRTA 1NPQA 1M31A 2KHNA 2H61C 3BJHA 4MZLA 3BYAA 2M7LA 1B4CA 1FPWA 1G8IA 2PVBA 2F3YA 3OGNA 1SSEB 2LVVA 3DY9A 1EXRA 2PSRA 3BFBA 3TDUA 1IJ5A 1CM4A 2QEOA 4YBHB 1J7RA 1JC2A 3D77A 1MR8A 3Q8IA 5KU1A 2L5YA 1DC1A 3EG5B 4JD9A 1N2DA 1B9AA 4QJ4B 2O60A 3CR5X 4QJ5B 1QWVA 4N1GA 1L7ZA 4I5NB 2M0RA 1B8LA 1YX8A 1DJXA 2KFGA 1K95A 1KK7Y 2GV5A 1SK6D 3R1VA 2BBNA 2ERBA 2LUXA 3PM2A 4YGCB 3WNXB 3PM8A 3R1OA 1B47A 3JVTC 2L4HA 1LVCD 3FWCA 4ZCVA 2JNXA 2EC6B 2SASA 4C0KA 1FI6A 1ZOTB 2WCHA 2P71A 4CIDA 1AK8A 4INWA 1EG3A 3F45A 1QV1A 2AAOA 3MSEB 3O6BA 3PALA 1KFXS 4BY5A 1V1GA 1RFJA 1J1DA 1QIVA 3S0EA 3SS5A 3RLZA 1PRWA 1QTXA 2F33A 1U5IB 3NSOA 1B1GA 1VRKA 2M9GA 3EK4A 4L9MA 1WY9A 1XFVO 1NSHA 1TRFA 2KAYA 1EG4A 4MBEA 1ODBA 1CM1A 2ISDA 5DKQA 3KPXA 3B87A 4OV2A 1XFXO 2LV7A 1BLQA 3FWBA 2QDIA 3BXKA 2EGDA 4CFRA 4CLNA 1KSOA 2JXLA 4ORAB 5CSFA 2BECA 3VGOA 2K2FA 3S0BA 1MUXA 1K9UA 4MZJA 1JWDA 1UHIA 4NDCA 3LK1A 1J1EA 1WDCB 3B86A 2IS9A 3FE8A 3OB2B 3FE6A 2KI6C 4N1FA 4YGAA 1B8RA 1XFYO 2KYCA 5FYXA 3PN7C 1M63B 3CR2A 1BG1A 1CKKA 3K21A 1K8UA 4MVFA 3H4SE 3KO0A 1XVJA 2LNKA 3FS7A 5HLVA 5HKYA 1DJIA 1MWNA 1YURA 1K2HA 2ZN9A 5D3OA 1QIWA 1NX3A 1WLZA 2CNPA 2RGIA 3BUNB 2WC5A 1EJ3A 2EC6C 1OMRA 2JOJA 2KQYA 3D75A 2PASA 5B8IB 2JPTA 2P70A 2WCLA 4PHJA 2Y5IA 4DS7A 1WRKA 2BCBA 1OW4A 3IQOA 2ZKMX 2HETA 2PRUA 5JJGA 2A4JA 3VB1A 4ORCB 1DJZA 3CZTX 1TCFA 3SG6A 2KLDA 3BUMB 3EKHA 1FBVA 3DYEA 3UNWA 4C0JA 4E68A 4YGEB 1UHHA 1IGVA 4WQ3A 1LINA 2KI4B 1S5GZ 2QEVA 1SYMA 2JQ6A 3S0DA 2CBLA 3NHIA 3SG3A 3D0YB 5HYDA 1B7TZ 1Y0VH 1KQVA 1W7IB 1ALVA 2LMVA 2MAZA 1W7JB 1WDCC 2TN4A 2WCEA 1F54A 4BY4A 1MHOA 2KNEA 1K93D 3VRNA 3S0FA 1QV0A 1KFXL 3KEVA 2FJUB 1KFUL 4YGDB 4JQ0D 1GM0A 1A75A 3DZTA 1SL7A 3WXAA 1PVBA 1U5IA 3A4UB 3D73A 3OHMB 2NLNA 2GGMA 3PATA 1CDLA 1DJYA 3SIAA 3LL8B 1AJ4A 4P5OE 1FI5A 1BU3A 2E6WA 1GGWA 1W9ZA 1TCOB 4WQ2A 4DRWA 4PCWA 3TDZA 2LCPA 1UHNA 3PLFB 3SG2A 1DJHA 5GQQC 3NSIA 3R1PA 1DT7B 1WRZA 3I5IB 4INXA 5HKWA 1TUZA 4MZKA 1WRLA 1IQ5A 4PHNA 2BAPA 1QASA 1C3ZA 5FI2A 1SL9A 1YUUA 2BE4A 1G33A 3BUWB 2L2CA 4PDZA 4FQOA 1OOHA 3GOFA 1C3YA 2KI4C 1NCXA 3ZWHA 3SG4A 1UWOA 2H8VA 1CNPA 2L0PA 4F7FA 2Q4UA 2K7BA 1KQMB 4NQGA 3ZNIA 2KSPA 1TNXA 1LXFC 4USLA 1A2XA 2MLEC 4MRYA 1AJ5A 1TUJA 1X02A 2FCDA 1HQVA 2K2AA 2LUCA 3PN7B 3SG5A 1FF1A 3A8RA 1CLMA 2GTEA 1WLMA 1JF0A 1PALA 2JZIA 2L98A 1UHKA 2H61A 3UO9A 1YUTA 1ZUZA 1OMDA 1QX2A 2M97A 1XFRA 2JPOA 2JTTA 4GGFC 3CS1A 2VRGA 1M45A 1SPYA 3WHUB 3DD4A 3LK0A 4I5KA 1KWOB 3D0YA 2KBMA 2LM5A 3IF7A 2BBMA 4KYNA 1MXLC 4MRXA 5I2OA 5IBWA 3L47A 3VRQA 3OP0A 3I5IC 1R2UA 2JULA 3VRRA 1F55A 2H2KA 1SNLA 2I18A 2WCBA 1SCVA 5I94A 1L2OB 1ZMZA 2F3ZA 3ICBA 1H8BA 1YTZC 1S5GY 3BFAA 5PALA 5TNCA 3HX4A 3PFVA 3SG7A 2I94A 1J7QA 2D8NA 1B7TY 1GGZA 1XA5A 1SW8A 1K94A 1GJYA 1SY9A 2WNDA 1LS8A 1TNWA 3D78A 4MEWA 1CTRA 2QEHA 3NSLA 1KQMC 2JXCA 1YRTB 4M2OA 1NX0A 2K61A 2I7AA 3AKAA 4DCKA 2MJWB 3OBVA 2B1UA 1C07A 1UURA 2LHIA 4JWQA 3VROA 1E8AA 1JFJA 1CFFA 1OQPA 5K89A 4PHKA 1C7VA 1DELA 2PYQA 4GUKA 1SR6B 3EKJA 2K8MB 5EL2A 1CMGA 3BFHA 2ZNDA 1DVIA 1XK4C 4F0ZB 3K1EA 1LA0A 1JFKA 4GNKB 2K7OA 2KLEA 5AANA 1AP4A 2E30A 1YVLA 2F2PA 2Y1MA 1NCZA 3NHTA 5ER4X 4OR9B 4IL1A 1IQ3A 3D76A 1A03A 3FE9A 2JU0A 3GK1A 1KWOC 3BOWB 4PT1A 2YGUA 2BNXA 1TNPA 1TN4A 2BKIB 4N5XA 5AEQA 1LKJA 1YVHA 2QEBA 1CLBA 1SBJA 4D1EA 2ZFDA 1QATA 1QJTA 1YUSA 1DQEA 1RJVA 3DF0B 4IJ7A 1F70A 1IRJA 1S6JA 4A4BA 1S26D 1SKTA 1L2OC 3RM1A 1UHJA 5CPVA 3S0AA 5CSIA 5G08A 4PE7A 2BKHB 1CB1A 1JSAA 4NDDA 2NCOA 3OX5A 1DEKA 4XJKB 1ALWA 1PK0D 2PQLA 2LLTA 1F4OA 2I2RE 3TDIA 2Q91A 2JT8A 1OOIX 3O2PA 1PVAA 1TIZA 1S6CA 4HRGA 4R1EA 2HPSA 1OOJA 2ZRSA 2L4IA 3OX6A 1QVIY 4JPZB 1Q80A 1OE9B 2MHHA 3E3RA 4U8DA 3R72A 2LMTA 5D7FA 4AOMA 1D1OA 1SR6C 4Q04A 2EHBA 2JNFA 3KF9A 3D74A 1CMFA 2L5XB 1Y1XA 4MN0A 1EL4A 1OSAA 5F6TA 4P2YB 1OOFA 3LLEA 3BUOB 2JTZA 1K9KA 3CTNA 3DVKA 1DGUA 2M1KB 1QLSA 3I5GB 2FOTA 1KK8B 2CXJA 1BR4B 2KAXA 1CDPA 2PALA 1MXEA 5AERA 1SRAA 2PMYA 2COLB 1Y6WA 2KFFA 2AUCA 3NSKA 1H4BA 3DVJA 4YRUA 3NGVA 4M2PA 4DUQA 2OTGB 2F2OA 2WOSA 4ETOA 1NIWA 3SIBA 2L50A 1PSBA 2LMUA 1V1FA 1YRUB 1TNQA 3DVEA 1FW4A 4YI8A 3C1VA 1OZOA 2NCPA 3O4XA 2LVKA 5DKRA 1BODA 1IJ6A 3M0WA 2LANA 3BOWA 3GK2A 5KSZA 2CT9A 2FJYA 3BUXB 3O78A 2JC2A 4OVNF 1DMOA 4PALA 2OS8B 2O5GA 4OZDA 1T14A 2L2EA 2QACA 2KPHA 2KQ6A 3CZ0A 3OB1B 2ZNEA 4YI9A 3TUYB 1UUSA 1QVIZ 1CFCA 1B8CA 5KTYA 5AFPA 3DF0A 2AMIA 1MF8B 1S3PA 2M29A 3DVMA 2QPTA 4TNCA 1IG5A 1CFPA 2Y4QA 1N65A 1RECA 1NUBA 2JWWA 2KDHA 2WC6A 5CSNA 1DTLA 2WCJA 1DJWA 1JUOA 3D10A 4ORBB 1Y1UA 4WRIA 1J7OA 2KGBC 1RROA 4XJKA 4AQJA 1F71A 3I5GC 1KK8C 1SCMB 2JT0A 1IIOA 2WCKA 1BMOA 1S36A 1RK9A 2G2BA 2LLUA 4PE1A 1YR5A 4C0LA 5I2QA 1F8HA 4GGNA 4I5LB 1CDNA 1A29A 2L51A 2M7NA 2OTGC 3JTDB 3EK8A 4QJ3B 5I8NA 1BOCA 1J55A 1S1EA 3BQ3A 3O4YA 2M3WA 1AVSA 1ZACA 3WHTB 3VRPA 4AQIA 4GGFA 1QS7A 2KFHA 1AUIB 1KFUS 5D69A 1AHRA 3I5HB 2WORA 5HLOA 1A75B 3PSRA 2KI6D 5CSJA 4A4CA 1OZSA 1P28A 4I5JA 1XO5A 5FI6A 3EVUA 3TS5B 3CWGA 1IKUA 2DOQA 3AKBA 3I5FB 2OS8C 2KBIA 3FIAA 3LCPC 2LP3A 3DXLA 2G9BA 3TUYC 1BT6A 2JT3A 3HCMA 3L4AA 3AAJA 5AXIA 1DF0B 2HF5A 1XYDA 1QX5B 1NX1A 1K96A 1NX2A 2LHLA 2M8UA 1G4YR 3EVRA 3N7HA 3QRXA 4UPGA 3RZSA 4FQTA 1Z4HA 2NZ0A 4PHMA 3B7AA 4GAOA 4XYNA 1XFWO 3V2LA 4GPLB 1Y1AA 4M2QA 2LE9B 2K0JA 1R6PA 4HREE 2FCEA 4MSPA 4GFTA 4NDBA 1OMVA 2BCXA 1QX7A 2M1UA 2Y1NA 1EH2A 1SCMC 3CZ2A 3SJSA
chains in the Genus database with same CATH topology
3EVVA 2MBXA 1KK7Z 1S6IA 2LAPA 1XFUO 1J7PA 1DJGA 3KHEA 2NXQA 3JTDC 4GBAA 4MLWA 1XK4A 1NCYA 1K9PA 2LC5A 5JOLA 3TZ1A 1MQ1A 4CFQA 1TOPA 2JRFA 2F8PA 1UP5A 2KGRA 2R2IA 5DKNA 1A4PA 1CLLA 2P6BB 3I5HC 1TTXA 1N0YA 4ICBA 2BL0B 3TS5C 1F4QA 2OPOA 1SMGA 1NWDA 3I5FC 2LLSA 1KSMA 1RTP1 3IQQA 1NP8A 2CCMA 3NXAA 5ER5A 1BJFA 1KCYA 2KYFA 2HQ8A 1QXPA 4OCIA 2MA2A 2BCAA 1M39A 2WC8A 2LVIA 4YGBB 1RWYA 4FTGA 3EK7A 1BF5A 1DGVA 3CLNA 2MLFC 1M46A 2KOTA 5HKZA 1NYAA 4CPVA 4ZCUA 5BPJA 2V53A 1YX7A 3JVTB 1HT9A 1BR1B 1QLKA 2M49B 4PE0A 1JBAA 4HRHA 1XFZO 2KAVA 2HQWA 2CTNA 1DF0A 1JF2A 5J3XA 2BE6A 3AAKA 2LP2A 1CFDA 4DIRA 1IH0A 1CDMA 4HSZA 1SL8A 2SCPA 2K7DA 3CR4X 3GK4X 1C7WA 1PULA 2LVJA 2MRDA 2WCFA 1GQMA 3CGAA 4OKHA 1IWQA 2GGZA 2BL0C 2K7CA 1LA3A 1K90D 2ZN8A 4PE4A 5I2LA 1PSRA 1ZFSA 2ZRTA 1NPQA 1M31A 2KHNA 2H61C 4MZLA 3BYAA 2M7LA 1B4CA 1FPWA 1G8IA 2PVBA 2F3YA 2LVVA 1EXRA 2PSRA 3TDUA 1IJ5A 1CM4A 4YBHB 1JC2A 1J7RA 1MR8A 5KU1A 1N2DA 1B9AA 4QJ4B 2O60A 3CR5X 4QJ5B 4N1GA 1L7ZA 4I5NB 2M0RA 1B8LA 1YX8A 1DJXA 2KFGA 1K95A 1KK7Y 2GV5A 1SK6D 4YGCB 2BBNA 3WNXB 2LUXA 3PM8A 1B47A 3JVTC 2L4HA 1LVCD 3FWCA 4ZCVA 2JNXA 2EC6B 2SASA 4C0KA 1FI6A 1ZOTB 4CIDA 1AK8A 1EG3A 3F45A 1QV1A 2AAOA 3MSEB 3O6BA 3PALA 1KFXS 4BY5A 1V1GA 1RFJA 1J1DA 1QIVA 3RLZA 1PRWA 1QTXA 2F33A 1U5IB 3NSOA 1B1GA 1VRKA 2M9GA 3EK4A 4L9MA 1WY9A 1XFVO 1NSHA 1TRFA 2KAYA 1EG4A 4MBEA 1ODBA 1CM1A 2ISDA 5DKQA 3KPXA 4OV2A 1XFXO 2LV7A 1BLQA 3FWBA 3BXKA 2EGDA 4CFRA 4CLNA 1KSOA 2JXLA 4ORAB 5CSFA 2BECA 3VGOA 2K2FA 1MUXA 1K9UA 4MZJA 1JWDA 1UHIA 4NDCA 3LK1A 1J1EA 1WDCB 2IS9A 3OB2B 2KI6C 4N1FA 4YGAA 1B8RA 1XFYO 2KYCA 5FYXA 3PN7C 1M63B 3CR2A 1BG1A 1CKKA 3K21A 1K8UA 4MVFA 3H4SE 3KO0A 1XVJA 2LNKA 3FS7A 5HLVA 5HKYA 1DJIA 1MWNA 1YURA 1K2HA 2ZN9A 1QIWA 1NX3A 1WLZA 2CNPA 2RGIA 3BUNB 1EJ3A 2EC6C 1OMRA 2JOJA 2KQYA 2PASA 5B8IB 2JPTA 4PHJA 2Y5IA 4DS7A 1WRKA 2BCBA 3IQOA 2ZKMX 2HETA 2PRUA 5JJGA 2A4JA 4ORCB 1DJZA 3CZTX 1TCFA 3SG6A 3BUMB 3EKHA 1FBVA 4C0JA 4E68A 4YGEB 1UHHA 1IGVA 4WQ3A 1LINA 2KI4B 1S5GZ 3SG3A 1SYMA 2JQ6A 2CBLA 3D0YB 5HYDA 1B7TZ 1Y0VH 1KQVA 1W7IB 1ALVA 2LMVA 2MAZA 1W7JB 1WDCC 2TN4A 2WCEA 1F54A 4BY4A 1MHOA 2KNEA 1K93D 3VRNA 1QV0A 1KFXL 3KEVA 2FJUB 1KFUL 4YGDB 4JQ0D 1A75A 1SL7A 3WXAA 1PVBA 1U5IA 3A4UB 3OHMB 2NLNA 2GGMA 3PATA 1CDLA 1DJYA 3SIAA 3LL8B 1AJ4A 4P5OE 1FI5A 1BU3A 2E6WA 1GGWA 1TCOB 4WQ2A 4DRWA 4PCWA 3TDZA 2LCPA 1UHNA 3PLFB 3SG2A 1DJHA 5GQQC 3NSIA 1DT7B 1WRZA 3I5IB 5HKWA 4MZKA 1WRLA 1IQ5A 4PHNA 1QASA 1SL9A 1YUUA 2BE4A 1G33A 3BUWB 4PDZA 4FQOA 3GOFA 2KI4C 1NCXA 3ZWHA 3SG4A 1UWOA 1CNPA 2L0PA 2Q4UA 2K7BA 1KQMB 4NQGA 3ZNIA 2KSPA 1TNXA 1LXFC 4USLA 1A2XA 2MLEC 4MRYA 1AJ5A 1X02A 2FCDA 3PN7B 1HQVA 2K2AA 2LUCA 3SG5A 1FF1A 3A8RA 1CLMA 1WLMA 1JF0A 1PALA 2JZIA 2L98A 1UHKA 2H61A 1YUTA 1ZUZA 1OMDA 1QX2A 2M97A 2JTTA 4GGFC 3CS1A 2VRGA 1M45A 1SPYA 3WHUB 3DD4A 3LK0A 4I5KA 1KWOB 3D0YA 2KBMA 2LM5A 3IF7A 2BBMA 5I2OA 1MXLC 4MRXA 5IBWA 3VRQA 3OP0A 3I5IC 1R2UA 2JULA 3VRRA 1F55A 2H2KA 1SNLA 2I18A 2WCBA 1SCVA 1L2OB 1ZMZA 2F3ZA 3ICBA 1H8BA 1YTZC 1S5GY 5TNCA 5PALA 3HX4A 3PFVA 3SG7A 2I94A 1J7QA 2D8NA 1B7TY 1GGZA 1SW8A 1K94A 1SY9A 1GJYA 1XA5A 2WNDA 4MEWA 1TNWA 4YRUA 1BODA 1CTRA 3NSLA 4M2OA 1KQMC 2JXCA 1YRTB 1NX0A 2K61A 2I7AA 3AKAA 4DCKA 2MJWB 2B1UA 1C07A 1UURA 2LHIA 4JWQA 3VROA 1E8AA 1JFJA 1CFFA 1OQPA 5K89A 4PHKA 1C7VA 4GUKA 1SR6B 3EKJA 2K8MB 1CMGA 2ZNDA 1DVIA 1XK4C 4F0ZB 1LA0A 1JFKA 4GNKB 2K7OA 5AANA 1AP4A 2E30A 1YVLA 2F2PA 2Y1MA 1NCZA 5ER4X 1IQ3A 4OR9B 4IL1A 1A03A 2JU0A 3GK1A 1KWOC 3BOWB 1TNPA 1TN4A 2BKIB 4N5XA 5AEQA 1LKJA 1YVHA 1CLBA 1SBJA 4D1EA 2ZFDA 1QATA 1QJTA 1YUSA 1RJVA 3DF0B 1F70A 1IRJA 1S6JA 4A4BA 1S26D 1SKTA 1L2OC 3RM1A 1UHJA 5CPVA 5CSIA 5G08A 4PE7A 2BKHB 1CB1A 1JSAA 4NDDA 2NCOA 3OX5A 4XJKB 1ALWA 1PK0D 2LLTA 1F4OA 2I2RE 3TDIA 2Q91A 2JT8A 3O2PA 1PVAA 1TIZA 1S6CA 4HRGA 4R1EA 2HPSA 1OOJA 2ZRSA 2L4IA 3OX6A 1QVIY 4JPZB 1Q80A 1OE9B 2MHHA 3E3RA 4U8DA 4AOMA 2LMTA 5D7FA 1D1OA 1SR6C 4Q04A 2EHBA 2JNFA 3KF9A 1CMFA 2L5XB 1Y1XA 4MN0A 1EL4A 1OSAA 5F6TA 4P2YB 3LLEA 3BUOB 2JTZA 1K9KA 3CTNA 3DVKA 1DGUA 2M1KB 1QLSA 3I5GB 2FOTA 1KK8B 2CXJA 1BR4B 2KAXA 1CDPA 2PALA 1MXEA 5AERA 1SRAA 2PMYA 2COLB 1Y6WA 2KFFA 2AUCA 3NSKA 1H4BA 3DVJA 4M2PA 4DUQA 2OTGB 2F2OA 2WOSA 4ETOA 1NIWA 3SIBA 2L50A 1PSBA 2LMUA 1V1FA 1YRUB 1TNQA 3DVEA 1FW4A 4YI8A 3C1VA 1OZOA 2NCPA 2LVKA 5DKRA 1IJ6A 3M0WA 2LANA 3BOWA 3GK2A 5KSZA 2CT9A 3BUXB 3O78A 1DMOA 2JC2A 4OVNF 4PALA 2OS8B 2O5GA 2L2EA 2QACA 2KQ6A 1CFCA 3OB1B 2ZNEA 4YI9A 3TUYB 1UUSA 1QVIZ 1B8CA 5KTYA 5AFPA 3DF0A 2AMIA 1MF8B 1S3PA 2M29A 3DVMA 2QPTA 4TNCA 1IG5A 1CFPA 2Y4QA 1N65A 1RECA 1NUBA 2JWWA 2KDHA 5CSNA 1DTLA 1DJWA 1JUOA 3D10A 4ORBB 1Y1UA 4WRIA 1J7OA 2KGBC 1RROA 4XJKA 4AQJA 1F71A 3I5GC 1KK8C 1SCMB 2JT0A 1BMOA 1S36A 1RK9A 2G2BA 2LLUA 4PE1A 1YR5A 4C0LA 5I2QA 1F8HA 4GGNA 4I5LB 1CDNA 1A29A 2L51A 2M7NA 2OTGC 3JTDB 3EK8A 4QJ3B 5I8NA 1BOCA 1J55A 1S1EA 3BQ3A 3O4YA 2M3WA 1AVSA 1ZACA 3WHTB 3VRPA 4AQIA 4GGFA 1QS7A 2KFHA 1AUIB 1KFUS 5D69A 1AHRA 3I5HB 2WORA 5HLOA 1A75B 3PSRA 2KI6D 5CSJA 4A4CA 1OZSA 4I5JA 3TS5B 1XO5A 3EVUA 3CWGA 1IKUA 2DOQA 3AKBA 3I5FB 2OS8C 2KBIA 3FIAA 3LCPC 2LP3A 3TUYC 2G9BA 1BT6A 2JT3A 3HCMA 3AAJA 5AXIA 1DF0B 2HF5A 1QX5B 1XYDA 1NX1A 1K96A 1NX2A 2LHLA 2M8UA 1G4YR 3EVRA 3QRXA 4UPGA 2NZ0A 4PHMA 4XYNA 4GAOA 1XFWO 4GPLB 1Y1AA 4M2QA 2LE9B 2K0JA 1R6PA 4HREE 2FCEA 4MSPA 4GFTA 4NDBA 1OMVA 2BCXA 1QX7A 2M1UA 2Y1NA 1EH2A 1SCMC 3SJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVV A;  2MBX A;  1KK7 Z;  1S6I A;  2LAP A;  1XFU O;  1J7P A;  1DJG A;  3KHE A;  2NXQ A;  3JTD C;  4GBA A;  4MLW A;  1XK4 A;  1NCY A;  1K9P A;  2LC5 A;  5JOL A;  3TZ1 A;  1MQ1 A;  4CFQ A;  1TOP A;  2JRF A;  2F8P A;  1UP5 A;  2KGR A;  2R2I A;  5DKN A;  1A4P A;  1CLL A;  2P6B B;  3I5H C;  1TTX A;  1N0Y A;  4ICB A;  2BL0 B;  3TS5 C;  1F4Q A;  2OPO A;  1SMG A;  1NWD A;  3I5F C;  2LLS A;  1KSM A;  1RTP 1;  3IQQ A;  1NP8 A;  2CCM A;  3NXA A;  5ER5 A;  1BJF A;  1KCY A;  2KYF A;  2HQ8 A;  1QXP A;  4OCI A;  2MA2 A;  2BCA A;  1M39 A;  2WC8 A;  2LVI A;  4YGB B;  1RWY A;  4FTG A;  3EK7 A;  1BF5 A;  1DGV A;  3CLN A;  2MLF C;  1M46 A;  2KOT A;  5HKZ A;  1NYA A;  4CPV A;  4ZCU A;  5BPJ A;  2V53 A;  1YX7 A;  3JVT B;  1HT9 A;  1BR1 B;  1QLK A;  2M49 B;  4PE0 A;  1JBA A;  4HRH A;  1XFZ O;  2KAV A;  2HQW A;  2CTN A;  1DF0 A;  1JF2 A;  5J3X A;  2BE6 A;  3AAK A;  2LP2 A;  1CFD A;  4DIR A;  1IH0 A;  1CDM A;  4HSZ A;  1SL8 A;  2SCP A;  2K7D A;  3CR4 X;  3GK4 X;  1C7W A;  1PUL A;  2LVJ A;  2MRD A;  2WCF A;  1GQM A;  3CGA A;  4OKH A;  1IWQ A;  2GGZ A;  2BL0 C;  2K7C A;  1LA3 A;  1K90 D;  2ZN8 A;  4PE4 A;  5I2L A;  1PSR A;  1ZFS A;  2ZRT A;  1NPQ A;  1M31 A;  2KHN A;  2H61 C;  4MZL A;  3BYA A;  2M7L A;  1B4C A;  1FPW A;  1G8I A;  2PVB A;  2F3Y A;  2LVV A;  1EXR A;  2PSR A;  3TDU A;  1IJ5 A;  1CM4 A;  4YBH B;  1JC2 A;  1J7R A;  1MR8 A;  5KU1 A;  1N2D A;  1B9A A;  4QJ4 B;  2O60 A;  3CR5 X;  4QJ5 B;  4N1G A;  1L7Z A;  4I5N B;  2M0R A;  1B8L A;  1YX8 A;  1DJX A;  2KFG A;  1K95 A;  1KK7 Y;  2GV5 A;  1SK6 D;  4YGC B;  2BBN A;  3WNX B;  2LUX A;  3PM8 A;  1B47 A;  3JVT C;  2L4H A;  1LVC D;  3FWC A;  4ZCV A;  2JNX A;  2EC6 B;  2SAS A;  4C0K A;  1FI6 A;  1ZOT B;  4CID A;  1AK8 A;  1EG3 A;  3F45 A;  1QV1 A;  2AAO A;  3MSE B;  3O6B A;  3PAL A;  1KFX S;  4BY5 A;  1V1G A;  1RFJ A;  1J1D A;  1QIV A;  3RLZ A;  1PRW A;  1QTX A;  2F33 A;  1U5I B;  3NSO A;  1B1G A;  1VRK A;  2M9G A;  3EK4 A;  4L9M A;  1WY9 A;  1XFV O;  1NSH A;  1TRF A;  2KAY A;  1EG4 A;  4MBE A;  1ODB A;  1CM1 A;  2ISD A;  5DKQ A;  3KPX A;  4OV2 A;  1XFX O;  2LV7 A;  1BLQ A;  3FWB A;  3BXK A;  2EGD A;  4CFR A;  4CLN A;  1KSO A;  2JXL A;  4ORA B;  5CSF A;  2BEC A;  3VGO A;  2K2F A;  1MUX A;  1K9U A;  4MZJ A;  1JWD A;  1UHI A;  4NDC A;  3LK1 A;  1J1E A;  1WDC B;  2IS9 A;  3OB2 B;  2KI6 C;  4N1F A;  4YGA A;  1B8R A;  1XFY O;  2KYC A;  5FYX A;  3PN7 C;  1M63 B;  3CR2 A;  1BG1 A;  1CKK A;  3K21 A;  1K8U A;  4MVF A;  3H4S E;  3KO0 A;  1XVJ A;  2LNK A;  3FS7 A;  5HLV A;  5HKY A;  1DJI A;  1MWN A;  1YUR A;  1K2H A;  2ZN9 A;  1QIW A;  1NX3 A;  1WLZ A;  2CNP A;  2RGI A;  3BUN B;  1EJ3 A;  2EC6 C;  1OMR A;  2JOJ A;  2KQY A;  2PAS A;  5B8I B;  2JPT A;  4PHJ A;  2Y5I A;  4DS7 A;  1WRK A;  2BCB A;  3IQO A;  2ZKM X;  2HET A;  2PRU A;  5JJG A;  2A4J A;  4ORC B;  1DJZ A;  3CZT X;  1TCF A;  3SG6 A;  3BUM B;  3EKH A;  1FBV A;  4C0J A;  4E68 A;  4YGE B;  1UHH A;  1IGV A;  4WQ3 A;  1LIN A;  2KI4 B;  1S5G Z;  3SG3 A;  1SYM A;  2JQ6 A;  2CBL A;  3D0Y B;  5HYD A;  1B7T Z;  1Y0V H;  1KQV A;  1W7I B;  1ALV A;  2LMV A;  2MAZ A;  1W7J B;  1WDC C;  2TN4 A;  2WCE A;  1F54 A;  4BY4 A;  1MHO A;  2KNE A;  1K93 D;  3VRN A;  1QV0 A;  1KFX L;  3KEV A;  2FJU B;  1KFU L;  4YGD B;  4JQ0 D;  1A75 A;  1SL7 A;  3WXA A;  1PVB A;  1U5I A;  3A4U B;  3OHM B;  2NLN A;  2GGM A;  3PAT A;  1CDL A;  1DJY A;  3SIA A;  3LL8 B;  1AJ4 A;  4P5O E;  1FI5 A;  1BU3 A;  2E6W A;  1GGW A;  1TCO B;  4WQ2 A;  4DRW A;  4PCW A;  3TDZ A;  2LCP A;  1UHN A;  3PLF B;  3SG2 A;  1DJH A;  5GQQ C;  3NSI A;  1DT7 B;  1WRZ A;  3I5I B;  5HKW A;  4MZK A;  1WRL A;  1IQ5 A;  4PHN A;  1QAS A;  1SL9 A;  1YUU A;  2BE4 A;  1G33 A;  3BUW B;  4PDZ A;  4FQO A;  3GOF A;  2KI4 C;  1NCX A;  3ZWH A;  3SG4 A;  1UWO A;  1CNP A;  2L0P A;  2Q4U A;  2K7B A;  1KQM B;  4NQG A;  3ZNI A;  2KSP A;  1TNX A;  1LXF C;  4USL A;  1A2X A;  2MLE C;  4MRY A;  1AJ5 A;  1X02 A;  2FCD A;  3PN7 B;  1HQV A;  2K2A A;  2LUC A;  3SG5 A;  1FF1 A;  3A8R A;  1CLM A;  1WLM A;  1JF0 A;  1PAL A;  2JZI A;  2L98 A;  1UHK A;  2H61 A;  1YUT A;  1ZUZ A;  1OMD A;  1QX2 A;  2M97 A;  2JTT A;  4GGF C;  3CS1 A;  2VRG A;  1M45 A;  1SPY A;  3WHU B;  3DD4 A;  3LK0 A;  4I5K A;  1KWO B;  3D0Y A;  2KBM A;  2LM5 A;  3IF7 A;  2BBM A;  5I2O A;  1MXL C;  4MRX A;  5IBW A;  3VRQ A;  3OP0 A;  3I5I C;  1R2U A;  2JUL A;  3VRR A;  1F55 A;  2H2K A;  1SNL A;  2I18 A;  2WCB A;  1SCV A;  1L2O B;  1ZMZ A;  2F3Z A;  3ICB A;  1H8B A;  1YTZ C;  1S5G Y;  5TNC A;  5PAL A;  3HX4 A;  3PFV A;  3SG7 A;  2I94 A;  1J7Q A;  2D8N A;  1B7T Y;  1GGZ A;  1SW8 A;  1K94 A;  1SY9 A;  1GJY A;  1XA5 A;  2WND A;  4MEW A;  1TNW A;  4YRU A;  1BOD A;  1CTR A;  3NSL A;  4M2O A;  1KQM C;  2JXC A;  1YRT B;  1NX0 A;  2K61 A;  2I7A A;  3AKA A;  4DCK A;  2MJW B;  2B1U A;  1C07 A;  1UUR A;  2LHI A;  4JWQ A;  3VRO A;  1E8A A;  1JFJ A;  1CFF A;  1OQP A;  5K89 A;  4PHK A;  1C7V A;  4GUK A;  1SR6 B;  3EKJ A;  2K8M B;  1CMG A;  2ZND A;  1DVI A;  1XK4 C;  4F0Z B;  1LA0 A;  1JFK A;  4GNK B;  2K7O A;  5AAN A;  1AP4 A;  2E30 A;  1YVL A;  2F2P A;  2Y1M A;  1NCZ A;  5ER4 X;  1IQ3 A;  4OR9 B;  4IL1 A;  1A03 A;  2JU0 A;  3GK1 A;  1KWO C;  3BOW B;  1TNP A;  1TN4 A;  2BKI B;  4N5X A;  5AEQ A;  1LKJ A;  1YVH A;  1CLB A;  1SBJ A;  4D1E A;  2ZFD A;  1QAT A;  1QJT A;  1YUS A;  1RJV A;  3DF0 B;  1F70 A;  1IRJ A;  1S6J A;  4A4B A;  1S26 D;  1SKT A;  1L2O C;  3RM1 A;  1UHJ A;  5CPV A;  5CSI A;  5G08 A;  4PE7 A;  2BKH B;  1CB1 A;  1JSA A;  4NDD A;  2NCO A;  3OX5 A;  4XJK B;  1ALW A;  1PK0 D;  2LLT A;  1F4O A;  2I2R E;  3TDI A;  2Q91 A;  2JT8 A;  3O2P A;  1PVA A;  1TIZ A;  1S6C A;  4HRG A;  4R1E A;  2HPS A;  1OOJ A;  2ZRS A;  2L4I A;  3OX6 A;  1QVI Y;  4JPZ B;  1Q80 A;  1OE9 B;  2MHH A;  3E3R A;  4U8D A;  4AOM A;  2LMT A;  5D7F A;  1D1O A;  1SR6 C;  4Q04 A;  2EHB A;  2JNF A;  3KF9 A;  1CMF A;  2L5X B;  1Y1X A;  4MN0 A;  1EL4 A;  1OSA A;  5F6T A;  4P2Y B;  3LLE A;  3BUO B;  2JTZ A;  1K9K A;  3CTN A;  3DVK A;  1DGU A;  2M1K B;  1QLS A;  3I5G B;  2FOT A;  1KK8 B;  2CXJ A;  1BR4 B;  2KAX A;  1CDP A;  2PAL A;  1MXE A;  5AER A;  1SRA A;  2PMY A;  2COL B;  1Y6W A;  2KFF A;  2AUC A;  3NSK A;  1H4B A;  3DVJ A;  4M2P A;  4DUQ A;  2OTG B;  2F2O A;  2WOS A;  4ETO A;  1NIW A;  3SIB A;  2L50 A;  1PSB A;  2LMU A;  1V1F A;  1YRU B;  1TNQ A;  3DVE A;  1FW4 A;  4YI8 A;  3C1V A;  1OZO A;  2NCP A;  2LVK A;  5DKR A;  1IJ6 A;  3M0W A;  2LAN A;  3BOW A;  3GK2 A;  5KSZ A;  2CT9 A;  3BUX B;  3O78 A;  1DMO A;  2JC2 A;  4OVN F;  4PAL A;  2OS8 B;  2O5G A;  2L2E A;  2QAC A;  2KQ6 A;  1CFC A;  3OB1 B;  2ZNE A;  4YI9 A;  3TUY B;  1UUS A;  1QVI Z;  1B8C A;  5KTY A;  5AFP A;  3DF0 A;  2AMI A;  1MF8 B;  1S3P A;  2M29 A;  3DVM A;  2QPT A;  4TNC A;  1IG5 A;  1CFP A;  2Y4Q A;  1N65 A;  1REC A;  1NUB A;  2JWW A;  2KDH A;  5CSN A;  1DTL A;  1DJW A;  1JUO A;  3D10 A;  4ORB B;  1Y1U A;  4WRI A;  1J7O A;  2KGB C;  1RRO A;  4XJK A;  4AQJ A;  1F71 A;  3I5G C;  1KK8 C;  1SCM B;  2JT0 A;  1BMO A;  1S36 A;  1RK9 A;  2G2B A;  2LLU A;  4PE1 A;  1YR5 A;  4C0L A;  5I2Q A;  1F8H A;  4GGN A;  4I5L B;  1CDN A;  1A29 A;  2L51 A;  2M7N A;  2OTG C;  3JTD B;  3EK8 A;  4QJ3 B;  5I8N A;  1BOC A;  1J55 A;  1S1E A;  3BQ3 A;  3O4Y A;  2M3W A;  1AVS A;  1ZAC A;  3WHT B;  3VRP A;  4AQI A;  4GGF A;  1QS7 A;  2KFH A;  1AUI B;  1KFU S;  5D69 A;  1AHR A;  3I5H B;  2WOR A;  5HLO A;  1A75 B;  3PSR A;  2KI6 D;  5CSJ A;  4A4C A;  1OZS A;  4I5J A;  3TS5 B;  1XO5 A;  3EVU A;  3CWG A;  1IKU A;  2DOQ A;  3AKB A;  3I5F B;  2OS8 C;  2KBI A;  3FIA A;  3LCP C;  2LP3 A;  3TUY C;  2G9B A;  1BT6 A;  2JT3 A;  3HCM A;  3AAJ A;  5AXI A;  1DF0 B;  2HF5 A;  1QX5 B;  1XYD A;  1NX1 A;  1K96 A;  1NX2 A;  2LHL A;  2M8U A;  1G4Y R;  3EVR A;  3QRX A;  4UPG A;  2NZ0 A;  4PHM A;  4XYN A;  4GAO A;  1XFW O;  4GPL B;  1Y1A A;  4M2Q A;  2LE9 B;  2K0J A;  1R6P A;  4HRE E;  2FCE A;  4MSP A;  4GFT A;  4NDB A;  1OMV A;  2BCX A;  1QX7 A;  2M1U A;  2Y1N A;  1EH2 A;  1SCM C;  3SJS A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  3EVV A;  2MBX A;  1KK7 Z;  1S6I A;  2LAP A;  3QME A;  1XFU O;  1J7P A;  3CYZ A;  1DJG A;  1TWO A;  3KHE A;  2NXQ A;  3JTD C;  4GBA A;  4MLW A;  1XK4 A;  1NCY A;  1K9P A;  2LC5 A;  5JOL A;  3TZ1 A;  5HL1 A;  1MQ1 A;  1Z2C B;  1TOP A;  4CFQ A;  2JRF A;  2F8P A;  1UP5 A;  2KGR A;  2R2I A;  5DKN A;  1A4P A;  1CLL A;  2P6B B;  3I5H C;  1TTX A;  3S0G A;  1N0Y A;  3L4L A;  2BL0 B;  4ICB A;  3TS5 C;  1F4Q A;  2OPO A;  1SMG A;  1NWD A;  3I5F C;  3PJI A;  2LLS A;  1KSM A;  4JKT A;  1RTP 1;  3IQQ A;  1NP8 A;  2CCM A;  3NXA A;  5ER5 A;  1BJF A;  1OOG A;  1KCY A;  2KYF A;  2HQ8 A;  1QXP A;  4OCI A;  2MA2 A;  3CZ1 A;  3SS4 A;  2BCA A;  3CAB A;  1M39 A;  2WC8 A;  2LVI A;  5DIC A;  4YGB B;  1RWY A;  3B88 A;  3CDN A;  4FTG A;  3EK7 A;  1BF5 A;  1DGV A;  3CLN A;  2MLF C;  1M46 A;  2KOT A;  5HKZ A;  1NYA A;  4CPV A;  4ZCU A;  5BPJ A;  2V53 A;  1YX7 A;  3JVT B;  1HT9 A;  1BR1 B;  1QLK A;  2M49 B;  4PE0 A;  3IVT A;  1JBA A;  4HRH A;  1XFZ O;  2KAV A;  3B6X A;  2HQW A;  2CTN A;  1DF0 A;  1JF2 A;  5J3X A;  2BE6 A;  2K60 A;  2LP2 A;  1CFD A;  3AAK A;  4DIR A;  1CDM A;  1IH0 A;  2WCM A;  4HSZ A;  1SL8 A;  2SCP A;  1ORG A;  2K7D A;  3CR4 X;  3GK4 X;  1C7W A;  1PUL A;  2LVJ A;  2MRD A;  2WCF A;  1GQM A;  3CGA A;  4OKH A;  1IWQ A;  2GGZ A;  2BL0 C;  2K7C A;  1LA3 A;  1K90 D;  2ZN8 A;  4PE4 A;  3SS3 A;  5I2L A;  1PSR A;  1ZFS A;  2ZRT A;  1NPQ A;  1M31 A;  2KHN A;  2H61 C;  3BJH A;  4MZL A;  3BYA A;  2M7L A;  1B4C A;  1FPW A;  1G8I A;  2PVB A;  2F3Y A;  3OGN A;  1SSE B;  2LVV A;  3DY9 A;  1EXR A;  2PSR A;  3BFB A;  3TDU A;  1IJ5 A;  1CM4 A;  2QEO A;  4YBH B;  1J7R A;  1JC2 A;  3D77 A;  1MR8 A;  3Q8I A;  5KU1 A;  2L5Y A;  1DC1 A;  3EG5 B;  4JD9 A;  1N2D A;  1B9A A;  4QJ4 B;  2O60 A;  3CR5 X;  4QJ5 B;  1QWV A;  4N1G A;  1L7Z A;  4I5N B;  2M0R A;  1B8L A;  1YX8 A;  1DJX A;  2KFG A;  1K95 A;  1KK7 Y;  2GV5 A;  1SK6 D;  3R1V A;  2BBN A;  2ERB A;  2LUX A;  3PM2 A;  4YGC B;  3WNX B;  3PM8 A;  3R1O A;  1B47 A;  3JVT C;  2L4H A;  1LVC D;  3FWC A;  4ZCV A;  2JNX A;  2EC6 B;  2SAS A;  4C0K A;  1FI6 A;  1ZOT B;  2WCH A;  2P71 A;  4CID A;  1AK8 A;  4INW A;  1EG3 A;  3F45 A;  1QV1 A;  2AAO A;  3MSE B;  3O6B A;  3PAL A;  1KFX S;  4BY5 A;  1V1G A;  1RFJ A;  1J1D A;  1QIV A;  3S0E A;  3SS5 A;  3RLZ A;  1PRW A;  1QTX A;  2F33 A;  1U5I B;  3NSO A;  1B1G A;  1VRK A;  2M9G A;  3EK4 A;  4L9M A;  1WY9 A;  1XFV O;  1NSH A;  1TRF A;  2KAY A;  1EG4 A;  4MBE A;  1ODB A;  1CM1 A;  2ISD A;  5DKQ A;  3KPX A;  3B87 A;  4OV2 A;  1XFX O;  2LV7 A;  1BLQ A;  3FWB A;  2QDI A;  3BXK A;  2EGD A;  4CFR A;  4CLN A;  1KSO A;  2JXL A;  4ORA B;  5CSF A;  2BEC A;  3VGO A;  2K2F A;  3S0B A;  1MUX A;  1K9U A;  4MZJ A;  1JWD A;  1UHI A;  4NDC A;  3LK1 A;  1J1E A;  1WDC B;  3B86 A;  2IS9 A;  3FE8 A;  3OB2 B;  3FE6 A;  2KI6 C;  4N1F A;  4YGA A;  1B8R A;  1XFY O;  2KYC A;  5FYX A;  3PN7 C;  1M63 B;  3CR2 A;  1BG1 A;  1CKK A;  3K21 A;  1K8U A;  4MVF A;  3H4S E;  3KO0 A;  1XVJ A;  2LNK A;  3FS7 A;  5HLV A;  5HKY A;  1DJI A;  1MWN A;  1YUR A;  1K2H A;  2ZN9 A;  5D3O A;  1QIW A;  1NX3 A;  1WLZ A;  2CNP A;  2RGI A;  3BUN B;  2WC5 A;  1EJ3 A;  2EC6 C;  1OMR A;  2JOJ A;  2KQY A;  3D75 A;  2PAS A;  5B8I B;  2JPT A;  2P70 A;  2WCL A;  4PHJ A;  2Y5I A;  4DS7 A;  1WRK A;  2BCB A;  1OW4 A;  3IQO A;  2ZKM X;  2HET A;  2PRU A;  5JJG A;  2A4J A;  3VB1 A;  4ORC B;  1DJZ A;  3CZT X;  1TCF A;  3SG6 A;  2KLD A;  3BUM B;  3EKH A;  1FBV A;  3DYE A;  3UNW A;  4C0J A;  4E68 A;  4YGE B;  1UHH A;  1IGV A;  4WQ3 A;  1LIN A;  2KI4 B;  1S5G Z;  2QEV A;  1SYM A;  2JQ6 A;  3S0D A;  2CBL A;  3NHI A;  3SG3 A;  3D0Y B;  5HYD A;  1B7T Z;  1Y0V H;  1KQV A;  1W7I B;  1ALV A;  2LMV A;  2MAZ A;  1W7J B;  1WDC C;  2TN4 A;  2WCE A;  1F54 A;  4BY4 A;  1MHO A;  2KNE A;  1K93 D;  3VRN A;  3S0F A;  1QV0 A;  1KFX L;  3KEV A;  2FJU B;  1KFU L;  4YGD B;  4JQ0 D;  1GM0 A;  1A75 A;  3DZT A;  1SL7 A;  3WXA A;  1PVB A;  1U5I A;  3A4U B;  3D73 A;  3OHM B;  2NLN A;  2GGM A;  3PAT A;  1CDL A;  1DJY A;  3SIA A;  3LL8 B;  1AJ4 A;  4P5O E;  1FI5 A;  1BU3 A;  2E6W A;  1GGW A;  1W9Z A;  1TCO B;  4WQ2 A;  4DRW A;  4PCW A;  3TDZ A;  2LCP A;  1UHN A;  3PLF B;  3SG2 A;  1DJH A;  5GQQ C;  3NSI A;  3R1P A;  1DT7 B;  1WRZ A;  3I5I B;  4INX A;  5HKW A;  1TUZ A;  4MZK A;  1WRL A;  1IQ5 A;  4PHN A;  2BAP A;  1QAS A;  1C3Z A;  5FI2 A;  1SL9 A;  1YUU A;  2BE4 A;  1G33 A;  3BUW B;  2L2C A;  4PDZ A;  4FQO A;  1OOH A;  3GOF A;  1C3Y A;  2KI4 C;  1NCX A;  3ZWH A;  3SG4 A;  1UWO A;  2H8V A;  1CNP A;  2L0P A;  4F7F A;  2Q4U A;  2K7B A;  1KQM B;  4NQG A;  3ZNI A;  2KSP A;  1TNX A;  1LXF C;  4USL A;  1A2X A;  2MLE C;  4MRY A;  1AJ5 A;  1TUJ A;  1X02 A;  2FCD A;  1HQV A;  2K2A A;  2LUC A;  3PN7 B;  3SG5 A;  1FF1 A;  3A8R A;  1CLM A;  2GTE A;  1WLM A;  1JF0 A;  1PAL A;  2JZI A;  2L98 A;  1UHK A;  2H61 A;  3UO9 A;  1YUT A;  1ZUZ A;  1OMD A;  1QX2 A;  2M97 A;  1XFR A;  2JPO A;  2JTT A;  4GGF C;  3CS1 A;  2VRG A;  1M45 A;  1SPY A;  3WHU B;  3DD4 A;  3LK0 A;  4I5K A;  1KWO B;  3D0Y A;  2KBM A;  2LM5 A;  3IF7 A;  2BBM A;  4KYN A;  1MXL C;  4MRX A;  5I2O A;  5IBW A;  3L47 A;  3VRQ A;  3OP0 A;  3I5I C;  1R2U A;  2JUL A;  3VRR A;  1F55 A;  2H2K A;  1SNL A;  2I18 A;  2WCB A;  1SCV A;  5I94 A;  1L2O B;  1ZMZ A;  2F3Z A;  3ICB A;  1H8B A;  1YTZ C;  1S5G Y;  3BFA A;  5PAL A;  5TNC A;  3HX4 A;  3PFV A;  3SG7 A;  2I94 A;  1J7Q A;  2D8N A;  1B7T Y;  1GGZ A;  1XA5 A;  1SW8 A;  1K94 A;  1GJY A;  1SY9 A;  2WND A;  1LS8 A;  1TNW A;  3D78 A;  4MEW A;  1CTR A;  2QEH A;  3NSL A;  1KQM C;  2JXC A;  1YRT B;  4M2O A;  1NX0 A;  2K61 A;  2I7A A;  3AKA A;  4DCK A;  2MJW B;  3OBV A;  2B1U A;  1C07 A;  1UUR A;  2LHI A;  4JWQ A;  3VRO A;  1E8A A;  1JFJ A;  1CFF A;  1OQP A;  5K89 A;  4PHK A;  1C7V A;  1DEL A;  2PYQ A;  4GUK A;  1SR6 B;  3EKJ A;  2K8M B;  5EL2 A;  1CMG A;  3BFH A;  2ZND A;  1DVI A;  1XK4 C;  4F0Z B;  3K1E A;  1LA0 A;  1JFK A;  4GNK B;  2K7O A;  2KLE A;  5AAN A;  1AP4 A;  2E30 A;  1YVL A;  2F2P A;  2Y1M A;  1NCZ A;  3NHT A;  5ER4 X;  4OR9 B;  4IL1 A;  1IQ3 A;  3D76 A;  1A03 A;  3FE9 A;  2JU0 A;  3GK1 A;  1KWO C;  3BOW B;  4PT1 A;  2YGU A;  2BNX A;  1TNP A;  1TN4 A;  2BKI B;  4N5X A;  5AEQ A;  1LKJ A;  1YVH A;  2QEB A;  1CLB A;  1SBJ A;  4D1E A;  2ZFD A;  1QAT A;  1QJT A;  1YUS A;  1DQE A;  1RJV A;  3DF0 B;  4IJ7 A;  1F70 A;  1IRJ A;  1S6J A;  4A4B A;  1S26 D;  1SKT A;  1L2O C;  3RM1 A;  1UHJ A;  5CPV A;  3S0A A;  5CSI A;  5G08 A;  4PE7 A;  2BKH B;  1CB1 A;  1JSA A;  4NDD A;  2NCO A;  3OX5 A;  1DEK A;  4XJK B;  1ALW A;  1PK0 D;  2PQL A;  2LLT A;  1F4O A;  2I2R E;  3TDI A;  2Q91 A;  2JT8 A;  1OOI X;  3O2P A;  1PVA A;  1TIZ A;  1S6C A;  4HRG A;  4R1E A;  2HPS A;  1OOJ A;  2ZRS A;  2L4I A;  3OX6 A;  1QVI Y;  4JPZ B;  1Q80 A;  1OE9 B;  2MHH A;  3E3R A;  4U8D A;  3R72 A;  2LMT A;  5D7F A;  4AOM A;  1D1O A;  1SR6 C;  4Q04 A;  2EHB A;  2JNF A;  3KF9 A;  3D74 A;  1CMF A;  2L5X B;  1Y1X A;  4MN0 A;  1EL4 A;  1OSA A;  5F6T A;  4P2Y B;  1OOF A;  3LLE A;  3BUO B;  2JTZ A;  1K9K A;  3CTN A;  3DVK A;  1DGU A;  2M1K B;  1QLS A;  3I5G B;  2FOT A;  1KK8 B;  2CXJ A;  1BR4 B;  2KAX A;  1CDP A;  2PAL A;  1MXE A;  5AER A;  1SRA A;  2PMY A;  2COL B;  1Y6W A;  2KFF A;  2AUC A;  3NSK A;  1H4B A;  3DVJ A;  4YRU A;  3NGV A;  4M2P A;  4DUQ A;  2OTG B;  2F2O A;  2WOS A;  4ETO A;  1NIW A;  3SIB A;  2L50 A;  1PSB A;  2LMU A;  1V1F A;  1YRU B;  1TNQ A;  3DVE A;  1FW4 A;  4YI8 A;  3C1V A;  1OZO A;  2NCP A;  3O4X A;  2LVK A;  5DKR A;  1BOD A;  1IJ6 A;  3M0W A;  2LAN A;  3BOW A;  3GK2 A;  5KSZ A;  2CT9 A;  2FJY A;  3BUX B;  3O78 A;  2JC2 A;  4OVN F;  1DMO A;  4PAL A;  2OS8 B;  2O5G A;  4OZD A;  1T14 A;  2L2E A;  2QAC A;  2KPH A;  2KQ6 A;  3CZ0 A;  3OB1 B;  2ZNE A;  4YI9 A;  3TUY B;  1UUS A;  1QVI Z;  1CFC A;  1B8C A;  5KTY A;  5AFP A;  3DF0 A;  2AMI A;  1MF8 B;  1S3P A;  2M29 A;  3DVM A;  2QPT A;  4TNC A;  1IG5 A;  1CFP A;  2Y4Q A;  1N65 A;  1REC A;  1NUB A;  2JWW A;  2KDH A;  2WC6 A;  5CSN A;  1DTL A;  2WCJ A;  1DJW A;  1JUO A;  3D10 A;  4ORB B;  1Y1U A;  4WRI A;  1J7O A;  2KGB C;  1RRO A;  4XJK A;  4AQJ A;  1F71 A;  3I5G C;  1KK8 C;  1SCM B;  2JT0 A;  1IIO A;  2WCK A;  1BMO A;  1S36 A;  1RK9 A;  2G2B A;  2LLU A;  4PE1 A;  1YR5 A;  4C0L A;  5I2Q A;  1F8H A;  4GGN A;  4I5L B;  1CDN A;  1A29 A;  2L51 A;  2M7N A;  2OTG C;  3JTD B;  3EK8 A;  4QJ3 B;  5I8N A;  1BOC A;  1J55 A;  1S1E A;  3BQ3 A;  3O4Y A;  2M3W A;  1AVS A;  1ZAC A;  3WHT B;  3VRP A;  4AQI A;  4GGF A;  1QS7 A;  2KFH A;  1AUI B;  1KFU S;  5D69 A;  1AHR A;  3I5H B;  2WOR A;  5HLO A;  1A75 B;  3PSR A;  2KI6 D;  5CSJ A;  4A4C A;  1OZS A;  1P28 A;  4I5J A;  1XO5 A;  5FI6 A;  3EVU A;  3TS5 B;  3CWG A;  1IKU A;  2DOQ A;  3AKB A;  3I5F B;  2OS8 C;  2KBI A;  3FIA A;  3LCP C;  2LP3 A;  3DXL A;  2G9B A;  3TUY C;  1BT6 A;  2JT3 A;  3HCM A;  3L4A A;  3AAJ A;  5AXI A;  1DF0 B;  2HF5 A;  1XYD A;  1QX5 B;  1NX1 A;  1K96 A;  1NX2 A;  2LHL A;  2M8U A;  1G4Y R;  3EVR A;  3N7H A;  3QRX A;  4UPG A;  3RZS A;  4FQT A;  1Z4H A;  2NZ0 A;  4PHM A;  3B7A A;  4GAO A;  4XYN A;  1XFW O;  3V2L A;  4GPL B;  1Y1A A;  4M2Q A;  2LE9 B;  2K0J A;  1R6P A;  4HRE E;  2FCE A;  4MSP A;  4GFT A;  4NDB A;  1OMV A;  2BCX A;  1QX7 A;  2M1U A;  2Y1N A;  1EH2 A;  1SCM C;  3CZ2 A;  3SJS A; 
#chains in the Genus database with same CATH homology
 3EVV A;  2MBX A;  1KK7 Z;  1S6I A;  2LAP A;  1XFU O;  1J7P A;  1DJG A;  3KHE A;  2NXQ A;  3JTD C;  4GBA A;  4MLW A;  1XK4 A;  1NCY A;  1K9P A;  2LC5 A;  5JOL A;  3TZ1 A;  1MQ1 A;  4CFQ A;  1TOP A;  2JRF A;  2F8P A;  1UP5 A;  2KGR A;  2R2I A;  5DKN A;  1A4P A;  1CLL A;  2P6B B;  3I5H C;  1TTX A;  1N0Y A;  4ICB A;  2BL0 B;  3TS5 C;  1F4Q A;  2OPO A;  1SMG A;  1NWD A;  3I5F C;  2LLS A;  1KSM A;  1RTP 1;  3IQQ A;  1NP8 A;  2CCM A;  3NXA A;  5ER5 A;  1BJF A;  1KCY A;  2KYF A;  2HQ8 A;  1QXP A;  4OCI A;  2MA2 A;  2BCA A;  1M39 A;  2WC8 A;  2LVI A;  4YGB B;  1RWY A;  4FTG A;  3EK7 A;  1BF5 A;  1DGV A;  3CLN A;  2MLF C;  1M46 A;  2KOT A;  5HKZ A;  1NYA A;  4CPV A;  4ZCU A;  5BPJ A;  2V53 A;  1YX7 A;  3JVT B;  1HT9 A;  1BR1 B;  1QLK A;  2M49 B;  4PE0 A;  1JBA A;  4HRH A;  1XFZ O;  2KAV A;  2HQW A;  2CTN A;  1DF0 A;  1JF2 A;  5J3X A;  2BE6 A;  3AAK A;  2LP2 A;  1CFD A;  4DIR A;  1IH0 A;  1CDM A;  4HSZ A;  1SL8 A;  2SCP A;  2K7D A;  3CR4 X;  3GK4 X;  1C7W A;  1PUL A;  2LVJ A;  2MRD A;  2WCF A;  1GQM A;  3CGA A;  4OKH A;  1IWQ A;  2GGZ A;  2BL0 C;  2K7C A;  1LA3 A;  1K90 D;  2ZN8 A;  4PE4 A;  5I2L A;  1PSR A;  1ZFS A;  2ZRT A;  1NPQ A;  1M31 A;  2KHN A;  2H61 C;  4MZL A;  3BYA A;  2M7L A;  1B4C A;  1FPW A;  1G8I A;  2PVB A;  2F3Y A;  2LVV A;  1EXR A;  2PSR A;  3TDU A;  1IJ5 A;  1CM4 A;  4YBH B;  1JC2 A;  1J7R A;  1MR8 A;  5KU1 A;  1N2D A;  1B9A A;  4QJ4 B;  2O60 A;  3CR5 X;  4QJ5 B;  4N1G A;  1L7Z A;  4I5N B;  2M0R A;  1B8L A;  1YX8 A;  1DJX A;  2KFG A;  1K95 A;  1KK7 Y;  2GV5 A;  1SK6 D;  4YGC B;  2BBN A;  3WNX B;  2LUX A;  3PM8 A;  1B47 A;  3JVT C;  2L4H A;  1LVC D;  3FWC A;  4ZCV A;  2JNX A;  2EC6 B;  2SAS A;  4C0K A;  1FI6 A;  1ZOT B;  4CID A;  1AK8 A;  1EG3 A;  3F45 A;  1QV1 A;  2AAO A;  3MSE B;  3O6B A;  3PAL A;  1KFX S;  4BY5 A;  1V1G A;  1RFJ A;  1J1D A;  1QIV A;  3RLZ A;  1PRW A;  1QTX A;  2F33 A;  1U5I B;  3NSO A;  1B1G A;  1VRK A;  2M9G A;  3EK4 A;  4L9M A;  1WY9 A;  1XFV O;  1NSH A;  1TRF A;  2KAY A;  1EG4 A;  4MBE A;  1ODB A;  1CM1 A;  2ISD A;  5DKQ A;  3KPX A;  4OV2 A;  1XFX O;  2LV7 A;  1BLQ A;  3FWB A;  3BXK A;  2EGD A;  4CFR A;  4CLN A;  1KSO A;  2JXL A;  4ORA B;  5CSF A;  2BEC A;  3VGO A;  2K2F A;  1MUX A;  1K9U A;  4MZJ A;  1JWD A;  1UHI A;  4NDC A;  3LK1 A;  1J1E A;  1WDC B;  2IS9 A;  3OB2 B;  2KI6 C;  4N1F A;  4YGA A;  1B8R A;  1XFY O;  2KYC A;  5FYX A;  3PN7 C;  1M63 B;  3CR2 A;  1BG1 A;  1CKK A;  3K21 A;  1K8U A;  4MVF A;  3H4S E;  3KO0 A;  1XVJ A;  2LNK A;  3FS7 A;  5HLV A;  5HKY A;  1DJI A;  1MWN A;  1YUR A;  1K2H A;  2ZN9 A;  1QIW A;  1NX3 A;  1WLZ A;  2CNP A;  2RGI A;  3BUN B;  1EJ3 A;  2EC6 C;  1OMR A;  2JOJ A;  2KQY A;  2PAS A;  5B8I B;  2JPT A;  4PHJ A;  2Y5I A;  4DS7 A;  1WRK A;  2BCB A;  3IQO A;  2ZKM X;  2HET A;  2PRU A;  5JJG A;  2A4J A;  4ORC B;  1DJZ A;  3CZT X;  1TCF A;  3SG6 A;  3BUM B;  3EKH A;  1FBV A;  4C0J A;  4E68 A;  4YGE B;  1UHH A;  1IGV A;  4WQ3 A;  1LIN A;  2KI4 B;  1S5G Z;  3SG3 A;  1SYM A;  2JQ6 A;  2CBL A;  3D0Y B;  5HYD A;  1B7T Z;  1Y0V H;  1KQV A;  1W7I B;  1ALV A;  2LMV A;  2MAZ A;  1W7J B;  1WDC C;  2TN4 A;  2WCE A;  1F54 A;  4BY4 A;  1MHO A;  2KNE A;  1K93 D;  3VRN A;  1QV0 A;  1KFX L;  3KEV A;  2FJU B;  1KFU L;  4YGD B;  4JQ0 D;  1A75 A;  1SL7 A;  3WXA A;  1PVB A;  1U5I A;  3A4U B;  3OHM B;  2NLN A;  2GGM A;  3PAT A;  1CDL A;  1DJY A;  3SIA A;  3LL8 B;  1AJ4 A;  4P5O E;  1FI5 A;  1BU3 A;  2E6W A;  1GGW A;  1TCO B;  4WQ2 A;  4DRW A;  4PCW A;  3TDZ A;  2LCP A;  1UHN A;  3PLF B;  3SG2 A;  1DJH A;  5GQQ C;  3NSI A;  1DT7 B;  1WRZ A;  3I5I B;  5HKW A;  4MZK A;  1WRL A;  1IQ5 A;  4PHN A;  1QAS A;  1SL9 A;  1YUU A;  2BE4 A;  1G33 A;  3BUW B;  4PDZ A;  4FQO A;  3GOF A;  2KI4 C;  1NCX A;  3ZWH A;  3SG4 A;  1UWO A;  1CNP A;  2L0P A;  2Q4U A;  2K7B A;  1KQM B;  4NQG A;  3ZNI A;  2KSP A;  1TNX A;  1LXF C;  4USL A;  1A2X A;  2MLE C;  4MRY A;  1AJ5 A;  1X02 A;  2FCD A;  3PN7 B;  1HQV A;  2K2A A;  2LUC A;  3SG5 A;  1FF1 A;  3A8R A;  1CLM A;  1WLM A;  1JF0 A;  1PAL A;  2JZI A;  2L98 A;  1UHK A;  2H61 A;  1YUT A;  1ZUZ A;  1OMD A;  1QX2 A;  2M97 A;  2JTT A;  4GGF C;  3CS1 A;  2VRG A;  1M45 A;  1SPY A;  3WHU B;  3DD4 A;  3LK0 A;  4I5K A;  1KWO B;  3D0Y A;  2KBM A;  2LM5 A;  3IF7 A;  2BBM A;  5I2O A;  1MXL C;  4MRX A;  5IBW A;  3VRQ A;  3OP0 A;  3I5I C;  1R2U A;  2JUL A;  3VRR A;  1F55 A;  2H2K A;  1SNL A;  2I18 A;  2WCB A;  1SCV A;  1L2O B;  1ZMZ A;  2F3Z A;  3ICB A;  1H8B A;  1YTZ C;  1S5G Y;  5TNC A;  5PAL A;  3HX4 A;  3PFV A;  3SG7 A;  2I94 A;  1J7Q A;  2D8N A;  1B7T Y;  1GGZ A;  1SW8 A;  1K94 A;  1SY9 A;  1GJY A;  1XA5 A;  2WND A;  4MEW A;  1TNW A;  4YRU A;  1BOD A;  1CTR A;  3NSL A;  4M2O A;  1KQM C;  2JXC A;  1YRT B;  1NX0 A;  2K61 A;  2I7A A;  3AKA A;  4DCK A;  2MJW B;  2B1U A;  1C07 A;  1UUR A;  2LHI A;  4JWQ A;  3VRO A;  1E8A A;  1JFJ A;  1CFF A;  1OQP A;  5K89 A;  4PHK A;  1C7V A;  4GUK A;  1SR6 B;  3EKJ A;  2K8M B;  1CMG A;  2ZND A;  1DVI A;  1XK4 C;  4F0Z B;  1LA0 A;  1JFK A;  4GNK B;  2K7O A;  5AAN A;  1AP4 A;  2E30 A;  1YVL A;  2F2P A;  2Y1M A;  1NCZ A;  5ER4 X;  1IQ3 A;  4OR9 B;  4IL1 A;  1A03 A;  2JU0 A;  3GK1 A;  1KWO C;  3BOW B;  1TNP A;  1TN4 A;  2BKI B;  4N5X A;  5AEQ A;  1LKJ A;  1YVH A;  1CLB A;  1SBJ A;  4D1E A;  2ZFD A;  1QAT A;  1QJT A;  1YUS A;  1RJV A;  3DF0 B;  1F70 A;  1IRJ A;  1S6J A;  4A4B A;  1S26 D;  1SKT A;  1L2O C;  3RM1 A;  1UHJ A;  5CPV A;  5CSI A;  5G08 A;  4PE7 A;  2BKH B;  1CB1 A;  1JSA A;  4NDD A;  2NCO A;  3OX5 A;  4XJK B;  1ALW A;  1PK0 D;  2LLT A;  1F4O A;  2I2R E;  3TDI A;  2Q91 A;  2JT8 A;  3O2P A;  1PVA A;  1TIZ A;  1S6C A;  4HRG A;  4R1E A;  2HPS A;  1OOJ A;  2ZRS A;  2L4I A;  3OX6 A;  1QVI Y;  4JPZ B;  1Q80 A;  1OE9 B;  2MHH A;  3E3R A;  4U8D A;  4AOM A;  2LMT A;  5D7F A;  1D1O A;  1SR6 C;  4Q04 A;  2EHB A;  2JNF A;  3KF9 A;  1CMF A;  2L5X B;  1Y1X A;  4MN0 A;  1EL4 A;  1OSA A;  5F6T A;  4P2Y B;  3LLE A;  3BUO B;  2JTZ A;  1K9K A;  3CTN A;  3DVK A;  1DGU A;  2M1K B;  1QLS A;  3I5G B;  2FOT A;  1KK8 B;  2CXJ A;  1BR4 B;  2KAX A;  1CDP A;  2PAL A;  1MXE A;  5AER A;  1SRA A;  2PMY A;  2COL B;  1Y6W A;  2KFF A;  2AUC A;  3NSK A;  1H4B A;  3DVJ A;  4M2P A;  4DUQ A;  2OTG B;  2F2O A;  2WOS A;  4ETO A;  1NIW A;  3SIB A;  2L50 A;  1PSB A;  2LMU A;  1V1F A;  1YRU B;  1TNQ A;  3DVE A;  1FW4 A;  4YI8 A;  3C1V A;  1OZO A;  2NCP A;  2LVK A;  5DKR A;  1IJ6 A;  3M0W A;  2LAN A;  3BOW A;  3GK2 A;  5KSZ A;  2CT9 A;  3BUX B;  3O78 A;  1DMO A;  2JC2 A;  4OVN F;  4PAL A;  2OS8 B;  2O5G A;  2L2E A;  2QAC A;  2KQ6 A;  1CFC A;  3OB1 B;  2ZNE A;  4YI9 A;  3TUY B;  1UUS A;  1QVI Z;  1B8C A;  5KTY A;  5AFP A;  3DF0 A;  2AMI A;  1MF8 B;  1S3P A;  2M29 A;  3DVM A;  2QPT A;  4TNC A;  1IG5 A;  1CFP A;  2Y4Q A;  1N65 A;  1REC A;  1NUB A;  2JWW A;  2KDH A;  5CSN A;  1DTL A;  1DJW A;  1JUO A;  3D10 A;  4ORB B;  1Y1U A;  4WRI A;  1J7O A;  2KGB C;  1RRO A;  4XJK A;  4AQJ A;  1F71 A;  3I5G C;  1KK8 C;  1SCM B;  2JT0 A;  1BMO A;  1S36 A;  1RK9 A;  2G2B A;  2LLU A;  4PE1 A;  1YR5 A;  4C0L A;  5I2Q A;  1F8H A;  4GGN A;  4I5L B;  1CDN A;  1A29 A;  2L51 A;  2M7N A;  2OTG C;  3JTD B;  3EK8 A;  4QJ3 B;  5I8N A;  1BOC A;  1J55 A;  1S1E A;  3BQ3 A;  3O4Y A;  2M3W A;  1AVS A;  1ZAC A;  3WHT B;  3VRP A;  4AQI A;  4GGF A;  1QS7 A;  2KFH A;  1AUI B;  1KFU S;  5D69 A;  1AHR A;  3I5H B;  2WOR A;  5HLO A;  1A75 B;  3PSR A;  2KI6 D;  5CSJ A;  4A4C A;  1OZS A;  4I5J A;  3TS5 B;  1XO5 A;  3EVU A;  3CWG A;  1IKU A;  2DOQ A;  3AKB A;  3I5F B;  2OS8 C;  2KBI A;  3FIA A;  3LCP C;  2LP3 A;  3TUY C;  2G9B A;  1BT6 A;  2JT3 A;  3HCM A;  3AAJ A;  5AXI A;  1DF0 B;  2HF5 A;  1QX5 B;  1XYD A;  1NX1 A;  1K96 A;  1NX2 A;  2LHL A;  2M8U A;  1G4Y R;  3EVR A;  3QRX A;  4UPG A;  2NZ0 A;  4PHM A;  4XYN A;  4GAO A;  1XFW O;  4GPL B;  1Y1A A;  4M2Q A;  2LE9 B;  2K0J A;  1R6P A;  4HRE E;  2FCE A;  4MSP A;  4GFT A;  4NDB A;  1OMV A;  2BCX A;  1QX7 A;  2M1U A;  2Y1N A;  1EH2 A;  1SCM C;  3SJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...