1FI6A

Solution structure of the reps1 eh domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
WKITDEQRQYYVNQFKTIQPDLNGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLPEKLPESLMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EH DOMAIN PROTEIN REPS1
publication title Solution structure of the Reps1 EH domain and characterization of its binding to NPF target sequences.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2000-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1fi6A00
4IL1A 1BR1B 2JXCA 1IG5A 1MXEA 3A8RA 5ER4X 1M31A 3WXAA 1SCVA 1U5IA 2D8NA 2BCAA 3DVEA 1U5IB 1XFYO 1KWOC 1RFJA 3QRXA 4GBAA 3LLEA 4PE0A 1J7OA 3BUWB 2KQ6A 2O60A 1UHKA 1Y1XA 4DS7A 1PSBA 1S6JA 3AKAA 2K7BA 3LK1A 1JWDA 1F8HA 1KWOB 5FYXA 1NCZA 3RM1A 1KFXS 1SKTA 3KHEA 3OP0A 1K90D 2F33A 2JTTA 3OB2B 4NDCA 1B47A 1B7TZ 3AKBA 3FS7A 3JVTC 4ZCVA 1NSHA 1AUIB 1KSMA 2EGDA 1XFUO 2L4HA 1ZOTB 2E6WA 2WC8A 1CTRA 3DVJA 2M9GA 3KO0A 2BE6A 2HETA 1S26D 3TDZA 5BPJA 3TUYC 3CGAA 2KI4C 2KSPA 2DOQA 2LMVA 2LUCA 1NCXA 2CTNA 1V1GA 3EVVA 1OSAA 3VRNA 3GK1A 1K9PA 4N1GA 2ZKMX 2V53A 1SR6C 2Y4QA 5AXIA 2BECA 1HQVA 3TUYB 2KI4B 1S5GZ 1QIWA 4GNKB 2KFGA 1S3PA 2NXQA 2SCPA 4MEWA 3BXKA 5HLVA 1PSRA 1A2XA 1WRZA 2K7OA 1B8CA 2FCEA 4YI8A 1N2DA 4UPGA 2MBXA 1DJGA 1TCOB 1CLLA 1RTP1 1A03A 4AQJA 2PRUA 5DKNA 2MRDA 4HRHA 1PULA 1OE9B 1NYAA 2ZNEA 1F70A 3AAKA 4I5LB 1EG3A 3LCPC 4MLWA 1ZUZA 1QATA 3NSOA 3FWCA 1TNXA 1C7WA 1IGVA 2JXLA 2G2BA 2K61A 1S1EA 4PHJA 4WQ3A 5AERA 4TNCA 1IKUA 2ZRTA 3VRRA 1E8AA 1NPQA 1GJYA 3JTDB 1MXLC 2FJUB 3PALA 3ZWHA 4M2PA 1YVLA 1QJTA 2LVKA 1DJXA 2Y1NA 1NX2A 1CDMA 4GGFC 2LCPA 3I5IC 2MLEC 4GPLB 2KGRA 1J7PA 2LMUA 2JTZA 4P5OE 5J3XA 2BCBA 4DIRA 3MSEB 5D69A 1BU3A 4A4CA 2LAPA 4NQGA 1NUBA 3KF9A 5AFPA 4CFQA 4MRXA 2MHHA 2L5XB 1XFXO 1QVIZ 1NIWA 1AK8A 2L0PA 2PSRA 4GGFA 1FPWA 3WHUB 1PRWA 1CDPA 4MBEA 1J1EA 1WLMA 3VRQA 1BODA 1SY9A 1BF5A 1PK0D 3BQ3A 2BL0C 2MA2A 1EH2A 1J7QA 3FWBA 4DCKA 2CXJA 4YRUA 3BUXB 2KYCA 3PLFB 1SL9A 1BR4B 2LV7A 3OHMB 5GQQC 2I7AA 5F6TA 1CB1A 1GGWA 2JQ6A 1YX8A 1SPYA 4YGBB 3O4YA 1SRAA 1OMVA 2BL0B 3VROA 1DGVA 3CLNA 1A29A 2LE9B 2LLUA 4PE1A 2AMIA 2KHNA 1N0YA 2LNKA 1J7RA 1DF0A 2AUCA 1JF0A 1LA3A 5HKYA 1EG4A 3ZNIA 4MN0A 4ETOA 1B4CA 2EC6C 1K8UA 1XVJA 1ZACA 3EK4A 3I5FB 3CS1A 1LVCD 4DRWA 1ZFSA 1B9AA 1KQMC 1Y1AA 2EC6B 2WORA 3TS5B 2LMTA 1AP4A 1IH0A 2JOJA 2M97A 3EKJA 4YGDB 1YTZC 4BY5A 1CKKA 1QLSA 2JU0A 1KQMB 3CR5X 1L2OC 3IF7A 4AOMA 1B8LA 4E68A 4PHNA 1K9KA 3F45A 4GGNA 1Y6WA 1SMGA 1NX1A 2JNFA 4PHKA 3I5HC 2LHLA 1CDNA 1YUTA 1L2OB 4AQIA 1TCFA 1XFZO 3SG2A 3NXAA 1B7TY 5CSIA 4A4BA 2F2PA 1CMGA 4L9MA 2K2AA 1EXRA 3OB1B 4ORAB 2OPOA 3DD4A 3I5HB 2KI6D 1OOJA 2Y5IA 1RROA 1DMOA 5HKWA 5I2LA 5B8IB 2KAXA 1QX2A 2KFHA 2JT0A 2P6BB 1KK8B 1NP8A 1EL4A 3O78A 4FTGA 1CFFA 1YR5A 2LP2A 4C0KA 1SL7A 2A4JA 3GOFA 3RLZA 1OMRA 1SYMA 1NCYA 1K95A 2KDHA 1NWDA 1MWNA 3AAJA 4MVFA 2F2OA 1XA5A 1A75A 2JT3A 4GFTA 1A75B 2ZRSA 4OKHA 1XYDA 2BBMA 2I2RE 3PATA 3BUNB 2WCBA 2JT8A 4ORBB 1SCMC 2SASA 1AHRA 1KSOA 2GV5A 1N65A 5DKQA 1Q80A 2LVVA 3PFVA 2R2IA 2L2EA 2G9BA 1Y1UA 5CSFA 2JULA 2L51A 4NDBA 1XK4C 2M49B 2K8MB 2VRGA 1SCMB 3JTDC 4HREE 4MZLA 4PCWA 4F0ZB 1LA0A 1CLBA 2JZIA 1CDLA 1TIZA 4JWQA 1RJVA 4ZCUA 1DJZA 1GQMA 1RECA 5JOLA 1KQVA 5I2OA 2LHIA 5TNCA 1XK4A 3TDUA 1H8BA 1IQ3A 1LXFC 1PVBA 4P2YB 1F71A 2KBMA 2HQWA 4USLA 1WY9A 5G08A 3SG4A 2KAYA 1L7ZA 2K2FA 1ZMZA 2I94A 1ODBA 3CR4X 3H4SE 2CT9A 2QACA 1QLKA 1NX3A 5I2QA 2OS8C 1DTLA 1OMDA 1HT9A 2E30A 2QPTA 2ZFDA 3CTNA 1B1GA 1JSAA 2FCDA 2KI6C 2M0RA 1A4PA 1ALWA 1M39A 2MAZA 1KK7Z 3BUOB 2BCXA 3D10A 5HLOA 1TRFA 2OS8B 3DVKA 4CFRA 3EKHA 1IJ5A 1DT7B 2MLFC 1UUSA 4GUKA 4MSPA 3KPXA 3HCMA 1C07A 1SW8A 1QTXA 1WRKA 1G33A 3DF0A 1C7VA 3DF0B 4WRIA 1ALVA 5AEQA 3PN7C 4C0LA 2M3WA 2TN4A 1DJIA 2L98A 3I5FC 3ICBA 1S36A 3IQOA 1BJFA 2K7CA 1MQ1A 4D1EA 2LUXA 3TS5C 2M7LA 1F4OA 4YGCB 1NX0A 2BE4A 2LVJA 3FIAA 1G4YR 3NSLA 1G8IA 3PN7B 3BUMB 1MF8B 2FOTA 3BYAA 1DVIA 1SBJA 2KAVA 1AJ4A 2O5GA 3DVMA 4HSZA 5ER5A 3EK8A 1MHOA 2K0JA 2M1KB 1K96A 2H61C 4BY4A 4NDDA 1FBVA 2L4IA 1DJYA 1AVSA 4DUQA 1YX7A 2LLTA 3VGOA 5IBWA 3LK0A 2Q91A 2KNEA 2EHBA 2M1UA 1FF1A 2GGZA 2LANA 1JFKA 1JBAA 1YVHA 4N1FA 3GK2A 2H61A 2BBNA 1QX5B 2WCEA 2KOTA 1QIVA 1LKJA 4OV2A 3SG3A 5HKZA 3CZTX 1YRTB 1QX7A 2ZNDA 1M46A 3NSKA 3M0WA 1K2HA 2F8PA 2HQ8A 4MZKA 2PASA 1K93D 4PE4A 5HYDA 1KFUL 1UWOA 1FW4A 4CPVA 2K7DA 1KK8C 3GK4X 4FQOA 1CLMA 4CIDA 1MUXA 2M7NA 4XJKA 4XJKB 2IS9A 1PVAA 2KFFA 1DJWA 3PM8A 1F55A 3EVRA 1FI5A 3O2PA 1S6CA 2JC2A 1M45A 3SG7A 1UHNA 1OQPA 3O6BA 1X02A 1W7IB 4MZJA 1CFDA 2BKIB 1CFPA 3CWGA 1QASA 2ISDA 2RGIA 4I5JA 3NSIA 3E3RA 4QJ5B 1TOPA 2KBIA 1BLQA 1S6IA 2M8UA 1UHHA 5AANA 1MR8A 1QXPA 2MJWB 1IWQA 3VRPA 1CM1A 5PALA 1S5GY 2WCFA 1IRJA 3HX4A 3D0YA 2LVIA 1JF2A 3C1VA 3D0YB 5CSJA 2NLNA 3JVTB 2ZN8A 2KQYA 2LP3A 5DKRA 1DJHA 1W7JB 4CLNA 2BKHB 5K89A 3KEVA 5CPVA 2PMYA 1FI6A 1BMOA 4WQ2A 5I8NA 5KTYA 1LINA 2PVBA 1TNPA 4PE7A 1R6PA 1J1DA 4OVNF 2NCOA 3SIAA 4N5XA 1TN4A 2HF5A 4QJ4B 1EJ3A 4YGAA 1XO5A 3TDIA 1KFXL 1YURA 1SR6B 1XFVO 3LL8B 4ICBA 1YUUA 1YRUB 1DGUA 4Q04A 1CM4A 2NZ0A 4YI9A 1OZSA 5CSNA 5D7FA 4U8DA 2WOSA 4M2QA 2JRFA 3OX6A 1RWYA 1WDCC 1BG1A 4GAOA 1D1OA 3EK7A 1J55A 1BT6A 1RK9A 2KYFA 1IQ5A 1R2UA 1YUSA 4JQ0D 2I18A 1QV1A 1UHIA 1TNWA 2COLB 1TNQA 1WDCB 1K94A 2F3ZA 2JPTA 4OR9B 3I5GC 5JJGA 1TTXA 4PHMA 2CNPA 1QVIY 3IQQA 3WNXB 2LC5A 2JNXA 4I5KA 4YBHB 2KGBC 1JUOA 3SG5A 2LM5A 4I5NB 2AAOA 1AJ5A 1KK7Y 1H4BA 1B8RA 4MRYA 2H2KA 3CR2A 1KCYA 1SNLA 1GGZA 2HPSA 3EVUA 4HRGA 4QJ3B 3I5GB 1CNPA 1IJ6A 4OCIA 1JC2A 2OTGC 2PALA 1KFUS 1VRKA 1F54A 1CMFA 3OX5A 1F4QA 1OZOA 3I5IB 1CFCA 1WRLA 3SJSA 1M63B 2NCPA 1QV0A 2GGMA 3K21A 1UP5A 2LLSA 3SG6A 4M2OA 2JWWA 4ORCB 2OTGB 2CCMA 2L50A 3SIBA 2Q4UA 1BOCA 4C0JA 2M29A 3PSRA 4XYNA 1WLZA 1UURA 2CBLA 4YGEB 1PALA 3A4UB 3WHTB 4JPZB 1XFWO 2Y1MA 5KU1A 2F3YA 1Y0VH 1QS7A 4PALA 4PDZA 2WNDA 1JFJA 2B1UA 1SL8A 3BOWA 5KSZA 4R1EA 1SK6D 3BOWB 1V1FA 1UHJA 1K9UA 3TZ1A 2ZN9A 1DF0B
chains in the Genus database with same CATH superfamily
4PT1A 4IL1A 2P71A 1BR1B 2JXCA 1IG5A 1MXEA 3A8RA 5ER4X 1OOFA 1M31A 3WXAA 1SCVA 1U5IA 2D8NA 2BCAA 3DVEA 1U5IB 1XFYO 1KWOC 1RFJA 3QRXA 4GBAA 3LLEA 4PE0A 1J7OA 3BUWB 2KQ6A 2O60A 1UHKA 1Y1XA 5D3OA 4DS7A 1PSBA 1S6JA 3AKAA 2K7BA 3LK1A 1JWDA 3CDNA 1F8HA 1KWOB 5FYXA 1NCZA 3RM1A 3BJHA 1KFXS 1SKTA 1SSEB 3L47A 3KHEA 3OP0A 1K90D 2F33A 2JTTA 3OB2B 4NDCA 3Q8IA 1B47A 1B7TZ 3AKBA 3OGNA 3FS7A 3JVTC 4ZCVA 1NSHA 1AUIB 1KSMA 2EGDA 3DZTA 1XFUO 2L4HA 1ZOTB 2E6WA 2WC8A 1CTRA 3PJIA 3DVJA 2M9GA 3KO0A 2BE6A 2HETA 1S26D 3TDZA 5BPJA 3D75A 2KLEA 3TUYC 3CGAA 2KI4C 2KSPA 2DOQA 2LMVA 2LUCA 1NCXA 2CTNA 1V1GA 3EVVA 1OSAA 4JD9A 3VRNA 3B88A 3GK1A 1K9PA 4N1GA 2ZKMX 2V53A 1SR6C 4F0ZB 2Y4QA 5AXIA 2K60A 2BECA 1HQVA 3TUYB 2KI4B 1S5GZ 1QIWA 4GNKB 2KFGA 1S3PA 2NXQA 2SCPA 4MEWA 3BXKA 5HLVA 1PSRA 1XFRA 1A2XA 1WRZA 1Z4HA 2K7OA 1B8CA 2FCEA 4YI8A 1N2DA 4UPGA 2YGUA 2PQLA 3EG5B 2MBXA 1DJGA 1TCOB 1GM0A 1CLLA 1RTP1 1A03A 4AQJA 2PRUA 5DKNA 2MRDA 3L4LA 4HRHA 1PULA 1OE9B 3O4XA 1NYAA 2ZNEA 1F70A 3AAKA 4I5LB 1EG3A 3B87A 3D76A 3LCPC 4MLWA 1ZUZA 1TWOA 1QATA 3UNWA 3NSOA 3FWCA 1TNXA 1C7WA 1IGVA 2JXLA 2G2BA 2K61A 1S1EA 4PHJA 4WQ3A 4INXA 5AERA 4TNCA 1IKUA 2ZRTA 3VRRA 1E8AA 1NPQA 1GJYA 3JTDB 1MXLC 2FJUB 3PALA 3ZWHA 4M2PA 1YVLA 1QJTA 2LVKA 1DJXA 2Y1NA 1NX2A 1CDMA 2KLDA 4GGFC 2LCPA 3I5IC 2MLEC 4GPLB 2KGRA 1Z2CB 3S0EA 2LMUA 2JTZA 4P5OE 5J3XA 2BCBA 4DIRA 3MSEB 1J7PA 5D69A 1BU3A 4A4CA 2LAPA 4NQGA 1NUBA 3KF9A 5AFPA 4CFQA 3D74A 4MRXA 3R1OA 2MHHA 2L5XB 1XFXO 1QVIZ 1NIWA 1AK8A 2L0PA 2PSRA 4GGFA 1FPWA 3WHUB 1PRWA 1CDPA 2ERBA 4MBEA 1J1EA 1WLMA 3VRQA 1BODA 1SY9A 1BF5A 1PK0D 1ORGA 3BQ3A 3FE9A 2BL0C 2MA2A 1EH2A 1J7QA 3FWBA 4DCKA 2CXJA 4YRUA 3BUXB 2KYCA 3PLFB 1SL9A 1BR4B 2LV7A 3OHMB 5GQQC 2I7AA 5F6TA 1CB1A 1GGWA 2JQ6A 1YX8A 1SPYA 4YGBB 3O4YA 1SRAA 1OMVA 2BL0B 3VROA 1OW4A 1DGVA 3CLNA 1A29A 2LE9B 2LLUA 4PE1A 2AMIA 2KHNA 1N0YA 2LNKA 1J7RA 1DF0A 2AUCA 1JF0A 1LA3A 5HKYA 1EG4A 3ZNIA 4MN0A 5EL2A 4ETOA 1B4CA 2EC6C 1K8UA 1XVJA 1ZACA 1W9ZA 3EK4A 3I5FB 3CS1A 1LVCD 3BFHA 4DRWA 1ZFSA 3D78A 1B9AA 1KQMC 1Y1AA 2EC6B 2WORA 3TS5B 2BAPA 2LMTA 1AP4A 1IH0A 2JOJA 2M97A 3EKJA 4JKTA 4YGDB 1YTZC 4BY5A 3CZ1A 5HL1A 2GTEA 1CKKA 1QLSA 2JU0A 1KQMB 3CR5X 1L2OC 3IF7A 4AOMA 1B8LA 4E68A 4PHNA 1K9KA 3F45A 4GGNA 1Y6WA 1SMGA 2WCMA 1NX1A 2JNFA 4PHKA 3I5HC 2LHLA 1CDNA 1YUTA 1L2OB 1P28A 1TCFA 1XFZO 3SG2A 4AQIA 2JPOA 2QEBA 1B7TY 3NXAA 5CSIA 4A4BA 2BNXA 2F2PA 3SS4A 4L9MA 1CMGA 2K2AA 1EXRA 3OB1B 4ORAB 2OPOA 3DD4A 3I5HB 3S0FA 2KI6D 3SS3A 1OOJA 2Y5IA 1RROA 1DMOA 5HKWA 5I2LA 5B8IB 2KAXA 1QX2A 2KFHA 2JT0A 2P6BB 1KK8B 1NP8A 3SS5A 1EL4A 3O78A 4FTGA 1CFFA 1YR5A 2LP2A 4C0KA 1SL7A 2A4JA 3GOFA 3RLZA 1OMRA 1SYMA 1NCYA 1K95A 2KDHA 1NWDA 1MWNA 3AAJA 4MVFA 2F2OA 2WCJA 1XA5A 1A75A 2JT3A 4GFTA 1A75B 2ZRSA 4OKHA 1XYDA 2BBMA 2I2RE 3PATA 3BUNB 3V2LA 2QEOA 2WCBA 2JT8A 4ORBB 1SCMC 2SASA 1OOIX 1AHRA 1KSOA 2GV5A 1N65A 5DKQA 5FI6A 1Q80A 2LVVA 4OZDA 3PFVA 3QMEA 2R2IA 2L2EA 2G9BA 3FE8A 1Y1UA 5CSFA 2JULA 2L51A 4NDBA 1XK4C 2M49B 2K8MB 2VRGA 1SCMB 3JTDC 4HREE 4INWA 3R1VA 4MZLA 4PCWA 1LA0A 3NHIA 1CLBA 2JZIA 1CDLA 1TIZA 4JWQA 1RJVA 4ZCUA 4KYNA 1DJZA 1GQMA 1RECA 5JOLA 1KQVA 5I2OA 2LHIA 2WCHA 5TNCA 1XK4A 3TDUA 1H8BA 1IQ3A 1LXFC 1PVBA 4P2YB 1F71A 2KBMA 2WCKA 2HQWA 4USLA 1C3ZA 1WY9A 5G08A 3SG4A 2KAYA 1L7ZA 2K2FA 1ZMZA 2I94A 1ODBA 3CR4X 3H4SE 2CT9A 2P70A 2QACA 1QLKA 1NX3A 3CZ0A 5I2QA 2OS8C 1DTLA 1OMDA 1HT9A 2E30A 1DQEA 2QPTA 2ZFDA 3CTNA 4FQTA 1B1GA 1JSAA 2FCDA 2KI6C 2M0RA 1A4PA 1ALWA 1M39A 2MAZA 1KK7Z 3BUOB 2BCXA 3D10A 3L4AA 1TRFA 5HLOA 1LS8A 5FI7A 2OS8B 1DELA 1IIOA 3DVKA 4CFRA 3EKHA 1IJ5A 1DT7B 2MLFC 1UUSA 4GUKA 4F7FA 4MSPA 3KPXA 3HCMA 1C07A 1SW8A 1QTXA 1WRKA 1G33A 3DF0A 1C7VA 3DF0B 4WRIA 1ALVA 3K1EA 5AEQA 3PN7C 4C0LA 2M3WA 2TN4A 1DJIA 2L98A 3I5FC 3ICBA 1S36A 3IQOA 1BJFA 2K7CA 3DY9A 1MQ1A 4D1EA 2LUXA 3TS5C 2M7LA 1F4OA 4YGCB 1NX0A 2BE4A 2LVJA 3FIAA 1G4YR 3NSLA 1G8IA 3PN7B 3CZ2A 3S0AA 3BUMB 1MF8B 3B6XA 2FOTA 3BYAA 1DVIA 1SBJA 2KAVA 1AJ4A 2O5GA 3DVMA 4HSZA 5ER5A 3EK8A 3DXLA 1MHOA 2K0JA 2M1KB 1K96A 3S0DA 2H61C 4BY4A 3S0BA 4NDDA 3R1PA 3UO9A 1FBVA 2L4IA 1DJYA 1AVSA 4DUQA 1YX7A 2LLTA 3VGOA 3RZSA 2QDIA 5IBWA 3LK0A 2Q91A 2KNEA 2EHBA 2M1UA 1FF1A 2GGZA 2LANA 1JFKA 1JBAA 1YVHA 4N1FA 3GK2A 2H61A 2BBNA 1QX5B 2WCEA 2KOTA 1QIVA 1LKJA 4OV2A 3SG3A 3NGVA 3CZTX 5HKZA 1YRTB 1QX7A 2ZNDA 1M46A 3NSKA 3M0WA 5DICA 2F8PA 2HQ8A 1K2HA 4MZKA 2PASA 1K93D 4PE4A 5HYDA 1KFUL 1UWOA 3PM2A 1FW4A 4CPVA 2K7DA 1KK8C 3GK4X 4FQOA 1CLMA 4CIDA 1MUXA 2M7NA 4XJKA 4XJKB 2IS9A 1PVAA 2KFFA 1DJWA 3PM8A 1F55A 3EVRA 1FI5A 3O2PA 1T14A 3VB1A 1S6CA 2JC2A 3CYZA 1M45A 3SG7A 1UHNA 1OQPA 3O6BA 1X02A 1W7IB 4MZJA 1CFDA 2BKIB 1CFPA 3CWGA 3S0GA 1QASA 2ISDA 2RGIA 4I5JA 3NSIA 3E3RA 4QJ5B 1TOPA 2KBIA 1BLQA 1S6IA 2M8UA 1UHHA 5AANA 1MR8A 1QXPA 1QWVA 2MJWB 1IWQA 3FE6A 3VRPA 1CM1A 5PALA 1S5GY 2WCFA 1IRJA 3HX4A 3D0YA 2LVIA 1JF2A 3C1VA 3D0YB 2WCLA 2L2CA 5CSJA 1TUZA 2NLNA 3JVTB 2ZN8A 2KQYA 2LP3A 5I94A 5DKRA 1DJHA 1W7JB 4CLNA 2BKHB 5K89A 2H8VA 3KEVA 5CPVA 1OOGA 2PMYA 1FI6A 1BMOA 4WQ2A 5I8NA 5KTYA 1LINA 2PVBA 3B7AA 1DEKA 1TNPA 4PE7A 1R6PA 1J1DA 4OVNF 3BFAA 2NCOA 3SIAA 4N5XA 1TN4A 2HF5A 4QJ4B 1EJ3A 4YGAA 1XO5A 3DYEA 3TDIA 1KFXL 1YURA 1SR6B 1XFVO 3LL8B 3N7HA 4ICBA 1YUUA 1YRUB 1DGUA 4Q04A 3IVTA 1CM4A 2NZ0A 4YI9A 5JJGA 1OZSA 5CSNA 5D7FA 3B86A 4U8DA 2WOSA 4M2QA 2JRFA 3OX6A 1RWYA 1WDCC 1BG1A 4GAOA 1D1OA 3EK7A 2KPHA 1J55A 1BT6A 1RK9A 2KYFA 1IQ5A 1R2UA 1YUSA 4JQ0D 2I18A 1QV1A 1UHIA 2WC5A 1TNWA 2COLB 1TNQA 1WDCB 1K94A 2F3ZA 2JPTA 3NHTA 3I5GC 3OBVA 1TTXA 4OR9B 2CNPA 1QVIY 3IQQA 4PHMA 2LC5A 2JNXA 3WNXB 4I5KA 4YBHB 1DC1A 2KGBC 1JUOA 3SG5A 2LM5A 4I5NB 2AAOA 1AJ5A 1KK7Y 2QEVA 1B8RA 4MRYA 1H4BA 2H2KA 3CR2A 1KCYA 2FJYA 1SNLA 1GGZA 2HPSA 3EVUA 4HRGA 4QJ3B 3I5GB 1CNPA 1C3YA 1IJ6A 4OCIA 1JC2A 2OTGC 2PALA 1KFUS 1VRKA 2QEHA 2WC6A 1F54A 1CMFA 3OX5A 1F4QA 1OZOA 3I5IB 3R72A 1WRLA 1CFCA 3SJSA 1M63B 2NCPA 2PYQA 1QV0A 2GGMA 3K21A 1UP5A 2LLSA 5FI2A 3SG6A 4M2OA 2JWWA 1TUJA 4ORCB 2OTGB 2CCMA 2L50A 3D77A 3SIBA 2L5YA 2Q4UA 1BOCA 4C0JA 2M29A 3PSRA 4XYNA 1WLZA 1UURA 2CBLA 3CABA 1OOHA 4YGEB 1PALA 3A4UB 3WHTB 4JPZB 1XFWO 2Y1MA 5KU1A 3D73A 2F3YA 1Y0VH 1QS7A 4PALA 4PDZA 2WNDA 1JFJA 2B1UA 1SL8A 3BFBA 3BOWA 5KSZA 4R1EA 1SK6D 3BOWB 4IJ7A 1V1FA 1UHJA 1K9UA 3TZ1A 2ZN9A 1DF0B
chains in the Genus database with same CATH topology
4IL1A 1BR1B 2JXCA 1IG5A 1MXEA 3A8RA 5ER4X 1M31A 3WXAA 1SCVA 1U5IA 2D8NA 2BCAA 3DVEA 1U5IB 1XFYO 1KWOC 1RFJA 3QRXA 4GBAA 3LLEA 4PE0A 1J7OA 3BUWB 2KQ6A 2O60A 1UHKA 1Y1XA 4DS7A 1PSBA 1S6JA 3AKAA 2K7BA 3LK1A 1JWDA 1F8HA 1KWOB 5FYXA 1NCZA 3RM1A 1KFXS 1SKTA 3KHEA 3OP0A 1K90D 2F33A 2JTTA 3OB2B 4NDCA 1B47A 1B7TZ 3AKBA 3FS7A 3JVTC 4ZCVA 1NSHA 1AUIB 1KSMA 2EGDA 1XFUO 2L4HA 1ZOTB 2E6WA 2WC8A 1CTRA 3DVJA 2M9GA 3KO0A 2BE6A 2HETA 1S26D 3TDZA 5BPJA 3TUYC 3CGAA 2KI4C 2KSPA 2DOQA 2LMVA 2LUCA 1NCXA 2CTNA 1V1GA 3EVVA 1OSAA 3VRNA 3GK1A 1K9PA 4N1GA 2ZKMX 2V53A 1SR6C 2Y4QA 5AXIA 2BECA 1HQVA 3TUYB 2KI4B 1S5GZ 1QIWA 4GNKB 2KFGA 1S3PA 2NXQA 2SCPA 4MEWA 3BXKA 5HLVA 1PSRA 1A2XA 1WRZA 2K7OA 1B8CA 2FCEA 4YI8A 1N2DA 4UPGA 2MBXA 1DJGA 1TCOB 1CLLA 1RTP1 1A03A 4AQJA 2PRUA 5DKNA 2MRDA 4HRHA 1PULA 1OE9B 1NYAA 2ZNEA 1F70A 3AAKA 4I5LB 1EG3A 3LCPC 4MLWA 1ZUZA 1QATA 3NSOA 3FWCA 1TNXA 1C7WA 1IGVA 2JXLA 2G2BA 2K61A 1S1EA 4PHJA 4WQ3A 5AERA 4TNCA 1IKUA 2ZRTA 3VRRA 1E8AA 1NPQA 1GJYA 3JTDB 1MXLC 2FJUB 3PALA 3ZWHA 4M2PA 1YVLA 1QJTA 2LVKA 1DJXA 2Y1NA 1NX2A 1CDMA 4GGFC 2LCPA 3I5IC 2MLEC 4GPLB 2KGRA 1J7PA 2LMUA 2JTZA 4P5OE 5J3XA 2BCBA 4DIRA 3MSEB 5D69A 1BU3A 4A4CA 2LAPA 4NQGA 1NUBA 3KF9A 5AFPA 4CFQA 4MRXA 2MHHA 2L5XB 1XFXO 1QVIZ 1NIWA 1AK8A 2L0PA 2PSRA 4GGFA 1FPWA 3WHUB 1PRWA 1CDPA 4MBEA 1J1EA 1WLMA 3VRQA 1BODA 1SY9A 1BF5A 1PK0D 3BQ3A 2BL0C 2MA2A 1EH2A 1J7QA 3FWBA 4DCKA 2CXJA 4YRUA 3BUXB 2KYCA 3PLFB 1SL9A 1BR4B 2LV7A 3OHMB 5GQQC 2I7AA 5F6TA 1CB1A 1GGWA 2JQ6A 1YX8A 1SPYA 4YGBB 3O4YA 1SRAA 1OMVA 2BL0B 3VROA 1DGVA 3CLNA 1A29A 2LE9B 2LLUA 4PE1A 2AMIA 2KHNA 1N0YA 2LNKA 1J7RA 1DF0A 2AUCA 1JF0A 1LA3A 5HKYA 1EG4A 3ZNIA 4MN0A 4ETOA 1B4CA 2EC6C 1K8UA 1XVJA 1ZACA 3EK4A 3I5FB 3CS1A 1LVCD 4DRWA 1ZFSA 1B9AA 1KQMC 1Y1AA 2EC6B 2WORA 3TS5B 2LMTA 1AP4A 1IH0A 2JOJA 2M97A 3EKJA 4YGDB 1YTZC 4BY5A 1CKKA 1QLSA 2JU0A 1KQMB 3CR5X 1L2OC 3IF7A 4AOMA 1B8LA 4E68A 4PHNA 1K9KA 3F45A 4GGNA 1Y6WA 1SMGA 1NX1A 2JNFA 4PHKA 3I5HC 2LHLA 1CDNA 1YUTA 1L2OB 4AQIA 1TCFA 1XFZO 3SG2A 3NXAA 1B7TY 5CSIA 4A4BA 2F2PA 1CMGA 4L9MA 2K2AA 1EXRA 3OB1B 4ORAB 2OPOA 3DD4A 3I5HB 2KI6D 1OOJA 2Y5IA 1RROA 1DMOA 5HKWA 5I2LA 5B8IB 2KAXA 1QX2A 2KFHA 2JT0A 2P6BB 1KK8B 1NP8A 1EL4A 3O78A 4FTGA 1CFFA 1YR5A 2LP2A 4C0KA 1SL7A 2A4JA 3GOFA 3RLZA 1OMRA 1SYMA 1NCYA 1K95A 2KDHA 1NWDA 1MWNA 3AAJA 4MVFA 2F2OA 1XA5A 1A75A 2JT3A 4GFTA 1A75B 2ZRSA 4OKHA 1XYDA 2BBMA 2I2RE 3PATA 3BUNB 2WCBA 2JT8A 4ORBB 1SCMC 2SASA 1AHRA 1KSOA 2GV5A 1N65A 5DKQA 1Q80A 2LVVA 3PFVA 2R2IA 2L2EA 2G9BA 1Y1UA 5CSFA 2JULA 2L51A 4NDBA 1XK4C 2M49B 2K8MB 2VRGA 1SCMB 3JTDC 4HREE 4MZLA 4PCWA 4F0ZB 1LA0A 1CLBA 2JZIA 1CDLA 1TIZA 4JWQA 1RJVA 4ZCUA 1DJZA 1GQMA 1RECA 5JOLA 1KQVA 5I2OA 2LHIA 5TNCA 1XK4A 3TDUA 1H8BA 1IQ3A 1LXFC 1PVBA 4P2YB 1F71A 2KBMA 2HQWA 4USLA 1WY9A 5G08A 3SG4A 2KAYA 1L7ZA 2K2FA 1ZMZA 2I94A 1ODBA 3CR4X 3H4SE 2CT9A 2QACA 1QLKA 1NX3A 5I2QA 2OS8C 1DTLA 1OMDA 1HT9A 2E30A 2QPTA 2ZFDA 3CTNA 1B1GA 1JSAA 2FCDA 2KI6C 2M0RA 1A4PA 1ALWA 1M39A 2MAZA 1KK7Z 3BUOB 2BCXA 3D10A 5HLOA 1TRFA 2OS8B 3DVKA 4CFRA 3EKHA 1IJ5A 1DT7B 2MLFC 1UUSA 4GUKA 4MSPA 3KPXA 3HCMA 1C07A 1SW8A 1QTXA 1WRKA 1G33A 3DF0A 1C7VA 3DF0B 4WRIA 1ALVA 5AEQA 3PN7C 4C0LA 2M3WA 2TN4A 1DJIA 2L98A 3I5FC 3ICBA 1S36A 3IQOA 1BJFA 2K7CA 1MQ1A 4D1EA 2LUXA 3TS5C 2M7LA 1F4OA 4YGCB 1NX0A 2BE4A 2LVJA 3FIAA 1G4YR 3NSLA 1G8IA 3PN7B 3BUMB 1MF8B 2FOTA 3BYAA 1DVIA 1SBJA 2KAVA 1AJ4A 2O5GA 3DVMA 4HSZA 5ER5A 3EK8A 1MHOA 2K0JA 2M1KB 1K96A 2H61C 4BY4A 4NDDA 1FBVA 2L4IA 1DJYA 1AVSA 4DUQA 1YX7A 2LLTA 3VGOA 5IBWA 3LK0A 2Q91A 2KNEA 2EHBA 2M1UA 1FF1A 2GGZA 2LANA 1JFKA 1JBAA 1YVHA 4N1FA 3GK2A 2H61A 2BBNA 1QX5B 2WCEA 2KOTA 1QIVA 1LKJA 4OV2A 3SG3A 5HKZA 3CZTX 1YRTB 1QX7A 2ZNDA 1M46A 3NSKA 3M0WA 1K2HA 2F8PA 2HQ8A 4MZKA 2PASA 1K93D 4PE4A 5HYDA 1KFUL 1UWOA 1FW4A 4CPVA 2K7DA 1KK8C 3GK4X 4FQOA 1CLMA 4CIDA 1MUXA 2M7NA 4XJKA 4XJKB 2IS9A 1PVAA 2KFFA 1DJWA 3PM8A 1F55A 3EVRA 1FI5A 3O2PA 1S6CA 2JC2A 1M45A 3SG7A 1UHNA 1OQPA 3O6BA 1X02A 1W7IB 4MZJA 1CFDA 2BKIB 1CFPA 3CWGA 1QASA 2ISDA 2RGIA 4I5JA 3NSIA 3E3RA 4QJ5B 1TOPA 2KBIA 1BLQA 1S6IA 2M8UA 1UHHA 5AANA 1MR8A 1QXPA 2MJWB 1IWQA 3VRPA 1CM1A 5PALA 1S5GY 2WCFA 1IRJA 3HX4A 3D0YA 2LVIA 1JF2A 3C1VA 3D0YB 5CSJA 2NLNA 3JVTB 2ZN8A 2KQYA 2LP3A 5DKRA 1DJHA 1W7JB 4CLNA 2BKHB 5K89A 3KEVA 5CPVA 2PMYA 1FI6A 1BMOA 4WQ2A 5I8NA 5KTYA 1LINA 2PVBA 1TNPA 4PE7A 1R6PA 1J1DA 4OVNF 2NCOA 3SIAA 4N5XA 1TN4A 2HF5A 4QJ4B 1EJ3A 4YGAA 1XO5A 3TDIA 1KFXL 1YURA 1SR6B 1XFVO 3LL8B 4ICBA 1YUUA 1YRUB 1DGUA 4Q04A 1CM4A 2NZ0A 4YI9A 1OZSA 5CSNA 5D7FA 4U8DA 2WOSA 4M2QA 2JRFA 3OX6A 1RWYA 1WDCC 1BG1A 4GAOA 1D1OA 3EK7A 1J55A 1BT6A 1RK9A 2KYFA 1IQ5A 1R2UA 1YUSA 4JQ0D 2I18A 1QV1A 1UHIA 1TNWA 2COLB 1TNQA 1WDCB 1K94A 2F3ZA 2JPTA 4OR9B 3I5GC 5JJGA 1TTXA 4PHMA 2CNPA 1QVIY 3IQQA 3WNXB 2LC5A 2JNXA 4I5KA 4YBHB 2KGBC 1JUOA 3SG5A 2LM5A 4I5NB 2AAOA 1AJ5A 1KK7Y 1H4BA 1B8RA 4MRYA 2H2KA 3CR2A 1KCYA 1SNLA 1GGZA 2HPSA 3EVUA 4HRGA 4QJ3B 3I5GB 1CNPA 1IJ6A 4OCIA 1JC2A 2OTGC 2PALA 1KFUS 1VRKA 1F54A 1CMFA 3OX5A 1F4QA 1OZOA 3I5IB 1CFCA 1WRLA 3SJSA 1M63B 2NCPA 1QV0A 2GGMA 3K21A 1UP5A 2LLSA 3SG6A 4M2OA 2JWWA 4ORCB 2OTGB 2CCMA 2L50A 3SIBA 2Q4UA 1BOCA 4C0JA 2M29A 3PSRA 4XYNA 1WLZA 1UURA 2CBLA 4YGEB 1PALA 3A4UB 3WHTB 4JPZB 1XFWO 2Y1MA 5KU1A 2F3YA 1Y0VH 1QS7A 4PALA 4PDZA 2WNDA 1JFJA 2B1UA 1SL8A 3BOWA 5KSZA 4R1EA 1SK6D 3BOWB 1V1FA 1UHJA 1K9UA 3TZ1A 2ZN9A 1DF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL1 A;  1BR1 B;  2JXC A;  1IG5 A;  1MXE A;  3A8R A;  5ER4 X;  1M31 A;  3WXA A;  1SCV A;  1U5I A;  2D8N A;  2BCA A;  3DVE A;  1U5I B;  1XFY O;  1KWO C;  1RFJ A;  3QRX A;  4GBA A;  3LLE A;  4PE0 A;  1J7O A;  3BUW B;  2KQ6 A;  2O60 A;  1UHK A;  1Y1X A;  4DS7 A;  1PSB A;  1S6J A;  3AKA A;  2K7B A;  3LK1 A;  1JWD A;  1F8H A;  1KWO B;  5FYX A;  1NCZ A;  3RM1 A;  1KFX S;  1SKT A;  3KHE A;  3OP0 A;  1K90 D;  2F33 A;  2JTT A;  3OB2 B;  4NDC A;  1B47 A;  1B7T Z;  3AKB A;  3FS7 A;  3JVT C;  4ZCV A;  1NSH A;  1AUI B;  1KSM A;  2EGD A;  1XFU O;  2L4H A;  1ZOT B;  2E6W A;  2WC8 A;  1CTR A;  3DVJ A;  2M9G A;  3KO0 A;  2BE6 A;  2HET A;  1S26 D;  3TDZ A;  5BPJ A;  3TUY C;  3CGA A;  2KI4 C;  2KSP A;  2DOQ A;  2LMV A;  2LUC A;  1NCX A;  2CTN A;  1V1G A;  3EVV A;  1OSA A;  3VRN A;  3GK1 A;  1K9P A;  4N1G A;  2ZKM X;  2V53 A;  1SR6 C;  2Y4Q A;  5AXI A;  2BEC A;  1HQV A;  3TUY B;  2KI4 B;  1S5G Z;  1QIW A;  4GNK B;  2KFG A;  1S3P A;  2NXQ A;  2SCP A;  4MEW A;  3BXK A;  5HLV A;  1PSR A;  1A2X A;  1WRZ A;  2K7O A;  1B8C A;  2FCE A;  4YI8 A;  1N2D A;  4UPG A;  2MBX A;  1DJG A;  1TCO B;  1CLL A;  1RTP 1;  1A03 A;  4AQJ A;  2PRU A;  5DKN A;  2MRD A;  4HRH A;  1PUL A;  1OE9 B;  1NYA A;  2ZNE A;  1F70 A;  3AAK A;  4I5L B;  1EG3 A;  3LCP C;  4MLW A;  1ZUZ A;  1QAT A;  3NSO A;  3FWC A;  1TNX A;  1C7W A;  1IGV A;  2JXL A;  2G2B A;  2K61 A;  1S1E A;  4PHJ A;  4WQ3 A;  5AER A;  4TNC A;  1IKU A;  2ZRT A;  3VRR A;  1E8A A;  1NPQ A;  1GJY A;  3JTD B;  1MXL C;  2FJU B;  3PAL A;  3ZWH A;  4M2P A;  1YVL A;  1QJT A;  2LVK A;  1DJX A;  2Y1N A;  1NX2 A;  1CDM A;  4GGF C;  2LCP A;  3I5I C;  2MLE C;  4GPL B;  2KGR A;  1J7P A;  2LMU A;  2JTZ A;  4P5O E;  5J3X A;  2BCB A;  4DIR A;  3MSE B;  5D69 A;  1BU3 A;  4A4C A;  2LAP A;  4NQG A;  1NUB A;  3KF9 A;  5AFP A;  4CFQ A;  4MRX A;  2MHH A;  2L5X B;  1XFX O;  1QVI Z;  1NIW A;  1AK8 A;  2L0P A;  2PSR A;  4GGF A;  1FPW A;  3WHU B;  1PRW A;  1CDP A;  4MBE A;  1J1E A;  1WLM A;  3VRQ A;  1BOD A;  1SY9 A;  1BF5 A;  1PK0 D;  3BQ3 A;  2BL0 C;  2MA2 A;  1EH2 A;  1J7Q A;  3FWB A;  4DCK A;  2CXJ A;  4YRU A;  3BUX B;  2KYC A;  3PLF B;  1SL9 A;  1BR4 B;  2LV7 A;  3OHM B;  5GQQ C;  2I7A A;  5F6T A;  1CB1 A;  1GGW A;  2JQ6 A;  1YX8 A;  1SPY A;  4YGB B;  3O4Y A;  1SRA A;  1OMV A;  2BL0 B;  3VRO A;  1DGV A;  3CLN A;  1A29 A;  2LE9 B;  2LLU A;  4PE1 A;  2AMI A;  2KHN A;  1N0Y A;  2LNK A;  1J7R A;  1DF0 A;  2AUC A;  1JF0 A;  1LA3 A;  5HKY A;  1EG4 A;  3ZNI A;  4MN0 A;  4ETO A;  1B4C A;  2EC6 C;  1K8U A;  1XVJ A;  1ZAC A;  3EK4 A;  3I5F B;  3CS1 A;  1LVC D;  4DRW A;  1ZFS A;  1B9A A;  1KQM C;  1Y1A A;  2EC6 B;  2WOR A;  3TS5 B;  2LMT A;  1AP4 A;  1IH0 A;  2JOJ A;  2M97 A;  3EKJ A;  4YGD B;  1YTZ C;  4BY5 A;  1CKK A;  1QLS A;  2JU0 A;  1KQM B;  3CR5 X;  1L2O C;  3IF7 A;  4AOM A;  1B8L A;  4E68 A;  4PHN A;  1K9K A;  3F45 A;  4GGN A;  1Y6W A;  1SMG A;  1NX1 A;  2JNF A;  4PHK A;  3I5H C;  2LHL A;  1CDN A;  1YUT A;  1L2O B;  4AQI A;  1TCF A;  1XFZ O;  3SG2 A;  3NXA A;  1B7T Y;  5CSI A;  4A4B A;  2F2P A;  1CMG A;  4L9M A;  2K2A A;  1EXR A;  3OB1 B;  4ORA B;  2OPO A;  3DD4 A;  3I5H B;  2KI6 D;  1OOJ A;  2Y5I A;  1RRO A;  1DMO A;  5HKW A;  5I2L A;  5B8I B;  2KAX A;  1QX2 A;  2KFH A;  2JT0 A;  2P6B B;  1KK8 B;  1NP8 A;  1EL4 A;  3O78 A;  4FTG A;  1CFF A;  1YR5 A;  2LP2 A;  4C0K A;  1SL7 A;  2A4J A;  3GOF A;  3RLZ A;  1OMR A;  1SYM A;  1NCY A;  1K95 A;  2KDH A;  1NWD A;  1MWN A;  3AAJ A;  4MVF A;  2F2O A;  1XA5 A;  1A75 A;  2JT3 A;  4GFT A;  1A75 B;  2ZRS A;  4OKH A;  1XYD A;  2BBM A;  2I2R E;  3PAT A;  3BUN B;  2WCB A;  2JT8 A;  4ORB B;  1SCM C;  2SAS A;  1AHR A;  1KSO A;  2GV5 A;  1N65 A;  5DKQ A;  1Q80 A;  2LVV A;  3PFV A;  2R2I A;  2L2E A;  2G9B A;  1Y1U A;  5CSF A;  2JUL A;  2L51 A;  4NDB A;  1XK4 C;  2M49 B;  2K8M B;  2VRG A;  1SCM B;  3JTD C;  4HRE E;  4MZL A;  4PCW A;  4F0Z B;  1LA0 A;  1CLB A;  2JZI A;  1CDL A;  1TIZ A;  4JWQ A;  1RJV A;  4ZCU A;  1DJZ A;  1GQM A;  1REC A;  5JOL A;  1KQV A;  5I2O A;  2LHI A;  5TNC A;  1XK4 A;  3TDU A;  1H8B A;  1IQ3 A;  1LXF C;  1PVB A;  4P2Y B;  1F71 A;  2KBM A;  2HQW A;  4USL A;  1WY9 A;  5G08 A;  3SG4 A;  2KAY A;  1L7Z A;  2K2F A;  1ZMZ A;  2I94 A;  1ODB A;  3CR4 X;  3H4S E;  2CT9 A;  2QAC A;  1QLK A;  1NX3 A;  5I2Q A;  2OS8 C;  1DTL A;  1OMD A;  1HT9 A;  2E30 A;  2QPT A;  2ZFD A;  3CTN A;  1B1G A;  1JSA A;  2FCD A;  2KI6 C;  2M0R A;  1A4P A;  1ALW A;  1M39 A;  2MAZ A;  1KK7 Z;  3BUO B;  2BCX A;  3D10 A;  5HLO A;  1TRF A;  2OS8 B;  3DVK A;  4CFR A;  3EKH A;  1IJ5 A;  1DT7 B;  2MLF C;  1UUS A;  4GUK A;  4MSP A;  3KPX A;  3HCM A;  1C07 A;  1SW8 A;  1QTX A;  1WRK A;  1G33 A;  3DF0 A;  1C7V A;  3DF0 B;  4WRI A;  1ALV A;  5AEQ A;  3PN7 C;  4C0L A;  2M3W A;  2TN4 A;  1DJI A;  2L98 A;  3I5F C;  3ICB A;  1S36 A;  3IQO A;  1BJF A;  2K7C A;  1MQ1 A;  4D1E A;  2LUX A;  3TS5 C;  2M7L A;  1F4O A;  4YGC B;  1NX0 A;  2BE4 A;  2LVJ A;  3FIA A;  1G4Y R;  3NSL A;  1G8I A;  3PN7 B;  3BUM B;  1MF8 B;  2FOT A;  3BYA A;  1DVI A;  1SBJ A;  2KAV A;  1AJ4 A;  2O5G A;  3DVM A;  4HSZ A;  5ER5 A;  3EK8 A;  1MHO A;  2K0J A;  2M1K B;  1K96 A;  2H61 C;  4BY4 A;  4NDD A;  1FBV A;  2L4I A;  1DJY A;  1AVS A;  4DUQ A;  1YX7 A;  2LLT A;  3VGO A;  5IBW A;  3LK0 A;  2Q91 A;  2KNE A;  2EHB A;  2M1U A;  1FF1 A;  2GGZ A;  2LAN A;  1JFK A;  1JBA A;  1YVH A;  4N1F A;  3GK2 A;  2H61 A;  2BBN A;  1QX5 B;  2WCE A;  2KOT A;  1QIV A;  1LKJ A;  4OV2 A;  3SG3 A;  5HKZ A;  3CZT X;  1YRT B;  1QX7 A;  2ZND A;  1M46 A;  3NSK A;  3M0W A;  1K2H A;  2F8P A;  2HQ8 A;  4MZK A;  2PAS A;  1K93 D;  4PE4 A;  5HYD A;  1KFU L;  1UWO A;  1FW4 A;  4CPV A;  2K7D A;  1KK8 C;  3GK4 X;  4FQO A;  1CLM A;  4CID A;  1MUX A;  2M7N A;  4XJK A;  4XJK B;  2IS9 A;  1PVA A;  2KFF A;  1DJW A;  3PM8 A;  1F55 A;  3EVR A;  1FI5 A;  3O2P A;  1S6C A;  2JC2 A;  1M45 A;  3SG7 A;  1UHN A;  1OQP A;  3O6B A;  1X02 A;  1W7I B;  4MZJ A;  1CFD A;  2BKI B;  1CFP A;  3CWG A;  1QAS A;  2ISD A;  2RGI A;  4I5J A;  3NSI A;  3E3R A;  4QJ5 B;  1TOP A;  2KBI A;  1BLQ A;  1S6I A;  2M8U A;  1UHH A;  5AAN A;  1MR8 A;  1QXP A;  2MJW B;  1IWQ A;  3VRP A;  1CM1 A;  5PAL A;  1S5G Y;  2WCF A;  1IRJ A;  3HX4 A;  3D0Y A;  2LVI A;  1JF2 A;  3C1V A;  3D0Y B;  5CSJ A;  2NLN A;  3JVT B;  2ZN8 A;  2KQY A;  2LP3 A;  5DKR A;  1DJH A;  1W7J B;  4CLN A;  2BKH B;  5K89 A;  3KEV A;  5CPV A;  2PMY A;  1FI6 A;  1BMO A;  4WQ2 A;  5I8N A;  5KTY A;  1LIN A;  2PVB A;  1TNP A;  4PE7 A;  1R6P A;  1J1D A;  4OVN F;  2NCO A;  3SIA A;  4N5X A;  1TN4 A;  2HF5 A;  4QJ4 B;  1EJ3 A;  4YGA A;  1XO5 A;  3TDI A;  1KFX L;  1YUR A;  1SR6 B;  1XFV O;  3LL8 B;  4ICB A;  1YUU A;  1YRU B;  1DGU A;  4Q04 A;  1CM4 A;  2NZ0 A;  4YI9 A;  1OZS A;  5CSN A;  5D7F A;  4U8D A;  2WOS A;  4M2Q A;  2JRF A;  3OX6 A;  1RWY A;  1WDC C;  1BG1 A;  4GAO A;  1D1O A;  3EK7 A;  1J55 A;  1BT6 A;  1RK9 A;  2KYF A;  1IQ5 A;  1R2U A;  1YUS A;  4JQ0 D;  2I18 A;  1QV1 A;  1UHI A;  1TNW A;  2COL B;  1TNQ A;  1WDC B;  1K94 A;  2F3Z A;  2JPT A;  4OR9 B;  3I5G C;  5JJG A;  1TTX A;  4PHM A;  2CNP A;  1QVI Y;  3IQQ A;  3WNX B;  2LC5 A;  2JNX A;  4I5K A;  4YBH B;  2KGB C;  1JUO A;  3SG5 A;  2LM5 A;  4I5N B;  2AAO A;  1AJ5 A;  1KK7 Y;  1H4B A;  1B8R A;  4MRY A;  2H2K A;  3CR2 A;  1KCY A;  1SNL A;  1GGZ A;  2HPS A;  3EVU A;  4HRG A;  4QJ3 B;  3I5G B;  1CNP A;  1IJ6 A;  4OCI A;  1JC2 A;  2OTG C;  2PAL A;  1KFU S;  1VRK A;  1F54 A;  1CMF A;  3OX5 A;  1F4Q A;  1OZO A;  3I5I B;  1CFC A;  1WRL A;  3SJS A;  1M63 B;  2NCP A;  1QV0 A;  2GGM A;  3K21 A;  1UP5 A;  2LLS A;  3SG6 A;  4M2O A;  2JWW A;  4ORC B;  2OTG B;  2CCM A;  2L50 A;  3SIB A;  2Q4U A;  1BOC A;  4C0J A;  2M29 A;  3PSR A;  4XYN A;  1WLZ A;  1UUR A;  2CBL A;  4YGE B;  1PAL A;  3A4U B;  3WHT B;  4JPZ B;  1XFW O;  2Y1M A;  5KU1 A;  2F3Y A;  1Y0V H;  1QS7 A;  4PAL A;  4PDZ A;  2WND A;  1JFJ A;  2B1U A;  1SL8 A;  3BOW A;  5KSZ A;  4R1E A;  1SK6 D;  3BOW B;  1V1F A;  1UHJ A;  1K9U A;  3TZ1 A;  2ZN9 A;  1DF0 B; 
#chains in the Genus database with same CATH topology
 4PT1 A;  4IL1 A;  2P71 A;  1BR1 B;  2JXC A;  1IG5 A;  1MXE A;  3A8R A;  5ER4 X;  1OOF A;  1M31 A;  3WXA A;  1SCV A;  1U5I A;  2D8N A;  2BCA A;  3DVE A;  1U5I B;  1XFY O;  1KWO C;  1RFJ A;  3QRX A;  4GBA A;  3LLE A;  4PE0 A;  1J7O A;  3BUW B;  2KQ6 A;  2O60 A;  1UHK A;  1Y1X A;  5D3O A;  4DS7 A;  1PSB A;  1S6J A;  3AKA A;  2K7B A;  3LK1 A;  1JWD A;  3CDN A;  1F8H A;  1KWO B;  5FYX A;  1NCZ A;  3RM1 A;  3BJH A;  1KFX S;  1SKT A;  1SSE B;  3L47 A;  3KHE A;  3OP0 A;  1K90 D;  2F33 A;  2JTT A;  3OB2 B;  4NDC A;  3Q8I A;  1B47 A;  1B7T Z;  3AKB A;  3OGN A;  3FS7 A;  3JVT C;  4ZCV A;  1NSH A;  1AUI B;  1KSM A;  2EGD A;  3DZT A;  1XFU O;  2L4H A;  1ZOT B;  2E6W A;  2WC8 A;  1CTR A;  3PJI A;  3DVJ A;  2M9G A;  3KO0 A;  2BE6 A;  2HET A;  1S26 D;  3TDZ A;  5BPJ A;  3D75 A;  2KLE A;  3TUY C;  3CGA A;  2KI4 C;  2KSP A;  2DOQ A;  2LMV A;  2LUC A;  1NCX A;  2CTN A;  1V1G A;  3EVV A;  1OSA A;  4JD9 A;  3VRN A;  3B88 A;  3GK1 A;  1K9P A;  4N1G A;  2ZKM X;  2V53 A;  1SR6 C;  4F0Z B;  2Y4Q A;  5AXI A;  2K60 A;  2BEC A;  1HQV A;  3TUY B;  2KI4 B;  1S5G Z;  1QIW A;  4GNK B;  2KFG A;  1S3P A;  2NXQ A;  2SCP A;  4MEW A;  3BXK A;  5HLV A;  1PSR A;  1XFR A;  1A2X A;  1WRZ A;  1Z4H A;  2K7O A;  1B8C A;  2FCE A;  4YI8 A;  1N2D A;  4UPG A;  2YGU A;  2PQL A;  3EG5 B;  2MBX A;  1DJG A;  1TCO B;  1GM0 A;  1CLL A;  1RTP 1;  1A03 A;  4AQJ A;  2PRU A;  5DKN A;  2MRD A;  3L4L A;  4HRH A;  1PUL A;  1OE9 B;  3O4X A;  1NYA A;  2ZNE A;  1F70 A;  3AAK A;  4I5L B;  1EG3 A;  3B87 A;  3D76 A;  3LCP C;  4MLW A;  1ZUZ A;  1TWO A;  1QAT A;  3UNW A;  3NSO A;  3FWC A;  1TNX A;  1C7W A;  1IGV A;  2JXL A;  2G2B A;  2K61 A;  1S1E A;  4PHJ A;  4WQ3 A;  4INX A;  5AER A;  4TNC A;  1IKU A;  2ZRT A;  3VRR A;  1E8A A;  1NPQ A;  1GJY A;  3JTD B;  1MXL C;  2FJU B;  3PAL A;  3ZWH A;  4M2P A;  1YVL A;  1QJT A;  2LVK A;  1DJX A;  2Y1N A;  1NX2 A;  1CDM A;  2KLD A;  4GGF C;  2LCP A;  3I5I C;  2MLE C;  4GPL B;  2KGR A;  1Z2C B;  3S0E A;  2LMU A;  2JTZ A;  4P5O E;  5J3X A;  2BCB A;  4DIR A;  3MSE B;  1J7P A;  5D69 A;  1BU3 A;  4A4C A;  2LAP A;  4NQG A;  1NUB A;  3KF9 A;  5AFP A;  4CFQ A;  3D74 A;  4MRX A;  3R1O A;  2MHH A;  2L5X B;  1XFX O;  1QVI Z;  1NIW A;  1AK8 A;  2L0P A;  2PSR A;  4GGF A;  1FPW A;  3WHU B;  1PRW A;  1CDP A;  2ERB A;  4MBE A;  1J1E A;  1WLM A;  3VRQ A;  1BOD A;  1SY9 A;  1BF5 A;  1PK0 D;  1ORG A;  3BQ3 A;  3FE9 A;  2BL0 C;  2MA2 A;  1EH2 A;  1J7Q A;  3FWB A;  4DCK A;  2CXJ A;  4YRU A;  3BUX B;  2KYC A;  3PLF B;  1SL9 A;  1BR4 B;  2LV7 A;  3OHM B;  5GQQ C;  2I7A A;  5F6T A;  1CB1 A;  1GGW A;  2JQ6 A;  1YX8 A;  1SPY A;  4YGB B;  3O4Y A;  1SRA A;  1OMV A;  2BL0 B;  3VRO A;  1OW4 A;  1DGV A;  3CLN A;  1A29 A;  2LE9 B;  2LLU A;  4PE1 A;  2AMI A;  2KHN A;  1N0Y A;  2LNK A;  1J7R A;  1DF0 A;  2AUC A;  1JF0 A;  1LA3 A;  5HKY A;  1EG4 A;  3ZNI A;  4MN0 A;  5EL2 A;  4ETO A;  1B4C A;  2EC6 C;  1K8U A;  1XVJ A;  1ZAC A;  1W9Z A;  3EK4 A;  3I5F B;  3CS1 A;  1LVC D;  3BFH A;  4DRW A;  1ZFS A;  3D78 A;  1B9A A;  1KQM C;  1Y1A A;  2EC6 B;  2WOR A;  3TS5 B;  2BAP A;  2LMT A;  1AP4 A;  1IH0 A;  2JOJ A;  2M97 A;  3EKJ A;  4JKT A;  4YGD B;  1YTZ C;  4BY5 A;  3CZ1 A;  5HL1 A;  2GTE A;  1CKK A;  1QLS A;  2JU0 A;  1KQM B;  3CR5 X;  1L2O C;  3IF7 A;  4AOM A;  1B8L A;  4E68 A;  4PHN A;  1K9K A;  3F45 A;  4GGN A;  1Y6W A;  1SMG A;  2WCM A;  1NX1 A;  2JNF A;  4PHK A;  3I5H C;  2LHL A;  1CDN A;  1YUT A;  1L2O B;  1P28 A;  1TCF A;  1XFZ O;  3SG2 A;  4AQI A;  2JPO A;  2QEB A;  1B7T Y;  3NXA A;  5CSI A;  4A4B A;  2BNX A;  2F2P A;  3SS4 A;  4L9M A;  1CMG A;  2K2A A;  1EXR A;  3OB1 B;  4ORA B;  2OPO A;  3DD4 A;  3I5H B;  3S0F A;  2KI6 D;  3SS3 A;  1OOJ A;  2Y5I A;  1RRO A;  1DMO A;  5HKW A;  5I2L A;  5B8I B;  2KAX A;  1QX2 A;  2KFH A;  2JT0 A;  2P6B B;  1KK8 B;  1NP8 A;  3SS5 A;  1EL4 A;  3O78 A;  4FTG A;  1CFF A;  1YR5 A;  2LP2 A;  4C0K A;  1SL7 A;  2A4J A;  3GOF A;  3RLZ A;  1OMR A;  1SYM A;  1NCY A;  1K95 A;  2KDH A;  1NWD A;  1MWN A;  3AAJ A;  4MVF A;  2F2O A;  2WCJ A;  1XA5 A;  1A75 A;  2JT3 A;  4GFT A;  1A75 B;  2ZRS A;  4OKH A;  1XYD A;  2BBM A;  2I2R E;  3PAT A;  3BUN B;  3V2L A;  2QEO A;  2WCB A;  2JT8 A;  4ORB B;  1SCM C;  2SAS A;  1OOI X;  1AHR A;  1KSO A;  2GV5 A;  1N65 A;  5DKQ A;  5FI6 A;  1Q80 A;  2LVV A;  4OZD A;  3PFV A;  3QME A;  2R2I A;  2L2E A;  2G9B A;  3FE8 A;  1Y1U A;  5CSF A;  2JUL A;  2L51 A;  4NDB A;  1XK4 C;  2M49 B;  2K8M B;  2VRG A;  1SCM B;  3JTD C;  4HRE E;  4INW A;  3R1V A;  4MZL A;  4PCW A;  1LA0 A;  3NHI A;  1CLB A;  2JZI A;  1CDL A;  1TIZ A;  4JWQ A;  1RJV A;  4ZCU A;  4KYN A;  1DJZ A;  1GQM A;  1REC A;  5JOL A;  1KQV A;  5I2O A;  2LHI A;  2WCH A;  5TNC A;  1XK4 A;  3TDU A;  1H8B A;  1IQ3 A;  1LXF C;  1PVB A;  4P2Y B;  1F71 A;  2KBM A;  2WCK A;  2HQW A;  4USL A;  1C3Z A;  1WY9 A;  5G08 A;  3SG4 A;  2KAY A;  1L7Z A;  2K2F A;  1ZMZ A;  2I94 A;  1ODB A;  3CR4 X;  3H4S E;  2CT9 A;  2P70 A;  2QAC A;  1QLK A;  1NX3 A;  3CZ0 A;  5I2Q A;  2OS8 C;  1DTL A;  1OMD A;  1HT9 A;  2E30 A;  1DQE A;  2QPT A;  2ZFD A;  3CTN A;  4FQT A;  1B1G A;  1JSA A;  2FCD A;  2KI6 C;  2M0R A;  1A4P A;  1ALW A;  1M39 A;  2MAZ A;  1KK7 Z;  3BUO B;  2BCX A;  3D10 A;  3L4A A;  1TRF A;  5HLO A;  1LS8 A;  5FI7 A;  2OS8 B;  1DEL A;  1IIO A;  3DVK A;  4CFR A;  3EKH A;  1IJ5 A;  1DT7 B;  2MLF C;  1UUS A;  4GUK A;  4F7F A;  4MSP A;  3KPX A;  3HCM A;  1C07 A;  1SW8 A;  1QTX A;  1WRK A;  1G33 A;  3DF0 A;  1C7V A;  3DF0 B;  4WRI A;  1ALV A;  3K1E A;  5AEQ A;  3PN7 C;  4C0L A;  2M3W A;  2TN4 A;  1DJI A;  2L98 A;  3I5F C;  3ICB A;  1S36 A;  3IQO A;  1BJF A;  2K7C A;  3DY9 A;  1MQ1 A;  4D1E A;  2LUX A;  3TS5 C;  2M7L A;  1F4O A;  4YGC B;  1NX0 A;  2BE4 A;  2LVJ A;  3FIA A;  1G4Y R;  3NSL A;  1G8I A;  3PN7 B;  3CZ2 A;  3S0A A;  3BUM B;  1MF8 B;  3B6X A;  2FOT A;  3BYA A;  1DVI A;  1SBJ A;  2KAV A;  1AJ4 A;  2O5G A;  3DVM A;  4HSZ A;  5ER5 A;  3EK8 A;  3DXL A;  1MHO A;  2K0J A;  2M1K B;  1K96 A;  3S0D A;  2H61 C;  4BY4 A;  3S0B A;  4NDD A;  3R1P A;  3UO9 A;  1FBV A;  2L4I A;  1DJY A;  1AVS A;  4DUQ A;  1YX7 A;  2LLT A;  3VGO A;  3RZS A;  2QDI A;  5IBW A;  3LK0 A;  2Q91 A;  2KNE A;  2EHB A;  2M1U A;  1FF1 A;  2GGZ A;  2LAN A;  1JFK A;  1JBA A;  1YVH A;  4N1F A;  3GK2 A;  2H61 A;  2BBN A;  1QX5 B;  2WCE A;  2KOT A;  1QIV A;  1LKJ A;  4OV2 A;  3SG3 A;  3NGV A;  3CZT X;  5HKZ A;  1YRT B;  1QX7 A;  2ZND A;  1M46 A;  3NSK A;  3M0W A;  5DIC A;  2F8P A;  2HQ8 A;  1K2H A;  4MZK A;  2PAS A;  1K93 D;  4PE4 A;  5HYD A;  1KFU L;  1UWO A;  3PM2 A;  1FW4 A;  4CPV A;  2K7D A;  1KK8 C;  3GK4 X;  4FQO A;  1CLM A;  4CID A;  1MUX A;  2M7N A;  4XJK A;  4XJK B;  2IS9 A;  1PVA A;  2KFF A;  1DJW A;  3PM8 A;  1F55 A;  3EVR A;  1FI5 A;  3O2P A;  1T14 A;  3VB1 A;  1S6C A;  2JC2 A;  3CYZ A;  1M45 A;  3SG7 A;  1UHN A;  1OQP A;  3O6B A;  1X02 A;  1W7I B;  4MZJ A;  1CFD A;  2BKI B;  1CFP A;  3CWG A;  3S0G A;  1QAS A;  2ISD A;  2RGI A;  4I5J A;  3NSI A;  3E3R A;  4QJ5 B;  1TOP A;  2KBI A;  1BLQ A;  1S6I A;  2M8U A;  1UHH A;  5AAN A;  1MR8 A;  1QXP A;  1QWV A;  2MJW B;  1IWQ A;  3FE6 A;  3VRP A;  1CM1 A;  5PAL A;  1S5G Y;  2WCF A;  1IRJ A;  3HX4 A;  3D0Y A;  2LVI A;  1JF2 A;  3C1V A;  3D0Y B;  2WCL A;  2L2C A;  5CSJ A;  1TUZ A;  2NLN A;  3JVT B;  2ZN8 A;  2KQY A;  2LP3 A;  5I94 A;  5DKR A;  1DJH A;  1W7J B;  4CLN A;  2BKH B;  5K89 A;  2H8V A;  3KEV A;  5CPV A;  1OOG A;  2PMY A;  1FI6 A;  1BMO A;  4WQ2 A;  5I8N A;  5KTY A;  1LIN A;  2PVB A;  3B7A A;  1DEK A;  1TNP A;  4PE7 A;  1R6P A;  1J1D A;  4OVN F;  3BFA A;  2NCO A;  3SIA A;  4N5X A;  1TN4 A;  2HF5 A;  4QJ4 B;  1EJ3 A;  4YGA A;  1XO5 A;  3DYE A;  3TDI A;  1KFX L;  1YUR A;  1SR6 B;  1XFV O;  3LL8 B;  3N7H A;  4ICB A;  1YUU A;  1YRU B;  1DGU A;  4Q04 A;  3IVT A;  1CM4 A;  2NZ0 A;  4YI9 A;  5JJG A;  1OZS A;  5CSN A;  5D7F A;  3B86 A;  4U8D A;  2WOS A;  4M2Q A;  2JRF A;  3OX6 A;  1RWY A;  1WDC C;  1BG1 A;  4GAO A;  1D1O A;  3EK7 A;  2KPH A;  1J55 A;  1BT6 A;  1RK9 A;  2KYF A;  1IQ5 A;  1R2U A;  1YUS A;  4JQ0 D;  2I18 A;  1QV1 A;  1UHI A;  2WC5 A;  1TNW A;  2COL B;  1TNQ A;  1WDC B;  1K94 A;  2F3Z A;  2JPT A;  3NHT A;  3I5G C;  3OBV A;  1TTX A;  4OR9 B;  2CNP A;  1QVI Y;  3IQQ A;  4PHM A;  2LC5 A;  2JNX A;  3WNX B;  4I5K A;  4YBH B;  1DC1 A;  2KGB C;  1JUO A;  3SG5 A;  2LM5 A;  4I5N B;  2AAO A;  1AJ5 A;  1KK7 Y;  2QEV A;  1B8R A;  4MRY A;  1H4B A;  2H2K A;  3CR2 A;  1KCY A;  2FJY A;  1SNL A;  1GGZ A;  2HPS A;  3EVU A;  4HRG A;  4QJ3 B;  3I5G B;  1CNP A;  1C3Y A;  1IJ6 A;  4OCI A;  1JC2 A;  2OTG C;  2PAL A;  1KFU S;  1VRK A;  2QEH A;  2WC6 A;  1F54 A;  1CMF A;  3OX5 A;  1F4Q A;  1OZO A;  3I5I B;  3R72 A;  1WRL A;  1CFC A;  3SJS A;  1M63 B;  2NCP A;  2PYQ A;  1QV0 A;  2GGM A;  3K21 A;  1UP5 A;  2LLS A;  5FI2 A;  3SG6 A;  4M2O A;  2JWW A;  1TUJ A;  4ORC B;  2OTG B;  2CCM A;  2L50 A;  3D77 A;  3SIB A;  2L5Y A;  2Q4U A;  1BOC A;  4C0J A;  2M29 A;  3PSR A;  4XYN A;  1WLZ A;  1UUR A;  2CBL A;  3CAB A;  1OOH A;  4YGE B;  1PAL A;  3A4U B;  3WHT B;  4JPZ B;  1XFW O;  2Y1M A;  5KU1 A;  3D73 A;  2F3Y A;  1Y0V H;  1QS7 A;  4PAL A;  4PDZ A;  2WND A;  1JFJ A;  2B1U A;  1SL8 A;  3BFB A;  3BOW A;  5KSZ A;  4R1E A;  1SK6 D;  3BOW B;  4IJ7 A;  1V1F A;  1UHJ A;  1K9U A;  3TZ1 A;  2ZN9 A;  1DF0 B; 
#chains in the Genus database with same CATH homology
 4IL1 A;  1BR1 B;  2JXC A;  1IG5 A;  1MXE A;  3A8R A;  5ER4 X;  1M31 A;  3WXA A;  1SCV A;  1U5I A;  2D8N A;  2BCA A;  3DVE A;  1U5I B;  1XFY O;  1KWO C;  1RFJ A;  3QRX A;  4GBA A;  3LLE A;  4PE0 A;  1J7O A;  3BUW B;  2KQ6 A;  2O60 A;  1UHK A;  1Y1X A;  4DS7 A;  1PSB A;  1S6J A;  3AKA A;  2K7B A;  3LK1 A;  1JWD A;  1F8H A;  1KWO B;  5FYX A;  1NCZ A;  3RM1 A;  1KFX S;  1SKT A;  3KHE A;  3OP0 A;  1K90 D;  2F33 A;  2JTT A;  3OB2 B;  4NDC A;  1B47 A;  1B7T Z;  3AKB A;  3FS7 A;  3JVT C;  4ZCV A;  1NSH A;  1AUI B;  1KSM A;  2EGD A;  1XFU O;  2L4H A;  1ZOT B;  2E6W A;  2WC8 A;  1CTR A;  3DVJ A;  2M9G A;  3KO0 A;  2BE6 A;  2HET A;  1S26 D;  3TDZ A;  5BPJ A;  3TUY C;  3CGA A;  2KI4 C;  2KSP A;  2DOQ A;  2LMV A;  2LUC A;  1NCX A;  2CTN A;  1V1G A;  3EVV A;  1OSA A;  3VRN A;  3GK1 A;  1K9P A;  4N1G A;  2ZKM X;  2V53 A;  1SR6 C;  2Y4Q A;  5AXI A;  2BEC A;  1HQV A;  3TUY B;  2KI4 B;  1S5G Z;  1QIW A;  4GNK B;  2KFG A;  1S3P A;  2NXQ A;  2SCP A;  4MEW A;  3BXK A;  5HLV A;  1PSR A;  1A2X A;  1WRZ A;  2K7O A;  1B8C A;  2FCE A;  4YI8 A;  1N2D A;  4UPG A;  2MBX A;  1DJG A;  1TCO B;  1CLL A;  1RTP 1;  1A03 A;  4AQJ A;  2PRU A;  5DKN A;  2MRD A;  4HRH A;  1PUL A;  1OE9 B;  1NYA A;  2ZNE A;  1F70 A;  3AAK A;  4I5L B;  1EG3 A;  3LCP C;  4MLW A;  1ZUZ A;  1QAT A;  3NSO A;  3FWC A;  1TNX A;  1C7W A;  1IGV A;  2JXL A;  2G2B A;  2K61 A;  1S1E A;  4PHJ A;  4WQ3 A;  5AER A;  4TNC A;  1IKU A;  2ZRT A;  3VRR A;  1E8A A;  1NPQ A;  1GJY A;  3JTD B;  1MXL C;  2FJU B;  3PAL A;  3ZWH A;  4M2P A;  1YVL A;  1QJT A;  2LVK A;  1DJX A;  2Y1N A;  1NX2 A;  1CDM A;  4GGF C;  2LCP A;  3I5I C;  2MLE C;  4GPL B;  2KGR A;  1J7P A;  2LMU A;  2JTZ A;  4P5O E;  5J3X A;  2BCB A;  4DIR A;  3MSE B;  5D69 A;  1BU3 A;  4A4C A;  2LAP A;  4NQG A;  1NUB A;  3KF9 A;  5AFP A;  4CFQ A;  4MRX A;  2MHH A;  2L5X B;  1XFX O;  1QVI Z;  1NIW A;  1AK8 A;  2L0P A;  2PSR A;  4GGF A;  1FPW A;  3WHU B;  1PRW A;  1CDP A;  4MBE A;  1J1E A;  1WLM A;  3VRQ A;  1BOD A;  1SY9 A;  1BF5 A;  1PK0 D;  3BQ3 A;  2BL0 C;  2MA2 A;  1EH2 A;  1J7Q A;  3FWB A;  4DCK A;  2CXJ A;  4YRU A;  3BUX B;  2KYC A;  3PLF B;  1SL9 A;  1BR4 B;  2LV7 A;  3OHM B;  5GQQ C;  2I7A A;  5F6T A;  1CB1 A;  1GGW A;  2JQ6 A;  1YX8 A;  1SPY A;  4YGB B;  3O4Y A;  1SRA A;  1OMV A;  2BL0 B;  3VRO A;  1DGV A;  3CLN A;  1A29 A;  2LE9 B;  2LLU A;  4PE1 A;  2AMI A;  2KHN A;  1N0Y A;  2LNK A;  1J7R A;  1DF0 A;  2AUC A;  1JF0 A;  1LA3 A;  5HKY A;  1EG4 A;  3ZNI A;  4MN0 A;  4ETO A;  1B4C A;  2EC6 C;  1K8U A;  1XVJ A;  1ZAC A;  3EK4 A;  3I5F B;  3CS1 A;  1LVC D;  4DRW A;  1ZFS A;  1B9A A;  1KQM C;  1Y1A A;  2EC6 B;  2WOR A;  3TS5 B;  2LMT A;  1AP4 A;  1IH0 A;  2JOJ A;  2M97 A;  3EKJ A;  4YGD B;  1YTZ C;  4BY5 A;  1CKK A;  1QLS A;  2JU0 A;  1KQM B;  3CR5 X;  1L2O C;  3IF7 A;  4AOM A;  1B8L A;  4E68 A;  4PHN A;  1K9K A;  3F45 A;  4GGN A;  1Y6W A;  1SMG A;  1NX1 A;  2JNF A;  4PHK A;  3I5H C;  2LHL A;  1CDN A;  1YUT A;  1L2O B;  4AQI A;  1TCF A;  1XFZ O;  3SG2 A;  3NXA A;  1B7T Y;  5CSI A;  4A4B A;  2F2P A;  1CMG A;  4L9M A;  2K2A A;  1EXR A;  3OB1 B;  4ORA B;  2OPO A;  3DD4 A;  3I5H B;  2KI6 D;  1OOJ A;  2Y5I A;  1RRO A;  1DMO A;  5HKW A;  5I2L A;  5B8I B;  2KAX A;  1QX2 A;  2KFH A;  2JT0 A;  2P6B B;  1KK8 B;  1NP8 A;  1EL4 A;  3O78 A;  4FTG A;  1CFF A;  1YR5 A;  2LP2 A;  4C0K A;  1SL7 A;  2A4J A;  3GOF A;  3RLZ A;  1OMR A;  1SYM A;  1NCY A;  1K95 A;  2KDH A;  1NWD A;  1MWN A;  3AAJ A;  4MVF A;  2F2O A;  1XA5 A;  1A75 A;  2JT3 A;  4GFT A;  1A75 B;  2ZRS A;  4OKH A;  1XYD A;  2BBM A;  2I2R E;  3PAT A;  3BUN B;  2WCB A;  2JT8 A;  4ORB B;  1SCM C;  2SAS A;  1AHR A;  1KSO A;  2GV5 A;  1N65 A;  5DKQ A;  1Q80 A;  2LVV A;  3PFV A;  2R2I A;  2L2E A;  2G9B A;  1Y1U A;  5CSF A;  2JUL A;  2L51 A;  4NDB A;  1XK4 C;  2M49 B;  2K8M B;  2VRG A;  1SCM B;  3JTD C;  4HRE E;  4MZL A;  4PCW A;  4F0Z B;  1LA0 A;  1CLB A;  2JZI A;  1CDL A;  1TIZ A;  4JWQ A;  1RJV A;  4ZCU A;  1DJZ A;  1GQM A;  1REC A;  5JOL A;  1KQV A;  5I2O A;  2LHI A;  5TNC A;  1XK4 A;  3TDU A;  1H8B A;  1IQ3 A;  1LXF C;  1PVB A;  4P2Y B;  1F71 A;  2KBM A;  2HQW A;  4USL A;  1WY9 A;  5G08 A;  3SG4 A;  2KAY A;  1L7Z A;  2K2F A;  1ZMZ A;  2I94 A;  1ODB A;  3CR4 X;  3H4S E;  2CT9 A;  2QAC A;  1QLK A;  1NX3 A;  5I2Q A;  2OS8 C;  1DTL A;  1OMD A;  1HT9 A;  2E30 A;  2QPT A;  2ZFD A;  3CTN A;  1B1G A;  1JSA A;  2FCD A;  2KI6 C;  2M0R A;  1A4P A;  1ALW A;  1M39 A;  2MAZ A;  1KK7 Z;  3BUO B;  2BCX A;  3D10 A;  5HLO A;  1TRF A;  2OS8 B;  3DVK A;  4CFR A;  3EKH A;  1IJ5 A;  1DT7 B;  2MLF C;  1UUS A;  4GUK A;  4MSP A;  3KPX A;  3HCM A;  1C07 A;  1SW8 A;  1QTX A;  1WRK A;  1G33 A;  3DF0 A;  1C7V A;  3DF0 B;  4WRI A;  1ALV A;  5AEQ A;  3PN7 C;  4C0L A;  2M3W A;  2TN4 A;  1DJI A;  2L98 A;  3I5F C;  3ICB A;  1S36 A;  3IQO A;  1BJF A;  2K7C A;  1MQ1 A;  4D1E A;  2LUX A;  3TS5 C;  2M7L A;  1F4O A;  4YGC B;  1NX0 A;  2BE4 A;  2LVJ A;  3FIA A;  1G4Y R;  3NSL A;  1G8I A;  3PN7 B;  3BUM B;  1MF8 B;  2FOT A;  3BYA A;  1DVI A;  1SBJ A;  2KAV A;  1AJ4 A;  2O5G A;  3DVM A;  4HSZ A;  5ER5 A;  3EK8 A;  1MHO A;  2K0J A;  2M1K B;  1K96 A;  2H61 C;  4BY4 A;  4NDD A;  1FBV A;  2L4I A;  1DJY A;  1AVS A;  4DUQ A;  1YX7 A;  2LLT A;  3VGO A;  5IBW A;  3LK0 A;  2Q91 A;  2KNE A;  2EHB A;  2M1U A;  1FF1 A;  2GGZ A;  2LAN A;  1JFK A;  1JBA A;  1YVH A;  4N1F A;  3GK2 A;  2H61 A;  2BBN A;  1QX5 B;  2WCE A;  2KOT A;  1QIV A;  1LKJ A;  4OV2 A;  3SG3 A;  5HKZ A;  3CZT X;  1YRT B;  1QX7 A;  2ZND A;  1M46 A;  3NSK A;  3M0W A;  1K2H A;  2F8P A;  2HQ8 A;  4MZK A;  2PAS A;  1K93 D;  4PE4 A;  5HYD A;  1KFU L;  1UWO A;  1FW4 A;  4CPV A;  2K7D A;  1KK8 C;  3GK4 X;  4FQO A;  1CLM A;  4CID A;  1MUX A;  2M7N A;  4XJK A;  4XJK B;  2IS9 A;  1PVA A;  2KFF A;  1DJW A;  3PM8 A;  1F55 A;  3EVR A;  1FI5 A;  3O2P A;  1S6C A;  2JC2 A;  1M45 A;  3SG7 A;  1UHN A;  1OQP A;  3O6B A;  1X02 A;  1W7I B;  4MZJ A;  1CFD A;  2BKI B;  1CFP A;  3CWG A;  1QAS A;  2ISD A;  2RGI A;  4I5J A;  3NSI A;  3E3R A;  4QJ5 B;  1TOP A;  2KBI A;  1BLQ A;  1S6I A;  2M8U A;  1UHH A;  5AAN A;  1MR8 A;  1QXP A;  2MJW B;  1IWQ A;  3VRP A;  1CM1 A;  5PAL A;  1S5G Y;  2WCF A;  1IRJ A;  3HX4 A;  3D0Y A;  2LVI A;  1JF2 A;  3C1V A;  3D0Y B;  5CSJ A;  2NLN A;  3JVT B;  2ZN8 A;  2KQY A;  2LP3 A;  5DKR A;  1DJH A;  1W7J B;  4CLN A;  2BKH B;  5K89 A;  3KEV A;  5CPV A;  2PMY A;  1FI6 A;  1BMO A;  4WQ2 A;  5I8N A;  5KTY A;  1LIN A;  2PVB A;  1TNP A;  4PE7 A;  1R6P A;  1J1D A;  4OVN F;  2NCO A;  3SIA A;  4N5X A;  1TN4 A;  2HF5 A;  4QJ4 B;  1EJ3 A;  4YGA A;  1XO5 A;  3TDI A;  1KFX L;  1YUR A;  1SR6 B;  1XFV O;  3LL8 B;  4ICB A;  1YUU A;  1YRU B;  1DGU A;  4Q04 A;  1CM4 A;  2NZ0 A;  4YI9 A;  1OZS A;  5CSN A;  5D7F A;  4U8D A;  2WOS A;  4M2Q A;  2JRF A;  3OX6 A;  1RWY A;  1WDC C;  1BG1 A;  4GAO A;  1D1O A;  3EK7 A;  1J55 A;  1BT6 A;  1RK9 A;  2KYF A;  1IQ5 A;  1R2U A;  1YUS A;  4JQ0 D;  2I18 A;  1QV1 A;  1UHI A;  1TNW A;  2COL B;  1TNQ A;  1WDC B;  1K94 A;  2F3Z A;  2JPT A;  4OR9 B;  3I5G C;  5JJG A;  1TTX A;  4PHM A;  2CNP A;  1QVI Y;  3IQQ A;  3WNX B;  2LC5 A;  2JNX A;  4I5K A;  4YBH B;  2KGB C;  1JUO A;  3SG5 A;  2LM5 A;  4I5N B;  2AAO A;  1AJ5 A;  1KK7 Y;  1H4B A;  1B8R A;  4MRY A;  2H2K A;  3CR2 A;  1KCY A;  1SNL A;  1GGZ A;  2HPS A;  3EVU A;  4HRG A;  4QJ3 B;  3I5G B;  1CNP A;  1IJ6 A;  4OCI A;  1JC2 A;  2OTG C;  2PAL A;  1KFU S;  1VRK A;  1F54 A;  1CMF A;  3OX5 A;  1F4Q A;  1OZO A;  3I5I B;  1CFC A;  1WRL A;  3SJS A;  1M63 B;  2NCP A;  1QV0 A;  2GGM A;  3K21 A;  1UP5 A;  2LLS A;  3SG6 A;  4M2O A;  2JWW A;  4ORC B;  2OTG B;  2CCM A;  2L50 A;  3SIB A;  2Q4U A;  1BOC A;  4C0J A;  2M29 A;  3PSR A;  4XYN A;  1WLZ A;  1UUR A;  2CBL A;  4YGE B;  1PAL A;  3A4U B;  3WHT B;  4JPZ B;  1XFW O;  2Y1M A;  5KU1 A;  2F3Y A;  1Y0V H;  1QS7 A;  4PAL A;  4PDZ A;  2WND A;  1JFJ A;  2B1U A;  1SL8 A;  3BOW A;  5KSZ A;  4R1E A;  1SK6 D;  3BOW B;  1V1F A;  1UHJ A;  1K9U A;  3TZ1 A;  2ZN9 A;  1DF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...