1GGWA

Cdc4p from schizosaccharomyces pombe
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
140
structure length
140
Chain Sequence
STDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PROTEIN (CDC4P)
publication title Structure of Cdc4p, a contractile ring protein essential for cytokinesis in Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 30
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2000-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ggwA01
3KPXA 4GUKA 1MHOA 1OOJA 1J55A 1CTRA 1PSBA 5KU1A 2FOTA 5CSJA 3BUNB 1H4BA 2MJWB 2JNFA 1MF8B 3CLNA 3HCMA 1DF0A 1LVCD 1FBVA 2PRUA 3C1VA 2JNXA 3SG4A 2OTGB 1MXLC 2NLNA 2LVJA 1KWOB 1UHKA 3OB2B 1AVSA 4YI8A 1S5GY 5HKZA 2BE6A 3RM1A 1AJ5A 2F8PA 3NSIA 3O2PA 5DKNA 2PASA 1EH2A 2BKHB 2H2KA 2O60A 1J7OA 5IBWA 3SG5A 1KSMA 1NYAA 1HQVA 4HRHA 3I5IB 5DKRA 4MEWA 1UHJA 2JWWA 1QLKA 1QJTA 2ZNDA 4I5JA 1YR5A 1XO5A 2OPOA 5HKYA 1LA0A 3PATA 1KFXS 2BCXA 1F4OA 3DVEA 3VGOA 2MHHA 2Y1NA 1EG4A 2EC6C 2E6WA 2G2BA 3BOWB 3I5GB 5I2QA 2L5XB 5FYXA 4MN0A 1FI5A 3VRPA 4CFRA 4OV2A 2JT0A 3OX6A 4GNKB 4ORAB 1TNXA 2ZFDA 1NCXA 4NDBA 2KAXA 2KYCA 3M0WA 1KK7Y 2LVKA 1EJ3A 3TDIA 1YVHA 1CKKA 1DJGA 4P2YB 1CDMA 3KO0A 1CFCA 3DVKA 3ICBA 1CFPA 1TCOB 2LVIA 3OHMB 2L0PA 2BCBA 5CSNA 1AHRA 1KK8C 1NX2A 2KQYA 1DGVA 2MRDA 4DS7A 1LA3A 1DMOA 1W7IB 2KQ6A 3EK4A 1G8IA 5JJGA 3KHEA 1UP5A 4PE4A 1CNPA 2M8UA 1A4PA 3TUYB 1A29A 1K94A 2M0RA 1DJIA 1QXPA 3FWCA 1RFJA 4DIRA 1YRUB 1CFDA 2DOQA 2ZRSA 4DRWA 2FCDA 4N1FA 2I7AA 1QX7A 2M49B 1J1DA 1XFWO 1DT7B 1KFUL 4IL1A 5DKQA 5I2OA 1QIWA 2LAPA 1BOCA 1NIWA 1NSHA 2I94A 4C0LA 4CIDA 3CR4X 2JQ6A 1UWOA 2LP3A 3JTDC 4BY4A 2H61C 2KHNA 1Y1XA 2KI4B 3A4UB 3VRQA 1WRZA 1DJZA 1NUBA 5JOLA 4ORBB 4HSZA 3NSKA 3I5FC 1BF5A 2K61A 2QACA 1CLMA 1BG1A 1M31A 4U8DA 2BL0C 4GGFA 1KSOA 3BUWB 1BODA 1QTXA 1K90D 1F55A 2SCPA 2AAOA 2JOJA 3I5HC 1LINA 3AAJA 1MQ1A 2KBMA 2LHLA 2M1UA 1S36A 4BY5A 2KI6C 1U5IA 1XYDA 1B47A 1KQMC 1JSAA 5ER4X 1IQ3A 4OCIA 3D0YA 1DVIA 4MZLA 4PE1A 5I2LA 1F70A 1K2HA 1W7JB 1OMVA 4D1EA 1CDLA 2M9GA 3BUXB 1CLLA 3PN7B 1DGUA 1YUUA 2RGIA 3FWBA 1IWQA 1SNLA 2JULA 1Q80A 2NXQA 2EGDA 2I2RE 1DTLA 4MBEA 4FQOA 1SMGA 1TCFA 2F3ZA 2L4HA 2L50A 1SBJA 1MUXA 2HQ8A 3DD4A 1RTP1 4DUQA 2KGRA 4ICBA 5K89A 1EXRA 2LVVA 3WHTB 3E3RA 2BE4A 2JXCA 4ZCVA 1PK0D 1SR6C 1K8UA 1GGWA 2LLTA 5G08A 3GK4X 1QX5B 1G33A 2P6BB 1QV0A 1B8RA 4GAOA 2FJUB 1A75B 2I18A 4CPVA 1ODBA 2KNEA 1OZSA 1JWDA 1RWYA 3LK0A 4MRXA 2JTZA 2HQWA 1IH0A 1F71A 2MLEC 3WXAA 1QS7A 1TIZA 2EC6B 1B9AA 2HF5A 2KOTA 3PFVA 3EVRA 4YGBB 1UUSA 3BUOB 1NX3A 5AANA 1YUSA 4N5XA 3JVTC 1SPYA 1XA5A 1DJHA 1Y1UA 2KGBC 1TOPA 3OX5A 1L7ZA 2IS9A 4MZKA 1WLMA 5B8IB 1GJYA 3IQOA 1OSAA 3EKHA 4HREE 3BQ3A 2CNPA 2EHBA 4PHJA 1KK8B 2HPSA 2K0JA 3BOWA 2NZ0A 2LUCA 1B7TZ 2L51A 2F2PA 1IGVA 2OS8C 1AP4A 1WRKA 3PALA 2KYFA 2WCBA 2WC8A 1QASA 1IQ5A 1Y6WA 3NSOA 5J3XA 1QVIZ 1S26D 1IJ6A 1WDCB 2FCEA 1G4YR 2LLUA 3RLZA 1MWNA 2D8NA 1K9PA 3LCPC 1J7PA 4WQ2A 4AOMA 1BT6A 1KFXL 1XFVO 2JPTA 3CZTX 5CSIA 1JUOA 4A4CA 1SK6D 1N2DA 2JU0A 1NCYA 2MBXA 2AUCA 1UHHA 2M29A 1CMFA 1B8CA 1WY9A 1GQMA 1UHNA 4QJ3B 1TNQA 3NSLA 5D7FA 2JZIA 4MLWA 1J1EA 3OP0A 3DVMA 3CWGA 3A8RA 4DCKA 3FS7A 1F4QA 3ZWHA 5HYDA 2BL0B 2LE9B 4C0KA 2BCAA 1NX1A 1ZACA 2ZRTA 2E30A 2KAVA 3I5HB 1HT9A 2PALA 1EG3A 1NPQA 3GK2A 1X02A 2CXJA 5AXIA 4C0JA 1L2OC 1XK4A 2LMUA 2TN4A 3EVUA 1K9KA 1A03A 2KI6D 3NXAA 2LLSA 2LCPA 3SIAA 4OR9B 3TS5C 2KSPA 4I5NB 2LNKA 1M63B 1K93D 1ALWA 1BR4B 4MRYA 2LV7A 2MAZA 3O6BA 2VRGA 2CT9A 3TDZA 3IF7A 2LP2A 1J7RA 1FW4A 4OVNF 4PHKA 1QLSA 1PVBA 1QX2A 1WLZA 1K96A 1TTXA 1OMDA 3MSEB 2WCFA 2GV5A 1VRKA 1MXEA 4AQJA 2ZKMX 1SR6B 5AFPA 2K2FA 2Q4UA 4WQ3A 4F0ZB 1FI6A 4QJ5B 3WNXB 2M7LA 4USLA 1R2UA 1N0YA 1RK9A 2LMVA 3H4SE 2KFFA 4YGAA 1CM4A 2HETA 5HLVA 2WOSA 2Y1MA 1SYMA 2SASA 2M7NA 3PLFB 1B7TY 1BR1B 1SRAA 2ZN9A 2K8MB 2M97A 1OMRA 3KEVA 1B1GA 4PE0A 1XFUO 1N65A 2JTTA 1NWDA 2KDHA 1SL9A 2LHIA 2BECA 3D10A 4GGFC 4PE7A 1YRTB 1ZMZA 4NDCA 1QIVA 1S6IA 3O78A 1QVIY 2K2AA 4GPLB 1BLQA 3PM8A 2F33A 3LK1A 1TRFA 3DF0B 4PCWA 4YI9A 1OZOA 4MVFA 1A75A 1CLBA 4HRGA 4QJ4B 1BMOA 3FIAA 2PVBA 4E68A 1OE9B 3VRRA 4YGCB 1V1FA 1F8HA 3DVJA 4XJKB 5D69A 3CTNA 2LUXA 1SCMC 1JF2A 4TNCA 1LKJA 1XFYO 1CMGA 1EL4A 4NQGA 2OS8B 5KSZA 3BXKA 1DF0B 2LANA 2JT8A 5ER5A 1B8LA 5HKWA 1SL7A 3SG7A 4YRUA 2WCEA 2NCPA 1RJVA 4JPZB 1ZUZA 2L2EA 1H8BA 1KQVA 3CGAA 2KBIA 2AMIA 3PSRA 4Q04A 1JC2A 2WNDA 3LL8B 4R1EA 1PSRA 2KFGA 1CDPA 1SY9A 1JBAA 5I8NA 3SJSA 1R6PA 1XVJA 2L98A 2CBLA 4CLNA 3BYAA 1A2XA 3TDUA 4M2OA 3ZNIA 1TNWA 4UPGA 2OTGC 2MLFC 5CSFA 1QATA 1KWOC 2PSRA 4GGNA 2M3WA 3OB1B 4FTGA 4AQIA 2COLB 4YGEB 4NDDA 2K7BA 3VRNA 3JTDB 2KFHA 2CTNA 2G9BA 2LC5A 2JT3A 5GQQC 3I5IC 2H61A 1L2OB 1IRJA 4PALA 2ZNEA 2CCMA 1KFUS 1D1OA 1UURA 1J7QA 1FPWA 2F2OA 4N1GA 4PHMA 3I5FB 3TZ1A 1ZOTB 1RECA 3TS5B 1JFJA 3GOFA 3I5GC 1SL8A 1YVLA 3HX4A 3AKAA 3CR2A 1PVAA 4I5KA 4A4BA 4CFQA 3BUMB 4YGDB 1RROA 1SW8A 2V53A 1Y1AA 2K7CA 1NP8A 1KQMB 2LMTA 1K95A 4M2PA 1S5GZ 3K21A 2QPTA 1DJYA 1M46A 1AUIB 1YX7A 1YX8A 3IQQA 5CPVA 1B4CA 1SCVA 2JRFA 1IJ5A 2F3YA 2BBMA 1S1EA 1S3PA 4JQ0D 1YURA 4P5OE 5BPJA 1C07A 1FF1A 1YUTA 2ISDA 2BBNA 2K7OA 1WDCC 2B1UA 2NCOA 2R2IA 4XYNA 1XFZO 2BKIB 5HLOA 1PALA 2WORA 3SG2A 1SKTA 1UHIA 3CS1A 4GBAA 4YBHB 4PDZA 1M39A 3QRXA 3SG3A 3SG6A 2JC2A 1OQPA 1TN4A 3EVVA 2GGMA 2JXLA 3AKBA 5AEQA 3TUYC 1IG5A 1GGZA 4WRIA 2Y4QA 2O5GA 2K7DA 1NX0A 4M2QA 4MZJA 1E8AA 2M1KB 1CDNA 1C7VA 1C7WA 1Y0VH 1QV1A 5KTYA 2MA2A 2ZN8A 1KK7Z 1S6CA 1DJXA 3SIBA 4ETOA 1AK8A 2LM5A 1K9UA 1U5IB 4ORCB 2Q91A 3GK1A 4JWQA 5PALA 4L9MA 1PRWA 4GFTA 4PHNA 1XK4C 1NCZA 3AAKA 1V1GA 2KI4C 3D0YB 2PMYA 5TNCA 1BJFA 1PULA 1ALVA 3EK7A 1JF0A 2Y5IA 1ZFSA 1SCMB 1JFKA 1S6JA 4ZCUA 1M45A 3KF9A 1CFFA 3O4YA 1YTZC 4MSPA 2KAYA 1AJ4A 1BU3A 3JVTB 3VROA 1F54A 3LLEA 1CB1A 1KCYA 4OKHA 2GGZA 2A4JA 1IKUA 3EKJA 3DF0A 1MR8A 3EK8A 2L4IA 3CR5X 3WHUB 4I5LB 5F6TA 1DJWA 1LXFC 5AERA 1WRLA 1TNPA 1XFXO 3F45A 3PN7C 4XJKA 1CM1A
chains in the Genus database with same CATH superfamily
3KPXA 4GUKA 1MHOA 1OOJA 1J55A 2BNXA 5DICA 1CTRA 1PSBA 2ERBA 5KU1A 2FOTA 5CSJA 3BUNB 1H4BA 2MJWB 2JNFA 1MF8B 3CLNA 3HCMA 1DF0A 1LVCD 1FBVA 2PRUA 3C1VA 2JNXA 5FI6A 3SG4A 2L2CA 2OTGB 1MXLC 2NLNA 2LVJA 1KWOB 1UHKA 3OB2B 1AVSA 4YI8A 1S5GY 3D75A 5HKZA 2BE6A 3RM1A 1AJ5A 2F8PA 3NSIA 3O2PA 5DKNA 2PASA 1EH2A 2BKHB 2H2KA 2O60A 1J7OA 5IBWA 3SG5A 5FI7A 1KSMA 1NYAA 1HQVA 3S0GA 4HRHA 3I5IB 5DKRA 4MEWA 1UHJA 2JWWA 1QLKA 1QJTA 2ZNDA 4I5JA 1YR5A 1XO5A 2OPOA 5HKYA 1LA0A 3PATA 1TWOA 1KFXS 1F4OA 2BCXA 3DVEA 3VGOA 2MHHA 2Y1NA 1EG4A 2EC6C 2E6WA 2G2BA 3BOWB 3I5GB 5I2QA 2L5XB 5FYXA 4MN0A 1Z4HA 3R1VA 3UNWA 1FI5A 3VRPA 4CFRA 4OV2A 2JT0A 3OX6A 4GNKB 4ORAB 4INXA 1TNXA 2ZFDA 1NCXA 4NDBA 2KAXA 2KYCA 3M0WA 1KK7Y 2LVKA 1EJ3A 3TDIA 1YVHA 1CKKA 1DJGA 4P2YB 1CDMA 3KO0A 1CFCA 3DVKA 3ICBA 1CFPA 1TCOB 2LVIA 3OHMB 2L0PA 1GM0A 2BCBA 5CSNA 1AHRA 1KK8C 3D78A 1NX2A 2KQYA 5EL2A 1DGVA 2MRDA 4DS7A 1LA3A 1DMOA 1W7IB 2KQ6A 3EK4A 3S0BA 1G8IA 5JJGA 3KHEA 1UP5A 4PE4A 1CNPA 2M8UA 1A4PA 3DXLA 5D3OA 3TUYB 1A29A 1K94A 2M0RA 3UO9A 1DJIA 1QXPA 3BJHA 3FWCA 1RFJA 4DIRA 1YRUB 3B87A 1CFDA 2DOQA 2ZRSA 4INWA 4DRWA 3BFAA 2FCDA 4N1FA 2I7AA 1QX7A 3CDNA 2M49B 3SS5A 1J1DA 1XFWO 2YGUA 1DT7B 1KFUL 4IL1A 5DKQA 5I2OA 1QIWA 2LAPA 1BOCA 1NIWA 4PT1A 1NSHA 2I94A 4C0LA 4CIDA 3CR4X 2JQ6A 1UWOA 2LP3A 3JTDC 4BY4A 2H61C 2KHNA 1Y1XA 2KI4B 3A4UB 3VRQA 4FQTA 1WRZA 1DJZA 3K1EA 1NUBA 5JOLA 4ORBB 4HSZA 3NSKA 2WC5A 3I5FC 1BF5A 3SS4A 2K61A 2QACA 1CLMA 1BG1A 1M31A 4U8DA 2BL0C 4GGFA 1KSOA 3BUWB 1BODA 1QTXA 1K90D 1F55A 2SCPA 2AAOA 2JOJA 3I5HC 1LINA 3AAJA 1MQ1A 2KBMA 2LHLA 2M1UA 1S36A 2QEBA 2KI6C 4BY5A 1U5IA 1XYDA 1B47A 1KQMC 1JSAA 5ER4X 3PM2A 4OCIA 1IQ3A 3D0YA 1DVIA 4MZLA 4PE1A 5I2LA 3RZSA 1F70A 1K2HA 1W7JB 1OMVA 4D1EA 1CDLA 2M9GA 3BUXB 1CLLA 3OBVA 1DGUA 1YUUA 2RGIA 3FE6A 3CZ2A 3PN7B 3FWBA 3R1PA 4F7FA 1IWQA 1SNLA 2JULA 1Q80A 2NXQA 2EGDA 2I2RE 1DTLA 4MBEA 4FQOA 1SMGA 1TCFA 2F3ZA 2L4HA 2L50A 1SBJA 1MUXA 1W9ZA 2HQ8A 3DD4A 1RTP1 4DUQA 2KGRA 4ICBA 5K89A 1EXRA 2LVVA 3DYEA 3WHTB 3E3RA 2BE4A 2JXCA 4ZCVA 1PK0D 1SR6C 1K8UA 1GGWA 2LLTA 5G08A 3GK4X 1QX5B 1G33A 2P6BB 1QV0A 1B8RA 4GAOA 2FJUB 1A75B 2I18A 4CPVA 1ODBA 2KNEA 1OZSA 1JWDA 1RWYA 3LK0A 4MRXA 2JTZA 2HQWA 1IH0A 2BAPA 1F71A 2MLEC 3WXAA 1QS7A 1TIZA 2EC6B 1B9AA 2HF5A 2KOTA 3PFVA 1OOFA 1OW4A 3EVRA 1Z2CB 4YGBB 1UUSA 3BUOB 1NX3A 5AANA 3V2LA 1YUSA 4N5XA 3JVTC 1SPYA 1XA5A 1DJHA 1Y1UA 2KGBC 4OZDA 1TOPA 3OX5A 1L7ZA 2IS9A 4MZKA 1WLMA 5B8IB 1GJYA 3IQOA 2GTEA 3EG5B 1OSAA 3EKHA 4HREE 3BQ3A 2CNPA 2EHBA 4PHJA 1KK8B 2HPSA 2K0JA 3BOWA 2L5YA 2NZ0A 4JKTA 2LUCA 1B7TZ 2L51A 2F2PA 1IGVA 5I94A 2OS8C 1AP4A 1WRKA 3PALA 2KYFA 2WCBA 2WC8A 1QASA 1IQ5A 1Y6WA 3NSOA 5J3XA 1QVIZ 1S26D 1IJ6A 1WDCB 2FCEA 1G4YR 2LLUA 3RLZA 1MWNA 2D8NA 1K9PA 3LCPC 1J7PA 3N7HA 4WQ2A 4AOMA 1BT6A 1ORGA 1KFXL 1XFVO 2JPTA 3CZTX 5CSIA 1JUOA 4A4CA 1SK6D 1N2DA 2JU0A 1NCYA 4KYNA 2AUCA 1UHHA 2M29A 2MBXA 1B8CA 1WY9A 1CMFA 3O4XA 1GQMA 1UHNA 4QJ3B 1TNQA 3NSLA 5D7FA 2JZIA 4MLWA 1J1EA 3OP0A 3B86A 3DVMA 3CWGA 3A8RA 4DCKA 3FS7A 1F4QA 3D77A 3ZWHA 5HYDA 2BL0B 2LE9B 4C0KA 2BCAA 1NX1A 1ZACA 2ZRTA 2E30A 2KAVA 3I5HB 5HL1A 3R72A 1HT9A 3L4AA 2PALA 1EG3A 1NPQA 3GK2A 1X02A 2CXJA 5AXIA 4C0JA 1L2OC 1XK4A 2LMUA 2TN4A 3B88A 3EVUA 1K9KA 1A03A 2KI6D 3DZTA 3NXAA 2LLSA 2LCPA 3S0DA 3SIAA 4OR9B 3TS5C 3S0EA 2KSPA 4I5NB 2LNKA 1M63B 1K93D 3FE9A 2P70A 1ALWA 1BR4B 4MRYA 2LV7A 2MAZA 1OOGA 3O6BA 2VRGA 2CT9A 3TDZA 3IF7A 2LP2A 1J7RA 1FW4A 4OVNF 4PHKA 1QLSA 1PVBA 1QX2A 1WLZA 1K96A 1TTXA 1OMDA 3MSEB 2WCFA 2GV5A 1VRKA 1MXEA 1T14A 3DY9A 4AQJA 2ZKMX 1SR6B 2JPOA 2K2FA 2Q4UA 4WQ3A 2KLDA 4F0ZB 5AFPA 3S0AA 4QJ5B 3WNXB 2H8VA 1FI6A 2M7LA 4USLA 1R2UA 1N0YA 1RK9A 2LMVA 3H4SE 2KFFA 4YGAA 1CM4A 2HETA 1XFRA 5HLVA 2WOSA 2Y1MA 1SYMA 2SASA 2M7NA 3PLFB 1B7TY 1BR1B 1SRAA 2ZN9A 2K8MB 2M97A 1OMRA 3KEVA 1B1GA 4PE0A 1XFUO 3CZ1A 1N65A 2P71A 2JTTA 1NWDA 2KDHA 1SL9A 2LHIA 2BECA 3D10A 4GGFC 4PE7A 1YRTB 1ZMZA 4NDCA 1QIVA 1S6IA 1C3ZA 3NHIA 3O78A 1QVIY 2K2AA 4GPLB 1BLQA 3PM8A 2F33A 3LK1A 1TRFA 3DF0B 4PCWA 4YI9A 1OZOA 3NGVA 1A75A 4MVFA 1CLBA 3BFBA 4HRGA 4QJ4B 1BMOA 3FIAA 2PVBA 4E68A 1OE9B 3VRRA 4YGCB 1V1FA 1F8HA 3DVJA 4XJKB 5D69A 3CTNA 2LUXA 1SCMC 1JF2A 4TNCA 3R1OA 1OOHA 1LKJA 1XFYO 3CYZA 1CMGA 2WCMA 1EL4A 4NQGA 2KLEA 2OS8B 5KSZA 1QWVA 3BXKA 1TUJA 1DF0B 2LANA 2JT8A 5ER5A 2WCLA 1B8LA 1P28A 3D74A 5HKWA 1SL7A 3SG7A 4YRUA 2WCEA 2NCPA 1RJVA 4JPZB 3CZ0A 2KPHA 1ZUZA 2L2EA 2WCHA 1H8BA 1KQVA 3CGAA 2KBIA 2PYQA 2FJYA 2AMIA 3PSRA 4Q04A 1JC2A 2WNDA 3B7AA 3LL8B 4R1EA 1PSRA 2KFGA 1CDPA 1SY9A 1JBAA 5I8NA 3SJSA 1R6PA 1XVJA 2L98A 2CBLA 4CLNA 3BYAA 1A2XA 1TUZA 2QDIA 3TDUA 1C3YA 4M2OA 3ZNIA 4JD9A 1TNWA 2QEOA 4UPGA 2OTGC 2MLFC 5CSFA 1QATA 1KWOC 2PSRA 3D76A 4GGNA 2M3WA 3OB1B 4FTGA 4AQIA 2COLB 1LS8A 4YGEB 4NDDA 2K7BA 3VB1A 3VRNA 3JTDB 2KFHA 2CTNA 2G9BA 2LC5A 3BFHA 2JT3A 5GQQC 3I5IC 2H61A 3PJIA 1L2OB 3SS3A 1IRJA 4PALA 2ZNEA 2CCMA 1KFUS 5FI2A 1UURA 1D1OA 1J7QA 1FPWA 2F2OA 4N1GA 4PHMA 3I5FB 3TZ1A 1ZOTB 1RECA 3TS5B 1JFJA 3GOFA 3I5GC 1SL8A 1YVLA 3HX4A 3AKAA 3CR2A 3L4LA 1PVAA 2WCKA 2PQLA 3Q8IA 4I5KA 4A4BA 4CFQA 3BUMB 4YGDB 2QEVA 1RROA 1SW8A 2V53A 1Y1AA 2K7CA 2QEHA 1NP8A 3QMEA 1KQMB 2LMTA 1K95A 4M2PA 1S5GZ 1SSEB 3K21A 2QPTA 3D73A 1DC1A 1DJYA 3NHTA 1M46A 1AUIB 1YX7A 1YX8A 3IQQA 5CPVA 1B4CA 1SCVA 2JRFA 2WC6A 1IJ5A 2F3YA 2BBMA 1S1EA 1S3PA 3CABA 2WCJA 4JQ0D 1YURA 4P5OE 5BPJA 1C07A 1FF1A 1YUTA 2K60A 2ISDA 2BBNA 2K7OA 1WDCC 2B1UA 2NCOA 2R2IA 4XYNA 1XFZO 2BKIB 5HLOA 1PALA 2WORA 3SG2A 1DEKA 1SKTA 1UHIA 3CS1A 4GBAA 4YBHB 4PDZA 1M39A 3QRXA 3IVTA 3FE8A 2JC2A 1OQPA 1TN4A 3SG6A 3SG3A 3EVVA 2GGMA 2JXLA 3AKBA 5AEQA 3TUYC 1IG5A 1GGZA 4WRIA 1DELA 2Y4QA 2O5GA 2K7DA 3OGNA 1NX0A 4M2QA 4MZJA 1E8AA 1OOIX 2M1KB 1CDNA 1C7VA 1C7WA 3B6XA 1Y0VH 1QV1A 5KTYA 1DQEA 2MA2A 2ZN8A 1KK7Z 1S6CA 1DJXA 3SIBA 4ETOA 1AK8A 2LM5A 1K9UA 1U5IB 4ORCB 2Q91A 3GK1A 4JWQA 5PALA 3S0FA 4L9MA 1PRWA 4GFTA 4PHNA 1XK4C 1NCZA 3AAKA 1V1GA 2KI4C 3D0YB 2PMYA 5TNCA 1BJFA 1PULA 1ALVA 3EK7A 1JF0A 2Y5IA 1ZFSA 1SCMB 3L47A 1JFKA 1S6JA 4ZCUA 1M45A 3KF9A 1CFFA 3O4YA 1YTZC 4MSPA 2KAYA 1AJ4A 1BU3A 3JVTB 3VROA 1F54A 3LLEA 1CB1A 1KCYA 4OKHA 2GGZA 2A4JA 1IKUA 4IJ7A 3EKJA 3DF0A 1MR8A 3EK8A 2L4IA 3CR5X 3WHUB 4I5LB 5F6TA 1DJWA 1LXFC 5AERA 1IIOA 1WRLA 1TNPA 1XFXO 3F45A 3PN7C 4XJKA 1CM1A
chains in the Genus database with same CATH topology
3KPXA 4GUKA 1MHOA 1OOJA 1J55A 1CTRA 1PSBA 5KU1A 2FOTA 5CSJA 3BUNB 1H4BA 2MJWB 2JNFA 1MF8B 3CLNA 3HCMA 1DF0A 1LVCD 1FBVA 2PRUA 3C1VA 2JNXA 3SG4A 2OTGB 1MXLC 2NLNA 2LVJA 1KWOB 1UHKA 3OB2B 1AVSA 4YI8A 1S5GY 5HKZA 2BE6A 3RM1A 1AJ5A 2F8PA 3NSIA 3O2PA 5DKNA 2PASA 1EH2A 2BKHB 2H2KA 2O60A 1J7OA 5IBWA 3SG5A 1KSMA 1NYAA 1HQVA 4HRHA 3I5IB 5DKRA 4MEWA 1UHJA 2JWWA 1QLKA 1QJTA 2ZNDA 4I5JA 1YR5A 1XO5A 2OPOA 5HKYA 1LA0A 3PATA 1KFXS 2BCXA 1F4OA 3DVEA 3VGOA 2MHHA 2Y1NA 1EG4A 2EC6C 2E6WA 2G2BA 3BOWB 3I5GB 5I2QA 2L5XB 5FYXA 4MN0A 1FI5A 3VRPA 4CFRA 4OV2A 2JT0A 3OX6A 4GNKB 4ORAB 1TNXA 2ZFDA 1NCXA 4NDBA 2KAXA 2KYCA 3M0WA 1KK7Y 2LVKA 1EJ3A 3TDIA 1YVHA 1CKKA 1DJGA 4P2YB 1CDMA 3KO0A 1CFCA 3DVKA 3ICBA 1CFPA 1TCOB 2LVIA 3OHMB 2L0PA 2BCBA 5CSNA 1AHRA 1KK8C 1NX2A 2KQYA 1DGVA 2MRDA 4DS7A 1LA3A 1DMOA 1W7IB 2KQ6A 3EK4A 1G8IA 5JJGA 3KHEA 1UP5A 4PE4A 1CNPA 2M8UA 1A4PA 3TUYB 1A29A 1K94A 2M0RA 1DJIA 1QXPA 3FWCA 1RFJA 4DIRA 1YRUB 1CFDA 2DOQA 2ZRSA 4DRWA 2FCDA 4N1FA 2I7AA 1QX7A 2M49B 1J1DA 1XFWO 1DT7B 1KFUL 4IL1A 5DKQA 5I2OA 1QIWA 2LAPA 1BOCA 1NIWA 1NSHA 2I94A 4C0LA 4CIDA 3CR4X 2JQ6A 1UWOA 2LP3A 3JTDC 4BY4A 2H61C 2KHNA 1Y1XA 2KI4B 3A4UB 3VRQA 1WRZA 1DJZA 1NUBA 5JOLA 4ORBB 4HSZA 3NSKA 3I5FC 1BF5A 2K61A 2QACA 1CLMA 1BG1A 1M31A 4U8DA 2BL0C 4GGFA 1KSOA 3BUWB 1BODA 1QTXA 1K90D 1F55A 2SCPA 2AAOA 2JOJA 3I5HC 1LINA 3AAJA 1MQ1A 2KBMA 2LHLA 2M1UA 1S36A 4BY5A 2KI6C 1U5IA 1XYDA 1B47A 1KQMC 1JSAA 5ER4X 1IQ3A 4OCIA 3D0YA 1DVIA 4MZLA 4PE1A 5I2LA 1F70A 1K2HA 1W7JB 1OMVA 4D1EA 1CDLA 2M9GA 3BUXB 1CLLA 3PN7B 1DGUA 1YUUA 2RGIA 3FWBA 1IWQA 1SNLA 2JULA 1Q80A 2NXQA 2EGDA 2I2RE 1DTLA 4MBEA 4FQOA 1SMGA 1TCFA 2F3ZA 2L4HA 2L50A 1SBJA 1MUXA 2HQ8A 3DD4A 1RTP1 4DUQA 2KGRA 4ICBA 5K89A 1EXRA 2LVVA 3WHTB 3E3RA 2BE4A 2JXCA 4ZCVA 1PK0D 1SR6C 1K8UA 1GGWA 2LLTA 5G08A 3GK4X 1QX5B 1G33A 2P6BB 1QV0A 1B8RA 4GAOA 2FJUB 1A75B 2I18A 4CPVA 1ODBA 2KNEA 1OZSA 1JWDA 1RWYA 3LK0A 4MRXA 2JTZA 2HQWA 1IH0A 1F71A 2MLEC 3WXAA 1QS7A 1TIZA 2EC6B 1B9AA 2HF5A 2KOTA 3PFVA 3EVRA 4YGBB 1UUSA 3BUOB 1NX3A 5AANA 1YUSA 4N5XA 3JVTC 1SPYA 1XA5A 1DJHA 1Y1UA 2KGBC 1TOPA 3OX5A 1L7ZA 2IS9A 4MZKA 1WLMA 5B8IB 1GJYA 3IQOA 1OSAA 3EKHA 4HREE 3BQ3A 2CNPA 2EHBA 4PHJA 1KK8B 2HPSA 2K0JA 3BOWA 2NZ0A 2LUCA 1B7TZ 2L51A 2F2PA 1IGVA 2OS8C 1AP4A 1WRKA 3PALA 2KYFA 2WCBA 2WC8A 1QASA 1IQ5A 1Y6WA 3NSOA 5J3XA 1QVIZ 1S26D 1IJ6A 1WDCB 2FCEA 1G4YR 2LLUA 3RLZA 1MWNA 2D8NA 1K9PA 3LCPC 1J7PA 4WQ2A 4AOMA 1BT6A 1KFXL 1XFVO 2JPTA 3CZTX 5CSIA 1JUOA 4A4CA 1SK6D 1N2DA 2JU0A 1NCYA 2MBXA 2AUCA 1UHHA 2M29A 1CMFA 1B8CA 1WY9A 1GQMA 1UHNA 4QJ3B 1TNQA 3NSLA 5D7FA 2JZIA 4MLWA 1J1EA 3OP0A 3DVMA 3CWGA 3A8RA 4DCKA 3FS7A 1F4QA 3ZWHA 5HYDA 2BL0B 2LE9B 4C0KA 2BCAA 1NX1A 1ZACA 2ZRTA 2E30A 2KAVA 3I5HB 1HT9A 2PALA 1EG3A 1NPQA 3GK2A 1X02A 2CXJA 5AXIA 4C0JA 1L2OC 1XK4A 2LMUA 2TN4A 3EVUA 1K9KA 1A03A 2KI6D 3NXAA 2LLSA 2LCPA 3SIAA 4OR9B 3TS5C 2KSPA 4I5NB 2LNKA 1M63B 1K93D 1ALWA 1BR4B 4MRYA 2LV7A 2MAZA 3O6BA 2VRGA 2CT9A 3TDZA 3IF7A 2LP2A 1J7RA 1FW4A 4OVNF 4PHKA 1QLSA 1PVBA 1QX2A 1WLZA 1K96A 1TTXA 1OMDA 3MSEB 2WCFA 2GV5A 1VRKA 1MXEA 4AQJA 2ZKMX 1SR6B 5AFPA 2K2FA 2Q4UA 4WQ3A 4F0ZB 1FI6A 4QJ5B 3WNXB 2M7LA 4USLA 1R2UA 1N0YA 1RK9A 2LMVA 3H4SE 2KFFA 4YGAA 1CM4A 2HETA 5HLVA 2WOSA 2Y1MA 1SYMA 2SASA 2M7NA 3PLFB 1B7TY 1BR1B 1SRAA 2ZN9A 2K8MB 2M97A 1OMRA 3KEVA 1B1GA 4PE0A 1XFUO 1N65A 2JTTA 1NWDA 2KDHA 1SL9A 2LHIA 2BECA 3D10A 4GGFC 4PE7A 1YRTB 1ZMZA 4NDCA 1QIVA 1S6IA 3O78A 1QVIY 2K2AA 4GPLB 1BLQA 3PM8A 2F33A 3LK1A 1TRFA 3DF0B 4PCWA 4YI9A 1OZOA 4MVFA 1A75A 1CLBA 4HRGA 4QJ4B 1BMOA 3FIAA 2PVBA 4E68A 1OE9B 3VRRA 4YGCB 1V1FA 1F8HA 3DVJA 4XJKB 5D69A 3CTNA 2LUXA 1SCMC 1JF2A 4TNCA 1LKJA 1XFYO 1CMGA 1EL4A 4NQGA 2OS8B 5KSZA 3BXKA 1DF0B 2LANA 2JT8A 5ER5A 1B8LA 5HKWA 1SL7A 3SG7A 4YRUA 2WCEA 2NCPA 1RJVA 4JPZB 1ZUZA 2L2EA 1H8BA 1KQVA 3CGAA 2KBIA 2AMIA 3PSRA 4Q04A 1JC2A 2WNDA 3LL8B 4R1EA 1PSRA 2KFGA 1CDPA 1SY9A 1JBAA 5I8NA 3SJSA 1R6PA 1XVJA 2L98A 2CBLA 4CLNA 3BYAA 1A2XA 3TDUA 4M2OA 3ZNIA 1TNWA 4UPGA 2OTGC 2MLFC 5CSFA 1QATA 1KWOC 2PSRA 4GGNA 2M3WA 3OB1B 4FTGA 4AQIA 2COLB 4YGEB 4NDDA 2K7BA 3VRNA 3JTDB 2KFHA 2CTNA 2G9BA 2LC5A 2JT3A 5GQQC 3I5IC 2H61A 1L2OB 1IRJA 4PALA 2ZNEA 2CCMA 1KFUS 1D1OA 1UURA 1J7QA 1FPWA 2F2OA 4N1GA 4PHMA 3I5FB 3TZ1A 1ZOTB 1RECA 3TS5B 1JFJA 3GOFA 3I5GC 1SL8A 1YVLA 3HX4A 3AKAA 3CR2A 1PVAA 4I5KA 4A4BA 4CFQA 3BUMB 4YGDB 1RROA 1SW8A 2V53A 1Y1AA 2K7CA 1NP8A 1KQMB 2LMTA 1K95A 4M2PA 1S5GZ 3K21A 2QPTA 1DJYA 1M46A 1AUIB 1YX7A 1YX8A 3IQQA 5CPVA 1B4CA 1SCVA 2JRFA 1IJ5A 2F3YA 2BBMA 1S1EA 1S3PA 4JQ0D 1YURA 4P5OE 5BPJA 1C07A 1FF1A 1YUTA 2ISDA 2BBNA 2K7OA 1WDCC 2B1UA 2NCOA 2R2IA 4XYNA 1XFZO 2BKIB 5HLOA 1PALA 2WORA 3SG2A 1SKTA 1UHIA 3CS1A 4GBAA 4YBHB 4PDZA 1M39A 3QRXA 3SG3A 3SG6A 2JC2A 1OQPA 1TN4A 3EVVA 2GGMA 2JXLA 3AKBA 5AEQA 3TUYC 1IG5A 1GGZA 4WRIA 2Y4QA 2O5GA 2K7DA 1NX0A 4M2QA 4MZJA 1E8AA 2M1KB 1CDNA 1C7VA 1C7WA 1Y0VH 1QV1A 5KTYA 2MA2A 2ZN8A 1KK7Z 1S6CA 1DJXA 3SIBA 4ETOA 1AK8A 2LM5A 1K9UA 1U5IB 4ORCB 2Q91A 3GK1A 4JWQA 5PALA 4L9MA 1PRWA 4GFTA 4PHNA 1XK4C 1NCZA 3AAKA 1V1GA 2KI4C 3D0YB 2PMYA 5TNCA 1BJFA 1PULA 1ALVA 3EK7A 1JF0A 2Y5IA 1ZFSA 1SCMB 1JFKA 1S6JA 4ZCUA 1M45A 3KF9A 1CFFA 3O4YA 1YTZC 4MSPA 2KAYA 1AJ4A 1BU3A 3JVTB 3VROA 1F54A 3LLEA 1CB1A 1KCYA 4OKHA 2GGZA 2A4JA 1IKUA 3EKJA 3DF0A 1MR8A 3EK8A 2L4IA 3CR5X 3WHUB 4I5LB 5F6TA 1DJWA 1LXFC 5AERA 1WRLA 1TNPA 1XFXO 3F45A 3PN7C 4XJKA 1CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPX A;  4GUK A;  1MHO A;  1OOJ A;  1J55 A;  1CTR A;  1PSB A;  5KU1 A;  2FOT A;  5CSJ A;  3BUN B;  1H4B A;  2MJW B;  2JNF A;  1MF8 B;  3CLN A;  3HCM A;  1DF0 A;  1LVC D;  1FBV A;  2PRU A;  3C1V A;  2JNX A;  3SG4 A;  2OTG B;  1MXL C;  2NLN A;  2LVJ A;  1KWO B;  1UHK A;  3OB2 B;  1AVS A;  4YI8 A;  1S5G Y;  5HKZ A;  2BE6 A;  3RM1 A;  1AJ5 A;  2F8P A;  3NSI A;  3O2P A;  5DKN A;  2PAS A;  1EH2 A;  2BKH B;  2H2K A;  2O60 A;  1J7O A;  5IBW A;  3SG5 A;  1KSM A;  1NYA A;  1HQV A;  4HRH A;  3I5I B;  5DKR A;  4MEW A;  1UHJ A;  2JWW A;  1QLK A;  1QJT A;  2ZND A;  4I5J A;  1YR5 A;  1XO5 A;  2OPO A;  5HKY A;  1LA0 A;  3PAT A;  1KFX S;  2BCX A;  1F4O A;  3DVE A;  3VGO A;  2MHH A;  2Y1N A;  1EG4 A;  2EC6 C;  2E6W A;  2G2B A;  3BOW B;  3I5G B;  5I2Q A;  2L5X B;  5FYX A;  4MN0 A;  1FI5 A;  3VRP A;  4CFR A;  4OV2 A;  2JT0 A;  3OX6 A;  4GNK B;  4ORA B;  1TNX A;  2ZFD A;  1NCX A;  4NDB A;  2KAX A;  2KYC A;  3M0W A;  1KK7 Y;  2LVK A;  1EJ3 A;  3TDI A;  1YVH A;  1CKK A;  1DJG A;  4P2Y B;  1CDM A;  3KO0 A;  1CFC A;  3DVK A;  3ICB A;  1CFP A;  1TCO B;  2LVI A;  3OHM B;  2L0P A;  2BCB A;  5CSN A;  1AHR A;  1KK8 C;  1NX2 A;  2KQY A;  1DGV A;  2MRD A;  4DS7 A;  1LA3 A;  1DMO A;  1W7I B;  2KQ6 A;  3EK4 A;  1G8I A;  5JJG A;  3KHE A;  1UP5 A;  4PE4 A;  1CNP A;  2M8U A;  1A4P A;  3TUY B;  1A29 A;  1K94 A;  2M0R A;  1DJI A;  1QXP A;  3FWC A;  1RFJ A;  4DIR A;  1YRU B;  1CFD A;  2DOQ A;  2ZRS A;  4DRW A;  2FCD A;  4N1F A;  2I7A A;  1QX7 A;  2M49 B;  1J1D A;  1XFW O;  1DT7 B;  1KFU L;  4IL1 A;  5DKQ A;  5I2O A;  1QIW A;  2LAP A;  1BOC A;  1NIW A;  1NSH A;  2I94 A;  4C0L A;  4CID A;  3CR4 X;  2JQ6 A;  1UWO A;  2LP3 A;  3JTD C;  4BY4 A;  2H61 C;  2KHN A;  1Y1X A;  2KI4 B;  3A4U B;  3VRQ A;  1WRZ A;  1DJZ A;  1NUB A;  5JOL A;  4ORB B;  4HSZ A;  3NSK A;  3I5F C;  1BF5 A;  2K61 A;  2QAC A;  1CLM A;  1BG1 A;  1M31 A;  4U8D A;  2BL0 C;  4GGF A;  1KSO A;  3BUW B;  1BOD A;  1QTX A;  1K90 D;  1F55 A;  2SCP A;  2AAO A;  2JOJ A;  3I5H C;  1LIN A;  3AAJ A;  1MQ1 A;  2KBM A;  2LHL A;  2M1U A;  1S36 A;  4BY5 A;  2KI6 C;  1U5I A;  1XYD A;  1B47 A;  1KQM C;  1JSA A;  5ER4 X;  1IQ3 A;  4OCI A;  3D0Y A;  1DVI A;  4MZL A;  4PE1 A;  5I2L A;  1F70 A;  1K2H A;  1W7J B;  1OMV A;  4D1E A;  1CDL A;  2M9G A;  3BUX B;  1CLL A;  3PN7 B;  1DGU A;  1YUU A;  2RGI A;  3FWB A;  1IWQ A;  1SNL A;  2JUL A;  1Q80 A;  2NXQ A;  2EGD A;  2I2R E;  1DTL A;  4MBE A;  4FQO A;  1SMG A;  1TCF A;  2F3Z A;  2L4H A;  2L50 A;  1SBJ A;  1MUX A;  2HQ8 A;  3DD4 A;  1RTP 1;  4DUQ A;  2KGR A;  4ICB A;  5K89 A;  1EXR A;  2LVV A;  3WHT B;  3E3R A;  2BE4 A;  2JXC A;  4ZCV A;  1PK0 D;  1SR6 C;  1K8U A;  1GGW A;  2LLT A;  5G08 A;  3GK4 X;  1QX5 B;  1G33 A;  2P6B B;  1QV0 A;  1B8R A;  4GAO A;  2FJU B;  1A75 B;  2I18 A;  4CPV A;  1ODB A;  2KNE A;  1OZS A;  1JWD A;  1RWY A;  3LK0 A;  4MRX A;  2JTZ A;  2HQW A;  1IH0 A;  1F71 A;  2MLE C;  3WXA A;  1QS7 A;  1TIZ A;  2EC6 B;  1B9A A;  2HF5 A;  2KOT A;  3PFV A;  3EVR A;  4YGB B;  1UUS A;  3BUO B;  1NX3 A;  5AAN A;  1YUS A;  4N5X A;  3JVT C;  1SPY A;  1XA5 A;  1DJH A;  1Y1U A;  2KGB C;  1TOP A;  3OX5 A;  1L7Z A;  2IS9 A;  4MZK A;  1WLM A;  5B8I B;  1GJY A;  3IQO A;  1OSA A;  3EKH A;  4HRE E;  3BQ3 A;  2CNP A;  2EHB A;  4PHJ A;  1KK8 B;  2HPS A;  2K0J A;  3BOW A;  2NZ0 A;  2LUC A;  1B7T Z;  2L51 A;  2F2P A;  1IGV A;  2OS8 C;  1AP4 A;  1WRK A;  3PAL A;  2KYF A;  2WCB A;  2WC8 A;  1QAS A;  1IQ5 A;  1Y6W A;  3NSO A;  5J3X A;  1QVI Z;  1S26 D;  1IJ6 A;  1WDC B;  2FCE A;  1G4Y R;  2LLU A;  3RLZ A;  1MWN A;  2D8N A;  1K9P A;  3LCP C;  1J7P A;  4WQ2 A;  4AOM A;  1BT6 A;  1KFX L;  1XFV O;  2JPT A;  3CZT X;  5CSI A;  1JUO A;  4A4C A;  1SK6 D;  1N2D A;  2JU0 A;  1NCY A;  2MBX A;  2AUC A;  1UHH A;  2M29 A;  1CMF A;  1B8C A;  1WY9 A;  1GQM A;  1UHN A;  4QJ3 B;  1TNQ A;  3NSL A;  5D7F A;  2JZI A;  4MLW A;  1J1E A;  3OP0 A;  3DVM A;  3CWG A;  3A8R A;  4DCK A;  3FS7 A;  1F4Q A;  3ZWH A;  5HYD A;  2BL0 B;  2LE9 B;  4C0K A;  2BCA A;  1NX1 A;  1ZAC A;  2ZRT A;  2E30 A;  2KAV A;  3I5H B;  1HT9 A;  2PAL A;  1EG3 A;  1NPQ A;  3GK2 A;  1X02 A;  2CXJ A;  5AXI A;  4C0J A;  1L2O C;  1XK4 A;  2LMU A;  2TN4 A;  3EVU A;  1K9K A;  1A03 A;  2KI6 D;  3NXA A;  2LLS A;  2LCP A;  3SIA A;  4OR9 B;  3TS5 C;  2KSP A;  4I5N B;  2LNK A;  1M63 B;  1K93 D;  1ALW A;  1BR4 B;  4MRY A;  2LV7 A;  2MAZ A;  3O6B A;  2VRG A;  2CT9 A;  3TDZ A;  3IF7 A;  2LP2 A;  1J7R A;  1FW4 A;  4OVN F;  4PHK A;  1QLS A;  1PVB A;  1QX2 A;  1WLZ A;  1K96 A;  1TTX A;  1OMD A;  3MSE B;  2WCF A;  2GV5 A;  1VRK A;  1MXE A;  4AQJ A;  2ZKM X;  1SR6 B;  5AFP A;  2K2F A;  2Q4U A;  4WQ3 A;  4F0Z B;  1FI6 A;  4QJ5 B;  3WNX B;  2M7L A;  4USL A;  1R2U A;  1N0Y A;  1RK9 A;  2LMV A;  3H4S E;  2KFF A;  4YGA A;  1CM4 A;  2HET A;  5HLV A;  2WOS A;  2Y1M A;  1SYM A;  2SAS A;  2M7N A;  3PLF B;  1B7T Y;  1BR1 B;  1SRA A;  2ZN9 A;  2K8M B;  2M97 A;  1OMR A;  3KEV A;  1B1G A;  4PE0 A;  1XFU O;  1N65 A;  2JTT A;  1NWD A;  2KDH A;  1SL9 A;  2LHI A;  2BEC A;  3D10 A;  4GGF C;  4PE7 A;  1YRT B;  1ZMZ A;  4NDC A;  1QIV A;  1S6I A;  3O78 A;  1QVI Y;  2K2A A;  4GPL B;  1BLQ A;  3PM8 A;  2F33 A;  3LK1 A;  1TRF A;  3DF0 B;  4PCW A;  4YI9 A;  1OZO A;  4MVF A;  1A75 A;  1CLB A;  4HRG A;  4QJ4 B;  1BMO A;  3FIA A;  2PVB A;  4E68 A;  1OE9 B;  3VRR A;  4YGC B;  1V1F A;  1F8H A;  3DVJ A;  4XJK B;  5D69 A;  3CTN A;  2LUX A;  1SCM C;  1JF2 A;  4TNC A;  1LKJ A;  1XFY O;  1CMG A;  1EL4 A;  4NQG A;  2OS8 B;  5KSZ A;  3BXK A;  1DF0 B;  2LAN A;  2JT8 A;  5ER5 A;  1B8L A;  5HKW A;  1SL7 A;  3SG7 A;  4YRU A;  2WCE A;  2NCP A;  1RJV A;  4JPZ B;  1ZUZ A;  2L2E A;  1H8B A;  1KQV A;  3CGA A;  2KBI A;  2AMI A;  3PSR A;  4Q04 A;  1JC2 A;  2WND A;  3LL8 B;  4R1E A;  1PSR A;  2KFG A;  1CDP A;  1SY9 A;  1JBA A;  5I8N A;  3SJS A;  1R6P A;  1XVJ A;  2L98 A;  2CBL A;  4CLN A;  3BYA A;  1A2X A;  3TDU A;  4M2O A;  3ZNI A;  1TNW A;  4UPG A;  2OTG C;  2MLF C;  5CSF A;  1QAT A;  1KWO C;  2PSR A;  4GGN A;  2M3W A;  3OB1 B;  4FTG A;  4AQI A;  2COL B;  4YGE B;  4NDD A;  2K7B A;  3VRN A;  3JTD B;  2KFH A;  2CTN A;  2G9B A;  2LC5 A;  2JT3 A;  5GQQ C;  3I5I C;  2H61 A;  1L2O B;  1IRJ A;  4PAL A;  2ZNE A;  2CCM A;  1KFU S;  1D1O A;  1UUR A;  1J7Q A;  1FPW A;  2F2O A;  4N1G A;  4PHM A;  3I5F B;  3TZ1 A;  1ZOT B;  1REC A;  3TS5 B;  1JFJ A;  3GOF A;  3I5G C;  1SL8 A;  1YVL A;  3HX4 A;  3AKA A;  3CR2 A;  1PVA A;  4I5K A;  4A4B A;  4CFQ A;  3BUM B;  4YGD B;  1RRO A;  1SW8 A;  2V53 A;  1Y1A A;  2K7C A;  1NP8 A;  1KQM B;  2LMT A;  1K95 A;  4M2P A;  1S5G Z;  3K21 A;  2QPT A;  1DJY A;  1M46 A;  1AUI B;  1YX7 A;  1YX8 A;  3IQQ A;  5CPV A;  1B4C A;  1SCV A;  2JRF A;  1IJ5 A;  2F3Y A;  2BBM A;  1S1E A;  1S3P A;  4JQ0 D;  1YUR A;  4P5O E;  5BPJ A;  1C07 A;  1FF1 A;  1YUT A;  2ISD A;  2BBN A;  2K7O A;  1WDC C;  2B1U A;  2NCO A;  2R2I A;  4XYN A;  1XFZ O;  2BKI B;  5HLO A;  1PAL A;  2WOR A;  3SG2 A;  1SKT A;  1UHI A;  3CS1 A;  4GBA A;  4YBH B;  4PDZ A;  1M39 A;  3QRX A;  3SG3 A;  3SG6 A;  2JC2 A;  1OQP A;  1TN4 A;  3EVV A;  2GGM A;  2JXL A;  3AKB A;  5AEQ A;  3TUY C;  1IG5 A;  1GGZ A;  4WRI A;  2Y4Q A;  2O5G A;  2K7D A;  1NX0 A;  4M2Q A;  4MZJ A;  1E8A A;  2M1K B;  1CDN A;  1C7V A;  1C7W A;  1Y0V H;  1QV1 A;  5KTY A;  2MA2 A;  2ZN8 A;  1KK7 Z;  1S6C A;  1DJX A;  3SIB A;  4ETO A;  1AK8 A;  2LM5 A;  1K9U A;  1U5I B;  4ORC B;  2Q91 A;  3GK1 A;  4JWQ A;  5PAL A;  4L9M A;  1PRW A;  4GFT A;  4PHN A;  1XK4 C;  1NCZ A;  3AAK A;  1V1G A;  2KI4 C;  3D0Y B;  2PMY A;  5TNC A;  1BJF A;  1PUL A;  1ALV A;  3EK7 A;  1JF0 A;  2Y5I A;  1ZFS A;  1SCM B;  1JFK A;  1S6J A;  4ZCU A;  1M45 A;  3KF9 A;  1CFF A;  3O4Y A;  1YTZ C;  4MSP A;  2KAY A;  1AJ4 A;  1BU3 A;  3JVT B;  3VRO A;  1F54 A;  3LLE A;  1CB1 A;  1KCY A;  4OKH A;  2GGZ A;  2A4J A;  1IKU A;  3EKJ A;  3DF0 A;  1MR8 A;  3EK8 A;  2L4I A;  3CR5 X;  3WHU B;  4I5L B;  5F6T A;  1DJW A;  1LXF C;  5AER A;  1WRL A;  1TNP A;  1XFX O;  3F45 A;  3PN7 C;  4XJK A;  1CM1 A; 
#chains in the Genus database with same CATH topology
 3KPX A;  4GUK A;  1MHO A;  1OOJ A;  1J55 A;  2BNX A;  5DIC A;  1CTR A;  1PSB A;  2ERB A;  5KU1 A;  2FOT A;  5CSJ A;  3BUN B;  1H4B A;  2MJW B;  2JNF A;  1MF8 B;  3CLN A;  3HCM A;  1DF0 A;  1LVC D;  1FBV A;  2PRU A;  3C1V A;  2JNX A;  5FI6 A;  3SG4 A;  2L2C A;  2OTG B;  1MXL C;  2NLN A;  2LVJ A;  1KWO B;  1UHK A;  3OB2 B;  1AVS A;  4YI8 A;  1S5G Y;  3D75 A;  5HKZ A;  2BE6 A;  3RM1 A;  1AJ5 A;  2F8P A;  3NSI A;  3O2P A;  5DKN A;  2PAS A;  1EH2 A;  2BKH B;  2H2K A;  2O60 A;  1J7O A;  5IBW A;  3SG5 A;  5FI7 A;  1KSM A;  1NYA A;  1HQV A;  3S0G A;  4HRH A;  3I5I B;  5DKR A;  4MEW A;  1UHJ A;  2JWW A;  1QLK A;  1QJT A;  2ZND A;  4I5J A;  1YR5 A;  1XO5 A;  2OPO A;  5HKY A;  1LA0 A;  3PAT A;  1TWO A;  1KFX S;  1F4O A;  2BCX A;  3DVE A;  3VGO A;  2MHH A;  2Y1N A;  1EG4 A;  2EC6 C;  2E6W A;  2G2B A;  3BOW B;  3I5G B;  5I2Q A;  2L5X B;  5FYX A;  4MN0 A;  1Z4H A;  3R1V A;  3UNW A;  1FI5 A;  3VRP A;  4CFR A;  4OV2 A;  2JT0 A;  3OX6 A;  4GNK B;  4ORA B;  4INX A;  1TNX A;  2ZFD A;  1NCX A;  4NDB A;  2KAX A;  2KYC A;  3M0W A;  1KK7 Y;  2LVK A;  1EJ3 A;  3TDI A;  1YVH A;  1CKK A;  1DJG A;  4P2Y B;  1CDM A;  3KO0 A;  1CFC A;  3DVK A;  3ICB A;  1CFP A;  1TCO B;  2LVI A;  3OHM B;  2L0P A;  1GM0 A;  2BCB A;  5CSN A;  1AHR A;  1KK8 C;  3D78 A;  1NX2 A;  2KQY A;  5EL2 A;  1DGV A;  2MRD A;  4DS7 A;  1LA3 A;  1DMO A;  1W7I B;  2KQ6 A;  3EK4 A;  3S0B A;  1G8I A;  5JJG A;  3KHE A;  1UP5 A;  4PE4 A;  1CNP A;  2M8U A;  1A4P A;  3DXL A;  5D3O A;  3TUY B;  1A29 A;  1K94 A;  2M0R A;  3UO9 A;  1DJI A;  1QXP A;  3BJH A;  3FWC A;  1RFJ A;  4DIR A;  1YRU B;  3B87 A;  1CFD A;  2DOQ A;  2ZRS A;  4INW A;  4DRW A;  3BFA A;  2FCD A;  4N1F A;  2I7A A;  1QX7 A;  3CDN A;  2M49 B;  3SS5 A;  1J1D A;  1XFW O;  2YGU A;  1DT7 B;  1KFU L;  4IL1 A;  5DKQ A;  5I2O A;  1QIW A;  2LAP A;  1BOC A;  1NIW A;  4PT1 A;  1NSH A;  2I94 A;  4C0L A;  4CID A;  3CR4 X;  2JQ6 A;  1UWO A;  2LP3 A;  3JTD C;  4BY4 A;  2H61 C;  2KHN A;  1Y1X A;  2KI4 B;  3A4U B;  3VRQ A;  4FQT A;  1WRZ A;  1DJZ A;  3K1E A;  1NUB A;  5JOL A;  4ORB B;  4HSZ A;  3NSK A;  2WC5 A;  3I5F C;  1BF5 A;  3SS4 A;  2K61 A;  2QAC A;  1CLM A;  1BG1 A;  1M31 A;  4U8D A;  2BL0 C;  4GGF A;  1KSO A;  3BUW B;  1BOD A;  1QTX A;  1K90 D;  1F55 A;  2SCP A;  2AAO A;  2JOJ A;  3I5H C;  1LIN A;  3AAJ A;  1MQ1 A;  2KBM A;  2LHL A;  2M1U A;  1S36 A;  2QEB A;  2KI6 C;  4BY5 A;  1U5I A;  1XYD A;  1B47 A;  1KQM C;  1JSA A;  5ER4 X;  3PM2 A;  4OCI A;  1IQ3 A;  3D0Y A;  1DVI A;  4MZL A;  4PE1 A;  5I2L A;  3RZS A;  1F70 A;  1K2H A;  1W7J B;  1OMV A;  4D1E A;  1CDL A;  2M9G A;  3BUX B;  1CLL A;  3OBV A;  1DGU A;  1YUU A;  2RGI A;  3FE6 A;  3CZ2 A;  3PN7 B;  3FWB A;  3R1P A;  4F7F A;  1IWQ A;  1SNL A;  2JUL A;  1Q80 A;  2NXQ A;  2EGD A;  2I2R E;  1DTL A;  4MBE A;  4FQO A;  1SMG A;  1TCF A;  2F3Z A;  2L4H A;  2L50 A;  1SBJ A;  1MUX A;  1W9Z A;  2HQ8 A;  3DD4 A;  1RTP 1;  4DUQ A;  2KGR A;  4ICB A;  5K89 A;  1EXR A;  2LVV A;  3DYE A;  3WHT B;  3E3R A;  2BE4 A;  2JXC A;  4ZCV A;  1PK0 D;  1SR6 C;  1K8U A;  1GGW A;  2LLT A;  5G08 A;  3GK4 X;  1QX5 B;  1G33 A;  2P6B B;  1QV0 A;  1B8R A;  4GAO A;  2FJU B;  1A75 B;  2I18 A;  4CPV A;  1ODB A;  2KNE A;  1OZS A;  1JWD A;  1RWY A;  3LK0 A;  4MRX A;  2JTZ A;  2HQW A;  1IH0 A;  2BAP A;  1F71 A;  2MLE C;  3WXA A;  1QS7 A;  1TIZ A;  2EC6 B;  1B9A A;  2HF5 A;  2KOT A;  3PFV A;  1OOF A;  1OW4 A;  3EVR A;  1Z2C B;  4YGB B;  1UUS A;  3BUO B;  1NX3 A;  5AAN A;  3V2L A;  1YUS A;  4N5X A;  3JVT C;  1SPY A;  1XA5 A;  1DJH A;  1Y1U A;  2KGB C;  4OZD A;  1TOP A;  3OX5 A;  1L7Z A;  2IS9 A;  4MZK A;  1WLM A;  5B8I B;  1GJY A;  3IQO A;  2GTE A;  3EG5 B;  1OSA A;  3EKH A;  4HRE E;  3BQ3 A;  2CNP A;  2EHB A;  4PHJ A;  1KK8 B;  2HPS A;  2K0J A;  3BOW A;  2L5Y A;  2NZ0 A;  4JKT A;  2LUC A;  1B7T Z;  2L51 A;  2F2P A;  1IGV A;  5I94 A;  2OS8 C;  1AP4 A;  1WRK A;  3PAL A;  2KYF A;  2WCB A;  2WC8 A;  1QAS A;  1IQ5 A;  1Y6W A;  3NSO A;  5J3X A;  1QVI Z;  1S26 D;  1IJ6 A;  1WDC B;  2FCE A;  1G4Y R;  2LLU A;  3RLZ A;  1MWN A;  2D8N A;  1K9P A;  3LCP C;  1J7P A;  3N7H A;  4WQ2 A;  4AOM A;  1BT6 A;  1ORG A;  1KFX L;  1XFV O;  2JPT A;  3CZT X;  5CSI A;  1JUO A;  4A4C A;  1SK6 D;  1N2D A;  2JU0 A;  1NCY A;  4KYN A;  2AUC A;  1UHH A;  2M29 A;  2MBX A;  1B8C A;  1WY9 A;  1CMF A;  3O4X A;  1GQM A;  1UHN A;  4QJ3 B;  1TNQ A;  3NSL A;  5D7F A;  2JZI A;  4MLW A;  1J1E A;  3OP0 A;  3B86 A;  3DVM A;  3CWG A;  3A8R A;  4DCK A;  3FS7 A;  1F4Q A;  3D77 A;  3ZWH A;  5HYD A;  2BL0 B;  2LE9 B;  4C0K A;  2BCA A;  1NX1 A;  1ZAC A;  2ZRT A;  2E30 A;  2KAV A;  3I5H B;  5HL1 A;  3R72 A;  1HT9 A;  3L4A A;  2PAL A;  1EG3 A;  1NPQ A;  3GK2 A;  1X02 A;  2CXJ A;  5AXI A;  4C0J A;  1L2O C;  1XK4 A;  2LMU A;  2TN4 A;  3B88 A;  3EVU A;  1K9K A;  1A03 A;  2KI6 D;  3DZT A;  3NXA A;  2LLS A;  2LCP A;  3S0D A;  3SIA A;  4OR9 B;  3TS5 C;  3S0E A;  2KSP A;  4I5N B;  2LNK A;  1M63 B;  1K93 D;  3FE9 A;  2P70 A;  1ALW A;  1BR4 B;  4MRY A;  2LV7 A;  2MAZ A;  1OOG A;  3O6B A;  2VRG A;  2CT9 A;  3TDZ A;  3IF7 A;  2LP2 A;  1J7R A;  1FW4 A;  4OVN F;  4PHK A;  1QLS A;  1PVB A;  1QX2 A;  1WLZ A;  1K96 A;  1TTX A;  1OMD A;  3MSE B;  2WCF A;  2GV5 A;  1VRK A;  1MXE A;  1T14 A;  3DY9 A;  4AQJ A;  2ZKM X;  1SR6 B;  2JPO A;  2K2F A;  2Q4U A;  4WQ3 A;  2KLD A;  4F0Z B;  5AFP A;  3S0A A;  4QJ5 B;  3WNX B;  2H8V A;  1FI6 A;  2M7L A;  4USL A;  1R2U A;  1N0Y A;  1RK9 A;  2LMV A;  3H4S E;  2KFF A;  4YGA A;  1CM4 A;  2HET A;  1XFR A;  5HLV A;  2WOS A;  2Y1M A;  1SYM A;  2SAS A;  2M7N A;  3PLF B;  1B7T Y;  1BR1 B;  1SRA A;  2ZN9 A;  2K8M B;  2M97 A;  1OMR A;  3KEV A;  1B1G A;  4PE0 A;  1XFU O;  3CZ1 A;  1N65 A;  2P71 A;  2JTT A;  1NWD A;  2KDH A;  1SL9 A;  2LHI A;  2BEC A;  3D10 A;  4GGF C;  4PE7 A;  1YRT B;  1ZMZ A;  4NDC A;  1QIV A;  1S6I A;  1C3Z A;  3NHI A;  3O78 A;  1QVI Y;  2K2A A;  4GPL B;  1BLQ A;  3PM8 A;  2F33 A;  3LK1 A;  1TRF A;  3DF0 B;  4PCW A;  4YI9 A;  1OZO A;  3NGV A;  1A75 A;  4MVF A;  1CLB A;  3BFB A;  4HRG A;  4QJ4 B;  1BMO A;  3FIA A;  2PVB A;  4E68 A;  1OE9 B;  3VRR A;  4YGC B;  1V1F A;  1F8H A;  3DVJ A;  4XJK B;  5D69 A;  3CTN A;  2LUX A;  1SCM C;  1JF2 A;  4TNC A;  3R1O A;  1OOH A;  1LKJ A;  1XFY O;  3CYZ A;  1CMG A;  2WCM A;  1EL4 A;  4NQG A;  2KLE A;  2OS8 B;  5KSZ A;  1QWV A;  3BXK A;  1TUJ A;  1DF0 B;  2LAN A;  2JT8 A;  5ER5 A;  2WCL A;  1B8L A;  1P28 A;  3D74 A;  5HKW A;  1SL7 A;  3SG7 A;  4YRU A;  2WCE A;  2NCP A;  1RJV A;  4JPZ B;  3CZ0 A;  2KPH A;  1ZUZ A;  2L2E A;  2WCH A;  1H8B A;  1KQV A;  3CGA A;  2KBI A;  2PYQ A;  2FJY A;  2AMI A;  3PSR A;  4Q04 A;  1JC2 A;  2WND A;  3B7A A;  3LL8 B;  4R1E A;  1PSR A;  2KFG A;  1CDP A;  1SY9 A;  1JBA A;  5I8N A;  3SJS A;  1R6P A;  1XVJ A;  2L98 A;  2CBL A;  4CLN A;  3BYA A;  1A2X A;  1TUZ A;  2QDI A;  3TDU A;  1C3Y A;  4M2O A;  3ZNI A;  4JD9 A;  1TNW A;  2QEO A;  4UPG A;  2OTG C;  2MLF C;  5CSF A;  1QAT A;  1KWO C;  2PSR A;  3D76 A;  4GGN A;  2M3W A;  3OB1 B;  4FTG A;  4AQI A;  2COL B;  1LS8 A;  4YGE B;  4NDD A;  2K7B A;  3VB1 A;  3VRN A;  3JTD B;  2KFH A;  2CTN A;  2G9B A;  2LC5 A;  3BFH A;  2JT3 A;  5GQQ C;  3I5I C;  2H61 A;  3PJI A;  1L2O B;  3SS3 A;  1IRJ A;  4PAL A;  2ZNE A;  2CCM A;  1KFU S;  5FI2 A;  1UUR A;  1D1O A;  1J7Q A;  1FPW A;  2F2O A;  4N1G A;  4PHM A;  3I5F B;  3TZ1 A;  1ZOT B;  1REC A;  3TS5 B;  1JFJ A;  3GOF A;  3I5G C;  1SL8 A;  1YVL A;  3HX4 A;  3AKA A;  3CR2 A;  3L4L A;  1PVA A;  2WCK A;  2PQL A;  3Q8I A;  4I5K A;  4A4B A;  4CFQ A;  3BUM B;  4YGD B;  2QEV A;  1RRO A;  1SW8 A;  2V53 A;  1Y1A A;  2K7C A;  2QEH A;  1NP8 A;  3QME A;  1KQM B;  2LMT A;  1K95 A;  4M2P A;  1S5G Z;  1SSE B;  3K21 A;  2QPT A;  3D73 A;  1DC1 A;  1DJY A;  3NHT A;  1M46 A;  1AUI B;  1YX7 A;  1YX8 A;  3IQQ A;  5CPV A;  1B4C A;  1SCV A;  2JRF A;  2WC6 A;  1IJ5 A;  2F3Y A;  2BBM A;  1S1E A;  1S3P A;  3CAB A;  2WCJ A;  4JQ0 D;  1YUR A;  4P5O E;  5BPJ A;  1C07 A;  1FF1 A;  1YUT A;  2K60 A;  2ISD A;  2BBN A;  2K7O A;  1WDC C;  2B1U A;  2NCO A;  2R2I A;  4XYN A;  1XFZ O;  2BKI B;  5HLO A;  1PAL A;  2WOR A;  3SG2 A;  1DEK A;  1SKT A;  1UHI A;  3CS1 A;  4GBA A;  4YBH B;  4PDZ A;  1M39 A;  3QRX A;  3IVT A;  3FE8 A;  2JC2 A;  1OQP A;  1TN4 A;  3SG6 A;  3SG3 A;  3EVV A;  2GGM A;  2JXL A;  3AKB A;  5AEQ A;  3TUY C;  1IG5 A;  1GGZ A;  4WRI A;  1DEL A;  2Y4Q A;  2O5G A;  2K7D A;  3OGN A;  1NX0 A;  4M2Q A;  4MZJ A;  1E8A A;  1OOI X;  2M1K B;  1CDN A;  1C7V A;  1C7W A;  3B6X A;  1Y0V H;  1QV1 A;  5KTY A;  1DQE A;  2MA2 A;  2ZN8 A;  1KK7 Z;  1S6C A;  1DJX A;  3SIB A;  4ETO A;  1AK8 A;  2LM5 A;  1K9U A;  1U5I B;  4ORC B;  2Q91 A;  3GK1 A;  4JWQ A;  5PAL A;  3S0F A;  4L9M A;  1PRW A;  4GFT A;  4PHN A;  1XK4 C;  1NCZ A;  3AAK A;  1V1G A;  2KI4 C;  3D0Y B;  2PMY A;  5TNC A;  1BJF A;  1PUL A;  1ALV A;  3EK7 A;  1JF0 A;  2Y5I A;  1ZFS A;  1SCM B;  3L47 A;  1JFK A;  1S6J A;  4ZCU A;  1M45 A;  3KF9 A;  1CFF A;  3O4Y A;  1YTZ C;  4MSP A;  2KAY A;  1AJ4 A;  1BU3 A;  3JVT B;  3VRO A;  1F54 A;  3LLE A;  1CB1 A;  1KCY A;  4OKH A;  2GGZ A;  2A4J A;  1IKU A;  4IJ7 A;  3EKJ A;  3DF0 A;  1MR8 A;  3EK8 A;  2L4I A;  3CR5 X;  3WHU B;  4I5L B;  5F6T A;  1DJW A;  1LXF C;  5AER A;  1IIO A;  1WRL A;  1TNP A;  1XFX O;  3F45 A;  3PN7 C;  4XJK A;  1CM1 A; 
#chains in the Genus database with same CATH homology
 3KPX A;  4GUK A;  1MHO A;  1OOJ A;  1J55 A;  1CTR A;  1PSB A;  5KU1 A;  2FOT A;  5CSJ A;  3BUN B;  1H4B A;  2MJW B;  2JNF A;  1MF8 B;  3CLN A;  3HCM A;  1DF0 A;  1LVC D;  1FBV A;  2PRU A;  3C1V A;  2JNX A;  3SG4 A;  2OTG B;  1MXL C;  2NLN A;  2LVJ A;  1KWO B;  1UHK A;  3OB2 B;  1AVS A;  4YI8 A;  1S5G Y;  5HKZ A;  2BE6 A;  3RM1 A;  1AJ5 A;  2F8P A;  3NSI A;  3O2P A;  5DKN A;  2PAS A;  1EH2 A;  2BKH B;  2H2K A;  2O60 A;  1J7O A;  5IBW A;  3SG5 A;  1KSM A;  1NYA A;  1HQV A;  4HRH A;  3I5I B;  5DKR A;  4MEW A;  1UHJ A;  2JWW A;  1QLK A;  1QJT A;  2ZND A;  4I5J A;  1YR5 A;  1XO5 A;  2OPO A;  5HKY A;  1LA0 A;  3PAT A;  1KFX S;  2BCX A;  1F4O A;  3DVE A;  3VGO A;  2MHH A;  2Y1N A;  1EG4 A;  2EC6 C;  2E6W A;  2G2B A;  3BOW B;  3I5G B;  5I2Q A;  2L5X B;  5FYX A;  4MN0 A;  1FI5 A;  3VRP A;  4CFR A;  4OV2 A;  2JT0 A;  3OX6 A;  4GNK B;  4ORA B;  1TNX A;  2ZFD A;  1NCX A;  4NDB A;  2KAX A;  2KYC A;  3M0W A;  1KK7 Y;  2LVK A;  1EJ3 A;  3TDI A;  1YVH A;  1CKK A;  1DJG A;  4P2Y B;  1CDM A;  3KO0 A;  1CFC A;  3DVK A;  3ICB A;  1CFP A;  1TCO B;  2LVI A;  3OHM B;  2L0P A;  2BCB A;  5CSN A;  1AHR A;  1KK8 C;  1NX2 A;  2KQY A;  1DGV A;  2MRD A;  4DS7 A;  1LA3 A;  1DMO A;  1W7I B;  2KQ6 A;  3EK4 A;  1G8I A;  5JJG A;  3KHE A;  1UP5 A;  4PE4 A;  1CNP A;  2M8U A;  1A4P A;  3TUY B;  1A29 A;  1K94 A;  2M0R A;  1DJI A;  1QXP A;  3FWC A;  1RFJ A;  4DIR A;  1YRU B;  1CFD A;  2DOQ A;  2ZRS A;  4DRW A;  2FCD A;  4N1F A;  2I7A A;  1QX7 A;  2M49 B;  1J1D A;  1XFW O;  1DT7 B;  1KFU L;  4IL1 A;  5DKQ A;  5I2O A;  1QIW A;  2LAP A;  1BOC A;  1NIW A;  1NSH A;  2I94 A;  4C0L A;  4CID A;  3CR4 X;  2JQ6 A;  1UWO A;  2LP3 A;  3JTD C;  4BY4 A;  2H61 C;  2KHN A;  1Y1X A;  2KI4 B;  3A4U B;  3VRQ A;  1WRZ A;  1DJZ A;  1NUB A;  5JOL A;  4ORB B;  4HSZ A;  3NSK A;  3I5F C;  1BF5 A;  2K61 A;  2QAC A;  1CLM A;  1BG1 A;  1M31 A;  4U8D A;  2BL0 C;  4GGF A;  1KSO A;  3BUW B;  1BOD A;  1QTX A;  1K90 D;  1F55 A;  2SCP A;  2AAO A;  2JOJ A;  3I5H C;  1LIN A;  3AAJ A;  1MQ1 A;  2KBM A;  2LHL A;  2M1U A;  1S36 A;  4BY5 A;  2KI6 C;  1U5I A;  1XYD A;  1B47 A;  1KQM C;  1JSA A;  5ER4 X;  1IQ3 A;  4OCI A;  3D0Y A;  1DVI A;  4MZL A;  4PE1 A;  5I2L A;  1F70 A;  1K2H A;  1W7J B;  1OMV A;  4D1E A;  1CDL A;  2M9G A;  3BUX B;  1CLL A;  3PN7 B;  1DGU A;  1YUU A;  2RGI A;  3FWB A;  1IWQ A;  1SNL A;  2JUL A;  1Q80 A;  2NXQ A;  2EGD A;  2I2R E;  1DTL A;  4MBE A;  4FQO A;  1SMG A;  1TCF A;  2F3Z A;  2L4H A;  2L50 A;  1SBJ A;  1MUX A;  2HQ8 A;  3DD4 A;  1RTP 1;  4DUQ A;  2KGR A;  4ICB A;  5K89 A;  1EXR A;  2LVV A;  3WHT B;  3E3R A;  2BE4 A;  2JXC A;  4ZCV A;  1PK0 D;  1SR6 C;  1K8U A;  1GGW A;  2LLT A;  5G08 A;  3GK4 X;  1QX5 B;  1G33 A;  2P6B B;  1QV0 A;  1B8R A;  4GAO A;  2FJU B;  1A75 B;  2I18 A;  4CPV A;  1ODB A;  2KNE A;  1OZS A;  1JWD A;  1RWY A;  3LK0 A;  4MRX A;  2JTZ A;  2HQW A;  1IH0 A;  1F71 A;  2MLE C;  3WXA A;  1QS7 A;  1TIZ A;  2EC6 B;  1B9A A;  2HF5 A;  2KOT A;  3PFV A;  3EVR A;  4YGB B;  1UUS A;  3BUO B;  1NX3 A;  5AAN A;  1YUS A;  4N5X A;  3JVT C;  1SPY A;  1XA5 A;  1DJH A;  1Y1U A;  2KGB C;  1TOP A;  3OX5 A;  1L7Z A;  2IS9 A;  4MZK A;  1WLM A;  5B8I B;  1GJY A;  3IQO A;  1OSA A;  3EKH A;  4HRE E;  3BQ3 A;  2CNP A;  2EHB A;  4PHJ A;  1KK8 B;  2HPS A;  2K0J A;  3BOW A;  2NZ0 A;  2LUC A;  1B7T Z;  2L51 A;  2F2P A;  1IGV A;  2OS8 C;  1AP4 A;  1WRK A;  3PAL A;  2KYF A;  2WCB A;  2WC8 A;  1QAS A;  1IQ5 A;  1Y6W A;  3NSO A;  5J3X A;  1QVI Z;  1S26 D;  1IJ6 A;  1WDC B;  2FCE A;  1G4Y R;  2LLU A;  3RLZ A;  1MWN A;  2D8N A;  1K9P A;  3LCP C;  1J7P A;  4WQ2 A;  4AOM A;  1BT6 A;  1KFX L;  1XFV O;  2JPT A;  3CZT X;  5CSI A;  1JUO A;  4A4C A;  1SK6 D;  1N2D A;  2JU0 A;  1NCY A;  2MBX A;  2AUC A;  1UHH A;  2M29 A;  1CMF A;  1B8C A;  1WY9 A;  1GQM A;  1UHN A;  4QJ3 B;  1TNQ A;  3NSL A;  5D7F A;  2JZI A;  4MLW A;  1J1E A;  3OP0 A;  3DVM A;  3CWG A;  3A8R A;  4DCK A;  3FS7 A;  1F4Q A;  3ZWH A;  5HYD A;  2BL0 B;  2LE9 B;  4C0K A;  2BCA A;  1NX1 A;  1ZAC A;  2ZRT A;  2E30 A;  2KAV A;  3I5H B;  1HT9 A;  2PAL A;  1EG3 A;  1NPQ A;  3GK2 A;  1X02 A;  2CXJ A;  5AXI A;  4C0J A;  1L2O C;  1XK4 A;  2LMU A;  2TN4 A;  3EVU A;  1K9K A;  1A03 A;  2KI6 D;  3NXA A;  2LLS A;  2LCP A;  3SIA A;  4OR9 B;  3TS5 C;  2KSP A;  4I5N B;  2LNK A;  1M63 B;  1K93 D;  1ALW A;  1BR4 B;  4MRY A;  2LV7 A;  2MAZ A;  3O6B A;  2VRG A;  2CT9 A;  3TDZ A;  3IF7 A;  2LP2 A;  1J7R A;  1FW4 A;  4OVN F;  4PHK A;  1QLS A;  1PVB A;  1QX2 A;  1WLZ A;  1K96 A;  1TTX A;  1OMD A;  3MSE B;  2WCF A;  2GV5 A;  1VRK A;  1MXE A;  4AQJ A;  2ZKM X;  1SR6 B;  5AFP A;  2K2F A;  2Q4U A;  4WQ3 A;  4F0Z B;  1FI6 A;  4QJ5 B;  3WNX B;  2M7L A;  4USL A;  1R2U A;  1N0Y A;  1RK9 A;  2LMV A;  3H4S E;  2KFF A;  4YGA A;  1CM4 A;  2HET A;  5HLV A;  2WOS A;  2Y1M A;  1SYM A;  2SAS A;  2M7N A;  3PLF B;  1B7T Y;  1BR1 B;  1SRA A;  2ZN9 A;  2K8M B;  2M97 A;  1OMR A;  3KEV A;  1B1G A;  4PE0 A;  1XFU O;  1N65 A;  2JTT A;  1NWD A;  2KDH A;  1SL9 A;  2LHI A;  2BEC A;  3D10 A;  4GGF C;  4PE7 A;  1YRT B;  1ZMZ A;  4NDC A;  1QIV A;  1S6I A;  3O78 A;  1QVI Y;  2K2A A;  4GPL B;  1BLQ A;  3PM8 A;  2F33 A;  3LK1 A;  1TRF A;  3DF0 B;  4PCW A;  4YI9 A;  1OZO A;  4MVF A;  1A75 A;  1CLB A;  4HRG A;  4QJ4 B;  1BMO A;  3FIA A;  2PVB A;  4E68 A;  1OE9 B;  3VRR A;  4YGC B;  1V1F A;  1F8H A;  3DVJ A;  4XJK B;  5D69 A;  3CTN A;  2LUX A;  1SCM C;  1JF2 A;  4TNC A;  1LKJ A;  1XFY O;  1CMG A;  1EL4 A;  4NQG A;  2OS8 B;  5KSZ A;  3BXK A;  1DF0 B;  2LAN A;  2JT8 A;  5ER5 A;  1B8L A;  5HKW A;  1SL7 A;  3SG7 A;  4YRU A;  2WCE A;  2NCP A;  1RJV A;  4JPZ B;  1ZUZ A;  2L2E A;  1H8B A;  1KQV A;  3CGA A;  2KBI A;  2AMI A;  3PSR A;  4Q04 A;  1JC2 A;  2WND A;  3LL8 B;  4R1E A;  1PSR A;  2KFG A;  1CDP A;  1SY9 A;  1JBA A;  5I8N A;  3SJS A;  1R6P A;  1XVJ A;  2L98 A;  2CBL A;  4CLN A;  3BYA A;  1A2X A;  3TDU A;  4M2O A;  3ZNI A;  1TNW A;  4UPG A;  2OTG C;  2MLF C;  5CSF A;  1QAT A;  1KWO C;  2PSR A;  4GGN A;  2M3W A;  3OB1 B;  4FTG A;  4AQI A;  2COL B;  4YGE B;  4NDD A;  2K7B A;  3VRN A;  3JTD B;  2KFH A;  2CTN A;  2G9B A;  2LC5 A;  2JT3 A;  5GQQ C;  3I5I C;  2H61 A;  1L2O B;  1IRJ A;  4PAL A;  2ZNE A;  2CCM A;  1KFU S;  1D1O A;  1UUR A;  1J7Q A;  1FPW A;  2F2O A;  4N1G A;  4PHM A;  3I5F B;  3TZ1 A;  1ZOT B;  1REC A;  3TS5 B;  1JFJ A;  3GOF A;  3I5G C;  1SL8 A;  1YVL A;  3HX4 A;  3AKA A;  3CR2 A;  1PVA A;  4I5K A;  4A4B A;  4CFQ A;  3BUM B;  4YGD B;  1RRO A;  1SW8 A;  2V53 A;  1Y1A A;  2K7C A;  1NP8 A;  1KQM B;  2LMT A;  1K95 A;  4M2P A;  1S5G Z;  3K21 A;  2QPT A;  1DJY A;  1M46 A;  1AUI B;  1YX7 A;  1YX8 A;  3IQQ A;  5CPV A;  1B4C A;  1SCV A;  2JRF A;  1IJ5 A;  2F3Y A;  2BBM A;  1S1E A;  1S3P A;  4JQ0 D;  1YUR A;  4P5O E;  5BPJ A;  1C07 A;  1FF1 A;  1YUT A;  2ISD A;  2BBN A;  2K7O A;  1WDC C;  2B1U A;  2NCO A;  2R2I A;  4XYN A;  1XFZ O;  2BKI B;  5HLO A;  1PAL A;  2WOR A;  3SG2 A;  1SKT A;  1UHI A;  3CS1 A;  4GBA A;  4YBH B;  4PDZ A;  1M39 A;  3QRX A;  3SG3 A;  3SG6 A;  2JC2 A;  1OQP A;  1TN4 A;  3EVV A;  2GGM A;  2JXL A;  3AKB A;  5AEQ A;  3TUY C;  1IG5 A;  1GGZ A;  4WRI A;  2Y4Q A;  2O5G A;  2K7D A;  1NX0 A;  4M2Q A;  4MZJ A;  1E8A A;  2M1K B;  1CDN A;  1C7V A;  1C7W A;  1Y0V H;  1QV1 A;  5KTY A;  2MA2 A;  2ZN8 A;  1KK7 Z;  1S6C A;  1DJX A;  3SIB A;  4ETO A;  1AK8 A;  2LM5 A;  1K9U A;  1U5I B;  4ORC B;  2Q91 A;  3GK1 A;  4JWQ A;  5PAL A;  4L9M A;  1PRW A;  4GFT A;  4PHN A;  1XK4 C;  1NCZ A;  3AAK A;  1V1G A;  2KI4 C;  3D0Y B;  2PMY A;  5TNC A;  1BJF A;  1PUL A;  1ALV A;  3EK7 A;  1JF0 A;  2Y5I A;  1ZFS A;  1SCM B;  1JFK A;  1S6J A;  4ZCU A;  1M45 A;  3KF9 A;  1CFF A;  3O4Y A;  1YTZ C;  4MSP A;  2KAY A;  1AJ4 A;  1BU3 A;  3JVT B;  3VRO A;  1F54 A;  3LLE A;  1CB1 A;  1KCY A;  4OKH A;  2GGZ A;  2A4J A;  1IKU A;  3EKJ A;  3DF0 A;  1MR8 A;  3EK8 A;  2L4I A;  3CR5 X;  3WHU B;  4I5L B;  5F6T A;  1DJW A;  1LXF C;  5AER A;  1WRL A;  1TNP A;  1XFX O;  3F45 A;  3PN7 C;  4XJK A;  1CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...