1GM0A

A form of the pheromone-binding protein from bombyx mori
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEGNLHHGNAMEFAKKHGADETMAQQLIDIVHGCEKSTPANDDKCIWTLGVATCFKAEIHKLNWAPSMDVAVGEILAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PHEROMONE-BINDING PROTEIN
publication title NMR Structure Reveals Novel Intramolecular Regulation Mechanism for Pheromone-Binding and Release
pubmed doi rcsb
source organism Bombyx mori
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2001-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01395 PBP_GOBP PBP/GOBP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 1gm0A00
3CDNA 3Q8IA 3BJHA 3D75A 3FE8A 3R1OA 1C3ZA 2QEHA 1OOGA 1T14A 1OOFA 2H8VA 4INXA 1XFRA 3S0GA 4OZDA 1P28A 3QMEA 1GM0A 2QDIA 3S0DA 2P71A 3B88A 3NGVA 3D77A 3D78A 2QEBA 2WC6A 1TUJA 3CZ0A 3OGNA 3L4LA 4JD9A 2WCMA 3D76A 3VB1A 3FE6A 1QWVA 1C3YA 4INWA 3BFHA 3K1EA 2JPOA 3B7AA 3L47A 3CABA 3DY9A 2KPHA 3S0BA 3S0FA 2P70A 3V2LA 5EL2A 3RZSA 3R1VA 3D74A 3PJIA 3D73A 3NHIA 1DQEA 1ORGA 3B86A 3R1PA 3DXLA 2FJYA 2QEOA 1TWOA 2GTEA 1OW4A 1LS8A 2QEVA 2WCLA 3NHTA 3B87A 3R72A 2PQLA 4FQTA 1OOIX 2ERBA 2WC5A 3S0AA 2WCJA 2WCKA 3BFAA 1OOHA 3BFBA 3CZ1A 3L4AA 4PT1A 2WCHA 5DICA 4F7FA 3CYZA 3DYEA 3FE9A 2L2CA 3S0EA 3CZ2A 3N7HA 3DZTA 3B6XA
chains in the Genus database with same CATH superfamily
1K8UA 3D0YA 3VRQA 1A75B 4GGNA 5KTYA 2QPTA 2BECA 4P2YB 1J7PA 2M8UA 3CDNA 3OB1B 3EK8A 3IQOA 2I7AA 1K9PA 2LV7A 1Y1XA 4DUQA 3R1OA 1C3ZA 1JUOA 2BCXA 1S26D 1OOGA 1T14A 3HX4A 5F6TA 4CIDA 2KOTA 1SMGA 4GBAA 4OR9B 2ZNDA 4HSZA 1K90D 1KFXS 1Y0VH 3SIBA 2WCEA 1DMOA 2WCBA 1B9AA 1UWOA 1MR8A 2Q4UA 5J3XA 3S0GA 1Y6WA 1Q80A 2Y1MA 3PFVA 4JWQA 2ZN8A 3AAKA 3OBVA 1BF5A 4FTGA 1K93D 2M97A 2R2IA 3H4SE 3WHUB 1M46A 2JULA 2YGUA 3BYAA 1TCOB 5JOLA 1YURA 1F71A 1OZSA 2KI4B 1CFPA 4YGDB 2LE9B 1SW8A 2LHIA 4DRWA 2JXCA 4MEWA 2B1UA 3D77A 2Y1NA 3NXAA 3O2PA 2EC6C 4A4BA 1PK0D 4MSPA 3VRPA 1SR6B 4TNCA 2LMTA 3OGNA 1RJVA 3KPXA 3CTNA 2HQWA 2WCMA 2OTGB 1J55A 3JVTC 2KQ6A 1KK7Z 5AERA 3VB1A 1KK8C 1QWVA 1XYDA 2HF5A 1KSMA 5FI7A 1EG3A 3WXAA 2KYCA 1NX1A 2KFGA 2ZKMX 2ZRSA 1WLMA 5I2QA 4CPVA 5HKWA 3CABA 2F33A 1AHRA 2P70A 1NX3A 5EL2A 1YRTB 3PLFB 1D1OA 3R1VA 1ODBA 4M2QA 1XK4C 3NHIA 1DQEA 1KK7Y 4MRXA 1YVLA 4PHKA 3F45A 1Y1AA 3DXLA 3CS1A 2CT9A 1RWYA 4ETOA 1TWOA 4M2OA 1K9KA 1XFVO 4YGCB 3TUYB 3UO9A 1OW4A 4C0JA 2G9BA 1CFCA 1CDLA 3KF9A 3PM8A 1G4YR 1IQ5A 2RGIA 3LL8B 2TN4A 3B87A 3R72A 5DKRA 4QJ4B 1DJZA 5I94A 2PQLA 3TS5B 3PALA 3GK1A 1BT6A 4JQ0D 4PE0A 1AVSA 2JQ6A 4PE7A 3CR4X 1NIWA 5KU1A 3AAJA 2ERBA 3WNXB 2K7DA 1MF8B 3SG7A 1IH0A 1WDCC 2JNFA 1TNQA 2LVKA 1MUXA 2WC5A 3LK1A 3VRNA 3BUMB 2WCKA 1ALWA 5FYXA 5I8NA 3I5IC 2L5YA 3CZ1A 3L4AA 1K96A 1RFJA 1OMRA 2LVVA 1SRAA 3KEVA 1KFUL 2NCPA 2BL0B 1IG5A 4HREE 1A29A 4MZJA 1SL7A 1UHHA 3CYZA 4YBHB 3DVEA 1EJ3A 1YUUA 2CBLA 4AQJA 5HL1A 2MA2A 3CZ2A 1QX5B 1X02A 4IJ7A 3N7HA 1DC1A 3DZTA 1BJFA 3SG5A 3OB2B 3NSIA 3NSOA 1QLKA 2LMVA 4ORBB 3I5HC 2K7BA 1JFJA 1L7ZA 2NCOA 2LAPA 4CFQA 1FI5A 1L2OB 1IRJA 3PN7B 3D75A 5AXIA 1B1GA 3SG3A 1Z4HA 1J7OA 1QX2A 3I5FC 2CXJA 1UURA 1DJWA 4DS7A 2PMYA 3QRXA 1G33A 1JBAA 3VROA 3GK2A 1XFWO 1OOJA 1C7VA 5DKNA 1MXEA 1XK4A 1DJHA 1YX8A 1XFRA 2PYQA 1ZUZA 1CDPA 2K2AA 4OZDA 1BR4B 2JRFA 4YI8A 2L4HA 1SNLA 1UP5A 3O78A 2KFHA 2Q91A 3I5GC 4MZLA 2CCMA 1SYMA 2PALA 1WLZA 1NPQA 2ZN9A 1N2DA 2F2OA 2ZFDA 4I5JA 1OE9B 1UHNA 3EK4A 2M1KB 2LNKA 2JT0A 1YUTA 3BXKA 2M7LA 2O60A 3D0YB 3HCMA 2KI6C 2K7OA 5FI6A 4MVFA 3KHEA 1DJIA 1KQMB 1YTZC 2WC6A 2D8NA 1M31A 2G2BA 2KSPA 4P5OE 1B8LA 3FWCA 2WOSA 1B4CA 2JTZA 1QV0A 1J1DA 1RK9A 1RROA 1F8HA 4ORAB 4WQ2A 1BLQA 4MZKA 1LXFC 1CDMA 1WDCB 2I18A 5IBWA 1W7IB 2LHLA 3A4UB 1YUSA 1H4BA 4N1GA 1IJ5A 2H61C 3BUNB 1PSBA 1TNPA 5FI2A 1SKTA 3DVJA 1K95A 2EGDA 1DGUA 3K1EA 3VRRA 3B7AA 2H2KA 3E3RA 1NSHA 1SCVA 2BKHB 2L0PA 1W7JB 1KWOB 1KFUS 1QVIZ 1TRFA 2KPHA 2WORA 3S0BA 1MQ1A 3S0FA 4D1EA 1SCMB 3ZNIA 3MSEB 4I5LB 4YI9A 1DJXA 1E8AA 3D73A 2KFFA 3PJIA 3TDUA 4C0LA 1F4OA 3R1PA 4A4CA 1DELA 4YRUA 2PVBA 4MN0A 1FI6A 2ZNEA 1CKKA 2CNPA 2QEVA 1BG1A 3CLNA 3AKAA 3OHMB 5CSFA 3DVKA 2FCDA 2BE6A 1YVHA 2GGZA 1EL4A 4FQTA 2ZRTA 5G08A 4BY4A 2FJUB 5K89A 1PVAA 2BBMA 1FBVA 2JT8A 1CLLA 2OS8C 1S36A 2KGBC 3SG2A 2L5XB 3BFAA 1F54A 5CSIA 1CM4A 2BNXA 3EKJA 1F70A 1BODA 3IQQA 1NX0A 3CR5X 1V1FA 2WC8A 2JU0A 5DICA 3SG6A 1CM1A 1TOPA 1XFXO 3CZTX 1DT7B 1ZMZA 5CSNA 5AEQA 3DVMA 3GOFA 4Q04A 3FS7A 1TNXA 3SS4A 1DVIA 2LCPA 3S0EA 5HKZA 2A4JA 4HRGA 5CPVA 1GM0A 1C07A 3LLEA 4JKTA 4DCKA 1IKUA 1B7TZ 3C1VA 4MLWA 1UHJA 1AP4A 3SJSA 3IVTA 2H61A 2BE4A 3Q8IA 3BJHA 4CFRA 1FW4A 1XVJA 2QEHA 3SG4A 1HT9A 5HLVA 1WRKA 1CTRA 1F55A 2LLSA 1JWDA 2M3WA 2F3ZA 1S6JA 2BCAA 4JPZB 1A2XA 1U5IA 4PDZA 1B8RA 1B7TY 2KBIA 3LCPC 1OQPA 1N0YA 3EVVA 3FWBA 1BOCA 5TNCA 1U5IB 4XJKA 5ER4X 4ZCVA 2LVJA 2EC6B 2KGRA 2JT3A 4GNKB 1OZOA 1QTXA 3IF7A 1IJ6A 4XJKB 4DIRA 4YGAA 2KHNA 3B88A 3JTDC 4ICBA 1DJGA 5DKQA 1MXLC 2JC2A 2JNXA 3JVTB 3RLZA 5I2LA 4L9MA 2WNDA 1MWNA 1KK8B 1WY9A 1DTLA 1AK8A 2LLTA 1TUJA 1YX7A 2F3YA 3CZ0A 3L4LA 2KI4C 2E30A 2P6BB 1QASA 1N65A 2VRGA 5KSZA 2M0RA 3K21A 2F8PA 4PE4A 3FE6A 4WRIA 1C3YA 1CMFA 4INWA 1S5GZ 1TNWA 1TCFA 4OV2A 5AANA 5HLOA 1JFKA 1BU3A 2L4IA 3KO0A 2L2EA 3EG5B 4M2PA 2JPOA 2K8MB 1CMGA 1EG4A 1SBJA 3VGOA 2MAZA 3DY9A 1NUBA 3PATA 1SSEB 2F2PA 3V2LA 2LP2A 2LANA 1YR5A 2HQ8A 1ZOTB 2SASA 1IGVA 2MRDA 1EXRA 4OVNF 4R1EA 3BOWA 2KBMA 4PHMA 3DF0A 3PSRA 2I2RE 3BOWB 1LA0A 2FJYA 4OCIA 1M63B 2JWWA 2GTEA 2KDHA 3DF0B 1NP8A 1WRZA 2NLNA 1RTP1 1LS8A 4MBEA 1PSRA 4ORCB 2QACA 2O5GA 2V53A 1J7QA 1FF1A 1NCYA 3I5IB 1H8BA 1IQ3A 1CNPA 1QLSA 4YGEB 1OOIX 2K7CA 4PALA 1GJYA 1PVBA 1QXPA 3TUYC 2JTTA 1CDNA 2BBNA 4E68A 2LM5A 2Y4QA 4USLA 2GGMA 1DF0A 2KLDA 1CFDA 2L98A 2WCJA 3S0AA 3SS3A 1Z2CB 3BFBA 5D7FA 3TS5C 3EKHA 1DF0B 1NX2A 2L51A 1QJTA 4PT1A 1UUSA 2WCHA 1M45A 1JC2A 1DGVA 1NWDA 4F7FA 3I5HB 2WCFA 1S6CA 3JTDB 2LMUA 1GGWA 1LKJA 2HETA 1QATA 2I94A 2M49B 3DYEA 3UNWA 1WRLA 2K2FA 3FE9A 2L2CA 1YRUB 3GK4X 4GAOA 1QVIY 2K0JA 4PHJA 1XFZO 2Y5IA 1XO5A 3I5FB 1QV1A 2BAPA 1R6PA 1IWQA 4F0ZB 2BL0C 1ALVA 3O6BA 4QJ5B 2KAVA 3O4YA 1QIWA 4IL1A 3FE8A 2JXLA 1UHIA 1UHKA 2MLEC 5BPJA 4I5NB 4GGFC 1OOFA 2H8VA 3EK7A 3I5GB 4INXA 1DEKA 1J7RA 5D69A 1KCYA 1NYAA 1TIZA 4PE1A 1J1EA 1CLBA 3D10A 4C0KA 1AUIB 1L2OC 5ER5A 2NXQA 3PN7C 3BQ3A 1P28A 4FQOA 1SK6D 3OX6A 1OMDA 4UPGA 2M9GA 2KYFA 2NZ0A 4NDCA 1DJYA 4AOMA 3QMEA 4N5XA 3ZWHA 2AAOA 2QDIA 3S0DA 1M39A 1K2HA 2K61A 2P71A 3BUOB 4GUKA 1BMOA 1C7WA 1PALA 1SPYA 2PRUA 5HKYA 3NGVA 3LK0A 4YGBB 1TUZA 2IS9A 3OP0A 1SL9A 2OPOA 4PHNA 2MLFC 1QIVA 4N1FA 3D78A 3A8RA 5GQQC 2QEBA 4U8DA 3SIAA 1FPWA 3EVRA 1A4PA 3AKBA 1R2UA 3BUWB 4GFTA 4OKHA 4JD9A 1BR1B 2SCPA 5HYDA 1K9UA 2JPTA 2CTNA 3PM2A 3D76A 4NDDA 4QJ3B 1HQVA 1A03A 1LVCD 1GQMA 2LLUA 3TDIA 1KQMC 1KSOA 2PASA 3BFHA 5D3OA 1KFXL 1NCZA 1RECA 4KYNA 1W9ZA 3L47A 3DD4A 4HRHA 5I2OA 4GPLB 4WQ3A 2MBXA 2E6WA 2FCEA 2BCBA 1VRKA 4CLNA 3RZSA 4ZCUA 3D74A 1EH2A 1NCXA 5PALA 1B8CA 1G8IA 1ORGA 2BKIB 2LUXA 2LUCA 3B86A 1V1GA 3NSKA 1AJ5A 3SS5A 3TZ1A 2KQYA 1CB1A 1JF2A 1S3PA 2QEOA 2AUCA 2KI6D 1KWOC 1S1EA 1ZFSA 2KAYA 3RM1A 4MRYA 2M29A 4AQIA 3WHTB 1AJ4A 2LVIA 1SCMC 2M7NA 1Y1UA 5AFPA 1ZACA 4NDBA 1IIOA 2WCLA 1K94A 4GGFA 3CWGA 2K60A 2OS8B 3NHTA 4PCWA 1SY9A 1LA3A 3BUXB 2KLEA 2LC5A 1SR6C 4NQGA 1JSAA 2JOJA 2PSRA 1JF0A 1B47A 3O4XA 1XFYO 2OTGC 2MJWB 3NSLA 3M0WA 5CSJA 3ICBA 5JJGA 4I5KA 1OMVA 1PULA 1GGZA 1OOHA 2KAXA 2HPSA 2FOTA 1LINA 1TTXA 1PRWA 2AMIA 3TDZA 1F4QA 1CLMA 1S5GY 1S6IA 2JZIA 2L50A 5B8IB 1CFFA 1OSAA 2EHBA 2M1UA 2MHHA 2COLB 4XYNA 2ISDA 1XA5A 3FIAA 1QS7A 2DOQA 1TN4A 1KQVA 3CR2A 2KNEA 2LP3A 4BY5A 3CGAA 1XFUO 1SL8A 3OX5A 1A75A 1MHOA 3B6XA 3EVUA 2GV5A 1QX7A
chains in the Genus database with same CATH topology
3CDNA 3Q8IA 3BJHA 3D75A 3FE8A 3R1OA 1C3ZA 2QEHA 1OOGA 1T14A 1OOFA 2H8VA 4INXA 1XFRA 3S0GA 4OZDA 1P28A 3QMEA 1GM0A 2QDIA 3S0DA 2P71A 3B88A 3NGVA 3D77A 3D78A 2QEBA 2WC6A 1TUJA 3CZ0A 3OGNA 3L4LA 4JD9A 2WCMA 3D76A 3VB1A 3FE6A 1QWVA 1C3YA 4INWA 3BFHA 3K1EA 2JPOA 3B7AA 3L47A 3CABA 3DY9A 2KPHA 3S0BA 3S0FA 2P70A 3V2LA 5EL2A 3RZSA 3R1VA 3D74A 3PJIA 3D73A 3NHIA 1DQEA 1ORGA 3B86A 3R1PA 3DXLA 2FJYA 2QEOA 1TWOA 2GTEA 1OW4A 1LS8A 2QEVA 2WCLA 3NHTA 3B87A 3R72A 2PQLA 4FQTA 1OOIX 2ERBA 2WC5A 3S0AA 2WCJA 2WCKA 3BFAA 1OOHA 3BFBA 3CZ1A 3L4AA 4PT1A 2WCHA 5DICA 4F7FA 3CYZA 3DYEA 3FE9A 2L2CA 3S0EA 3CZ2A 3N7HA 3DZTA 3B6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDN A;  3Q8I A;  3BJH A;  3D75 A;  3FE8 A;  3R1O A;  1C3Z A;  2QEH A;  1OOG A;  1T14 A;  1OOF A;  2H8V A;  4INX A;  1XFR A;  3S0G A;  4OZD A;  1P28 A;  3QME A;  1GM0 A;  2QDI A;  3S0D A;  2P71 A;  3B88 A;  3NGV A;  3D77 A;  3D78 A;  2QEB A;  2WC6 A;  1TUJ A;  3CZ0 A;  3OGN A;  3L4L A;  4JD9 A;  2WCM A;  3D76 A;  3VB1 A;  3FE6 A;  1QWV A;  1C3Y A;  4INW A;  3BFH A;  3K1E A;  2JPO A;  3B7A A;  3L47 A;  3CAB A;  3DY9 A;  2KPH A;  3S0B A;  3S0F A;  2P70 A;  3V2L A;  5EL2 A;  3RZS A;  3R1V A;  3D74 A;  3PJI A;  3D73 A;  3NHI A;  1DQE A;  1ORG A;  3B86 A;  3R1P A;  3DXL A;  2FJY A;  2QEO A;  1TWO A;  2GTE A;  1OW4 A;  1LS8 A;  2QEV A;  2WCL A;  3NHT A;  3B87 A;  3R72 A;  2PQL A;  4FQT A;  1OOI X;  2ERB A;  2WC5 A;  3S0A A;  2WCJ A;  2WCK A;  3BFA A;  1OOH A;  3BFB A;  3CZ1 A;  3L4A A;  4PT1 A;  2WCH A;  5DIC A;  4F7F A;  3CYZ A;  3DYE A;  3FE9 A;  2L2C A;  3S0E A;  3CZ2 A;  3N7H A;  3DZT A;  3B6X A; 
#chains in the Genus database with same CATH topology
 1K8U A;  3D0Y A;  3VRQ A;  1A75 B;  4GGN A;  5KTY A;  2QPT A;  2BEC A;  4P2Y B;  1J7P A;  2M8U A;  3CDN A;  3OB1 B;  3EK8 A;  3IQO A;  2I7A A;  1K9P A;  2LV7 A;  1Y1X A;  4DUQ A;  3R1O A;  1C3Z A;  1JUO A;  2BCX A;  1S26 D;  1OOG A;  1T14 A;  3HX4 A;  5F6T A;  4CID A;  2KOT A;  1SMG A;  4GBA A;  4OR9 B;  2ZND A;  4HSZ A;  1K90 D;  1KFX S;  1Y0V H;  3SIB A;  2WCE A;  1DMO A;  2WCB A;  1B9A A;  1UWO A;  1MR8 A;  2Q4U A;  5J3X A;  3S0G A;  1Y6W A;  1Q80 A;  2Y1M A;  3PFV A;  4JWQ A;  2ZN8 A;  3AAK A;  3OBV A;  1BF5 A;  4FTG A;  1K93 D;  2M97 A;  2R2I A;  3H4S E;  3WHU B;  1M46 A;  2JUL A;  2YGU A;  3BYA A;  1TCO B;  5JOL A;  1YUR A;  1F71 A;  1OZS A;  2KI4 B;  1CFP A;  4YGD B;  2LE9 B;  1SW8 A;  2LHI A;  4DRW A;  2JXC A;  4MEW A;  2B1U A;  3D77 A;  2Y1N A;  3NXA A;  3O2P A;  2EC6 C;  4A4B A;  1PK0 D;  4MSP A;  3VRP A;  1SR6 B;  4TNC A;  2LMT A;  3OGN A;  1RJV A;  3KPX A;  3CTN A;  2HQW A;  2WCM A;  2OTG B;  1J55 A;  3JVT C;  2KQ6 A;  1KK7 Z;  5AER A;  3VB1 A;  1KK8 C;  1QWV A;  1XYD A;  2HF5 A;  1KSM A;  5FI7 A;  1EG3 A;  3WXA A;  2KYC A;  1NX1 A;  2KFG A;  2ZKM X;  2ZRS A;  1WLM A;  5I2Q A;  4CPV A;  5HKW A;  3CAB A;  2F33 A;  1AHR A;  2P70 A;  1NX3 A;  5EL2 A;  1YRT B;  3PLF B;  1D1O A;  3R1V A;  1ODB A;  4M2Q A;  1XK4 C;  3NHI A;  1DQE A;  1KK7 Y;  4MRX A;  1YVL A;  4PHK A;  3F45 A;  1Y1A A;  3DXL A;  3CS1 A;  2CT9 A;  1RWY A;  4ETO A;  1TWO A;  4M2O A;  1K9K A;  1XFV O;  4YGC B;  3TUY B;  3UO9 A;  1OW4 A;  4C0J A;  2G9B A;  1CFC A;  1CDL A;  3KF9 A;  3PM8 A;  1G4Y R;  1IQ5 A;  2RGI A;  3LL8 B;  2TN4 A;  3B87 A;  3R72 A;  5DKR A;  4QJ4 B;  1DJZ A;  5I94 A;  2PQL A;  3TS5 B;  3PAL A;  3GK1 A;  1BT6 A;  4JQ0 D;  4PE0 A;  1AVS A;  2JQ6 A;  4PE7 A;  3CR4 X;  1NIW A;  5KU1 A;  3AAJ A;  2ERB A;  3WNX B;  2K7D A;  1MF8 B;  3SG7 A;  1IH0 A;  1WDC C;  2JNF A;  1TNQ A;  2LVK A;  1MUX A;  2WC5 A;  3LK1 A;  3VRN A;  3BUM B;  2WCK A;  1ALW A;  5FYX A;  5I8N A;  3I5I C;  2L5Y A;  3CZ1 A;  3L4A A;  1K96 A;  1RFJ A;  1OMR A;  2LVV A;  1SRA A;  3KEV A;  1KFU L;  2NCP A;  2BL0 B;  1IG5 A;  4HRE E;  1A29 A;  4MZJ A;  1SL7 A;  1UHH A;  3CYZ A;  4YBH B;  3DVE A;  1EJ3 A;  1YUU A;  2CBL A;  4AQJ A;  5HL1 A;  2MA2 A;  3CZ2 A;  1QX5 B;  1X02 A;  4IJ7 A;  3N7H A;  1DC1 A;  3DZT A;  1BJF A;  3SG5 A;  3OB2 B;  3NSI A;  3NSO A;  1QLK A;  2LMV A;  4ORB B;  3I5H C;  2K7B A;  1JFJ A;  1L7Z A;  2NCO A;  2LAP A;  4CFQ A;  1FI5 A;  1L2O B;  1IRJ A;  3PN7 B;  3D75 A;  5AXI A;  1B1G A;  3SG3 A;  1Z4H A;  1J7O A;  1QX2 A;  3I5F C;  2CXJ A;  1UUR A;  1DJW A;  4DS7 A;  2PMY A;  3QRX A;  1G33 A;  1JBA A;  3VRO A;  3GK2 A;  1XFW O;  1OOJ A;  1C7V A;  5DKN A;  1MXE A;  1XK4 A;  1DJH A;  1YX8 A;  1XFR A;  2PYQ A;  1ZUZ A;  1CDP A;  2K2A A;  4OZD A;  1BR4 B;  2JRF A;  4YI8 A;  2L4H A;  1SNL A;  1UP5 A;  3O78 A;  2KFH A;  2Q91 A;  3I5G C;  4MZL A;  2CCM A;  1SYM A;  2PAL A;  1WLZ A;  1NPQ A;  2ZN9 A;  1N2D A;  2F2O A;  2ZFD A;  4I5J A;  1OE9 B;  1UHN A;  3EK4 A;  2M1K B;  2LNK A;  2JT0 A;  1YUT A;  3BXK A;  2M7L A;  2O60 A;  3D0Y B;  3HCM A;  2KI6 C;  2K7O A;  5FI6 A;  4MVF A;  3KHE A;  1DJI A;  1KQM B;  1YTZ C;  2WC6 A;  2D8N A;  1M31 A;  2G2B A;  2KSP A;  4P5O E;  1B8L A;  3FWC A;  2WOS A;  1B4C A;  2JTZ A;  1QV0 A;  1J1D A;  1RK9 A;  1RRO A;  1F8H A;  4ORA B;  4WQ2 A;  1BLQ A;  4MZK A;  1LXF C;  1CDM A;  1WDC B;  2I18 A;  5IBW A;  1W7I B;  2LHL A;  3A4U B;  1YUS A;  1H4B A;  4N1G A;  1IJ5 A;  2H61 C;  3BUN B;  1PSB A;  1TNP A;  5FI2 A;  1SKT A;  3DVJ A;  1K95 A;  2EGD A;  1DGU A;  3K1E A;  3VRR A;  3B7A A;  2H2K A;  3E3R A;  1NSH A;  1SCV A;  2BKH B;  2L0P A;  1W7J B;  1KWO B;  1KFU S;  1QVI Z;  1TRF A;  2KPH A;  2WOR A;  3S0B A;  1MQ1 A;  3S0F A;  4D1E A;  1SCM B;  3ZNI A;  3MSE B;  4I5L B;  4YI9 A;  1DJX A;  1E8A A;  3D73 A;  2KFF A;  3PJI A;  3TDU A;  4C0L A;  1F4O A;  3R1P A;  4A4C A;  1DEL A;  4YRU A;  2PVB A;  4MN0 A;  1FI6 A;  2ZNE A;  1CKK A;  2CNP A;  2QEV A;  1BG1 A;  3CLN A;  3AKA A;  3OHM B;  5CSF A;  3DVK A;  2FCD A;  2BE6 A;  1YVH A;  2GGZ A;  1EL4 A;  4FQT A;  2ZRT A;  5G08 A;  4BY4 A;  2FJU B;  5K89 A;  1PVA A;  2BBM A;  1FBV A;  2JT8 A;  1CLL A;  2OS8 C;  1S36 A;  2KGB C;  3SG2 A;  2L5X B;  3BFA A;  1F54 A;  5CSI A;  1CM4 A;  2BNX A;  3EKJ A;  1F70 A;  1BOD A;  3IQQ A;  1NX0 A;  3CR5 X;  1V1F A;  2WC8 A;  2JU0 A;  5DIC A;  3SG6 A;  1CM1 A;  1TOP A;  1XFX O;  3CZT X;  1DT7 B;  1ZMZ A;  5CSN A;  5AEQ A;  3DVM A;  3GOF A;  4Q04 A;  3FS7 A;  1TNX A;  3SS4 A;  1DVI A;  2LCP A;  3S0E A;  5HKZ A;  2A4J A;  4HRG A;  5CPV A;  1GM0 A;  1C07 A;  3LLE A;  4JKT A;  4DCK A;  1IKU A;  1B7T Z;  3C1V A;  4MLW A;  1UHJ A;  1AP4 A;  3SJS A;  3IVT A;  2H61 A;  2BE4 A;  3Q8I A;  3BJH A;  4CFR A;  1FW4 A;  1XVJ A;  2QEH A;  3SG4 A;  1HT9 A;  5HLV A;  1WRK A;  1CTR A;  1F55 A;  2LLS A;  1JWD A;  2M3W A;  2F3Z A;  1S6J A;  2BCA A;  4JPZ B;  1A2X A;  1U5I A;  4PDZ A;  1B8R A;  1B7T Y;  2KBI A;  3LCP C;  1OQP A;  1N0Y A;  3EVV A;  3FWB A;  1BOC A;  5TNC A;  1U5I B;  4XJK A;  5ER4 X;  4ZCV A;  2LVJ A;  2EC6 B;  2KGR A;  2JT3 A;  4GNK B;  1OZO A;  1QTX A;  3IF7 A;  1IJ6 A;  4XJK B;  4DIR A;  4YGA A;  2KHN A;  3B88 A;  3JTD C;  4ICB A;  1DJG A;  5DKQ A;  1MXL C;  2JC2 A;  2JNX A;  3JVT B;  3RLZ A;  5I2L A;  4L9M A;  2WND A;  1MWN A;  1KK8 B;  1WY9 A;  1DTL A;  1AK8 A;  2LLT A;  1TUJ A;  1YX7 A;  2F3Y A;  3CZ0 A;  3L4L A;  2KI4 C;  2E30 A;  2P6B B;  1QAS A;  1N65 A;  2VRG A;  5KSZ A;  2M0R A;  3K21 A;  2F8P A;  4PE4 A;  3FE6 A;  4WRI A;  1C3Y A;  1CMF A;  4INW A;  1S5G Z;  1TNW A;  1TCF A;  4OV2 A;  5AAN A;  5HLO A;  1JFK A;  1BU3 A;  2L4I A;  3KO0 A;  2L2E A;  3EG5 B;  4M2P A;  2JPO A;  2K8M B;  1CMG A;  1EG4 A;  1SBJ A;  3VGO A;  2MAZ A;  3DY9 A;  1NUB A;  3PAT A;  1SSE B;  2F2P A;  3V2L A;  2LP2 A;  2LAN A;  1YR5 A;  2HQ8 A;  1ZOT B;  2SAS A;  1IGV A;  2MRD A;  1EXR A;  4OVN F;  4R1E A;  3BOW A;  2KBM A;  4PHM A;  3DF0 A;  3PSR A;  2I2R E;  3BOW B;  1LA0 A;  2FJY A;  4OCI A;  1M63 B;  2JWW A;  2GTE A;  2KDH A;  3DF0 B;  1NP8 A;  1WRZ A;  2NLN A;  1RTP 1;  1LS8 A;  4MBE A;  1PSR A;  4ORC B;  2QAC A;  2O5G A;  2V53 A;  1J7Q A;  1FF1 A;  1NCY A;  3I5I B;  1H8B A;  1IQ3 A;  1CNP A;  1QLS A;  4YGE B;  1OOI X;  2K7C A;  4PAL A;  1GJY A;  1PVB A;  1QXP A;  3TUY C;  2JTT A;  1CDN A;  2BBN A;  4E68 A;  2LM5 A;  2Y4Q A;  4USL A;  2GGM A;  1DF0 A;  2KLD A;  1CFD A;  2L98 A;  2WCJ A;  3S0A A;  3SS3 A;  1Z2C B;  3BFB A;  5D7F A;  3TS5 C;  3EKH A;  1DF0 B;  1NX2 A;  2L51 A;  1QJT A;  4PT1 A;  1UUS A;  2WCH A;  1M45 A;  1JC2 A;  1DGV A;  1NWD A;  4F7F A;  3I5H B;  2WCF A;  1S6C A;  3JTD B;  2LMU A;  1GGW A;  1LKJ A;  2HET A;  1QAT A;  2I94 A;  2M49 B;  3DYE A;  3UNW A;  1WRL A;  2K2F A;  3FE9 A;  2L2C A;  1YRU B;  3GK4 X;  4GAO A;  1QVI Y;  2K0J A;  4PHJ A;  1XFZ O;  2Y5I A;  1XO5 A;  3I5F B;  1QV1 A;  2BAP A;  1R6P A;  1IWQ A;  4F0Z B;  2BL0 C;  1ALV A;  3O6B A;  4QJ5 B;  2KAV A;  3O4Y A;  1QIW A;  4IL1 A;  3FE8 A;  2JXL A;  1UHI A;  1UHK A;  2MLE C;  5BPJ A;  4I5N B;  4GGF C;  1OOF A;  2H8V A;  3EK7 A;  3I5G B;  4INX A;  1DEK A;  1J7R A;  5D69 A;  1KCY A;  1NYA A;  1TIZ A;  4PE1 A;  1J1E A;  1CLB A;  3D10 A;  4C0K A;  1AUI B;  1L2O C;  5ER5 A;  2NXQ A;  3PN7 C;  3BQ3 A;  1P28 A;  4FQO A;  1SK6 D;  3OX6 A;  1OMD A;  4UPG A;  2M9G A;  2KYF A;  2NZ0 A;  4NDC A;  1DJY A;  4AOM A;  3QME A;  4N5X A;  3ZWH A;  2AAO A;  2QDI A;  3S0D A;  1M39 A;  1K2H A;  2K61 A;  2P71 A;  3BUO B;  4GUK A;  1BMO A;  1C7W A;  1PAL A;  1SPY A;  2PRU A;  5HKY A;  3NGV A;  3LK0 A;  4YGB B;  1TUZ A;  2IS9 A;  3OP0 A;  1SL9 A;  2OPO A;  4PHN A;  2MLF C;  1QIV A;  4N1F A;  3D78 A;  3A8R A;  5GQQ C;  2QEB A;  4U8D A;  3SIA A;  1FPW A;  3EVR A;  1A4P A;  3AKB A;  1R2U A;  3BUW B;  4GFT A;  4OKH A;  4JD9 A;  1BR1 B;  2SCP A;  5HYD A;  1K9U A;  2JPT A;  2CTN A;  3PM2 A;  3D76 A;  4NDD A;  4QJ3 B;  1HQV A;  1A03 A;  1LVC D;  1GQM A;  2LLU A;  3TDI A;  1KQM C;  1KSO A;  2PAS A;  3BFH A;  5D3O A;  1KFX L;  1NCZ A;  1REC A;  4KYN A;  1W9Z A;  3L47 A;  3DD4 A;  4HRH A;  5I2O A;  4GPL B;  4WQ3 A;  2MBX A;  2E6W A;  2FCE A;  2BCB A;  1VRK A;  4CLN A;  3RZS A;  4ZCU A;  3D74 A;  1EH2 A;  1NCX A;  5PAL A;  1B8C A;  1G8I A;  1ORG A;  2BKI B;  2LUX A;  2LUC A;  3B86 A;  1V1G A;  3NSK A;  1AJ5 A;  3SS5 A;  3TZ1 A;  2KQY A;  1CB1 A;  1JF2 A;  1S3P A;  2QEO A;  2AUC A;  2KI6 D;  1KWO C;  1S1E A;  1ZFS A;  2KAY A;  3RM1 A;  4MRY A;  2M29 A;  4AQI A;  3WHT B;  1AJ4 A;  2LVI A;  1SCM C;  2M7N A;  1Y1U A;  5AFP A;  1ZAC A;  4NDB A;  1IIO A;  2WCL A;  1K94 A;  4GGF A;  3CWG A;  2K60 A;  2OS8 B;  3NHT A;  4PCW A;  1SY9 A;  1LA3 A;  3BUX B;  2KLE A;  2LC5 A;  1SR6 C;  4NQG A;  1JSA A;  2JOJ A;  2PSR A;  1JF0 A;  1B47 A;  3O4X A;  1XFY O;  2OTG C;  2MJW B;  3NSL A;  3M0W A;  5CSJ A;  3ICB A;  5JJG A;  4I5K A;  1OMV A;  1PUL A;  1GGZ A;  1OOH A;  2KAX A;  2HPS A;  2FOT A;  1LIN A;  1TTX A;  1PRW A;  2AMI A;  3TDZ A;  1F4Q A;  1CLM A;  1S5G Y;  1S6I A;  2JZI A;  2L50 A;  5B8I B;  1CFF A;  1OSA A;  2EHB A;  2M1U A;  2MHH A;  2COL B;  4XYN A;  2ISD A;  1XA5 A;  3FIA A;  1QS7 A;  2DOQ A;  1TN4 A;  1KQV A;  3CR2 A;  2KNE A;  2LP3 A;  4BY5 A;  3CGA A;  1XFU O;  1SL8 A;  3OX5 A;  1A75 A;  1MHO A;  3B6X A;  3EVU A;  2GV5 A;  1QX7 A; 
#chains in the Genus database with same CATH homology
 3CDN A;  3Q8I A;  3BJH A;  3D75 A;  3FE8 A;  3R1O A;  1C3Z A;  2QEH A;  1OOG A;  1T14 A;  1OOF A;  2H8V A;  4INX A;  1XFR A;  3S0G A;  4OZD A;  1P28 A;  3QME A;  1GM0 A;  2QDI A;  3S0D A;  2P71 A;  3B88 A;  3NGV A;  3D77 A;  3D78 A;  2QEB A;  2WC6 A;  1TUJ A;  3CZ0 A;  3OGN A;  3L4L A;  4JD9 A;  2WCM A;  3D76 A;  3VB1 A;  3FE6 A;  1QWV A;  1C3Y A;  4INW A;  3BFH A;  3K1E A;  2JPO A;  3B7A A;  3L47 A;  3CAB A;  3DY9 A;  2KPH A;  3S0B A;  3S0F A;  2P70 A;  3V2L A;  5EL2 A;  3RZS A;  3R1V A;  3D74 A;  3PJI A;  3D73 A;  3NHI A;  1DQE A;  1ORG A;  3B86 A;  3R1P A;  3DXL A;  2FJY A;  2QEO A;  1TWO A;  2GTE A;  1OW4 A;  1LS8 A;  2QEV A;  2WCL A;  3NHT A;  3B87 A;  3R72 A;  2PQL A;  4FQT A;  1OOI X;  2ERB A;  2WC5 A;  3S0A A;  2WCJ A;  2WCK A;  3BFA A;  1OOH A;  3BFB A;  3CZ1 A;  3L4A A;  4PT1 A;  2WCH A;  5DIC A;  4F7F A;  3CYZ A;  3DYE A;  3FE9 A;  2L2C A;  3S0E A;  3CZ2 A;  3N7H A;  3DZT A;  3B6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...