1H4BA

Solution structure of the birch pollen allergen bet v 4
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords POLCALCIN BET V 4
publication title Solution Structure, Dynamics, and Hydrodynamics of the Calcium-Bound Cross-Reactive Birch Pollen Allergen Bet V 4 Reveal a Canonical Monomeric Two EF-Hand Assembly with a Regulatory Function
pubmed doi rcsb
source organism Betula verrucosa
total genus 28
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
A PF13833 EF-hand_8 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h4bA00
1NIWA 1RFJA 2LV7A 2L50A 4F0ZB 2KFHA 1W7IB 5G08A 2LC5A 1TNWA 2K61A 2LMUA 1DT7B 1N65A 1NX0A 3EVVA 1J7RA 2B1UA 4XJKB 3WNXB 1H4BA 4A4CA 4L9MA 3F45A 2F8PA 1YX8A 3VRNA 3VRPA 4YGBB 1CMFA 1S3PA 2MLFC 4YBHB 1SBJA 1K95A 1K9UA 2JULA 2LVVA 4MN0A 1DF0A 1XK4C 1BU3A 2PALA 2LCPA 2ZN8A 3OX5A 3M0WA 1XYDA 1C7VA 5I2OA 2FOTA 4QJ4B 5ER4X 5I8NA 2F3YA 2KBIA 1LA0A 3AKBA 3EVUA 3QRXA 1F55A 1CDNA 1LKJA 1TCFA 5AANA 3CR5X 3HX4A 2KGBC 4NDDA 3ZNIA 3MSEB 1CFCA 2JNFA 2O5GA 4MZJA 4MZLA 1XK4A 2BCAA 4YGEB 2F3ZA 1MXLC 3JTDC 1JC2A 4BY4A 2M7LA 2K7BA 1KK7Y 3HCMA 1ZOTB 4N1GA 4E68A 4HSZA 3VGOA 3NSLA 4ORBB 4MBEA 2KAYA 2ZNDA 3AAKA 1BF5A 1MHOA 1TTXA 1J1EA 2K2AA 3PALA 1F71A 2MRDA 2Y1MA 4YGCB 1RROA 2BE6A 1FPWA 3LLEA 1Y1XA 4WRIA 2EC6C 2BE4A 1V1FA 2HETA 3TS5C 2ZNEA 3D0YA 4WQ3A 1A75B 1SPYA 2CTNA 1UHIA 1WLMA 5HLVA 1KQVA 3WXAA 3KF9A 1DJIA 2M8UA 5KU1A 2Y4QA 3E3RA 3SG7A 1CM4A 1SK6D 2MA2A 1LXFC 2QPTA 3TDIA 4FTGA 4NDBA 3H4SE 1DGUA 2HQ8A 1CLMA 1J1DA 1NUBA 1J7OA 1H8BA 3DF0B 2JOJA 1F4OA 1KFUS 3O6BA 2K0JA 2PMYA 2LP3A 2L0PA 1IG5A 3I5FB 1MWNA 3BXKA 4I5KA 1S6CA 3I5IB 1CFPA 1JWDA 3JVTB 1SKTA 1DJHA 1TRFA 2CXJA 1FI6A 1FF1A 1B8LA 1W7JB 1V1GA 3CTNA 3EKJA 4PHMA 1TNPA 2M1KB 5HLOA 1TNXA 3TUYB 1BG1A 2P6BB 1PVBA 1L2OC 2F2PA 3SG2A 2M1UA 3NSOA 5AEQA 1VRKA 5KSZA 1NX2A 2HQWA 1BOCA 1OZOA 4CFQA 3DD4A 1EH2A 1K93D 1XO5A 3OHMB 1KFXL 4YI9A 2LM5A 2GV5A 3VRRA 1IGVA 1CB1A 1KCYA 2KYFA 1TNQA 1ZUZA 2MBXA 2LHLA 1LINA 1G8IA 5CSJA 3VROA 3WHTB 1PK0D 1RTP1 1B47A 1KWOC 2JPTA 2NCPA 4P5OE 4AQIA 4PE7A 1KQMC 4DIRA 1JF2A 3PN7C 3PFVA 1PVAA 1OE9B 4DS7A 3EK7A 1DTLA 1QX7A 1S26D 1SY9A 1YUTA 2MHHA 4C0KA 1IQ3A 1OMRA 2PRUA 1NCYA 5DKNA 5ER5A 4HRGA 3NSIA 1IKUA 5GQQC 3BUOB 1MR8A 3SJSA 2OS8B 2KI6D 1JFKA 2O60A 3PSRA 5BPJA 1SCMB 2G2BA 2JC2A 4C0JA 4OR9B 1PSRA 2M97A 1DF0B 3FWBA 1CLLA 2BCBA 4M2PA 5HKZA 2H61A 2KYCA 4GAOA 4CLNA 1QASA 1F70A 3DVEA 2WCEA 5J3XA 2NCOA 1YRTB 1SL7A 3SG6A 1PRWA 3CR2A 2JQ6A 3RLZA 5I2QA 2FCDA 1TCOB 1B8RA 3FIAA 2FCEA 3ICBA 4OVNF 4XJKA 4MLWA 2EC6B 4QJ5B 2ZFDA 1G33A 2ZN9A 1WRZA 2SCPA 2V53A 3TS5B 3DVMA 2JTZA 2KOTA 1WDCC 3O78A 2WCFA 3OP0A 1SMGA 2H61C 1RECA 1D1OA 1SYMA 1QX2A 1AK8A 1XFZO 1XVJA 2CCMA 1UHKA 2M7NA 3IF7A 4U8DA 5I2LA 2E6WA 4FQOA 1HQVA 2KDHA 2LP2A 2JT0A 1TN4A 2F33A 4TNCA 1ALVA 1PALA 3I5HB 1A4PA 4PALA 1XFYO 3VRQA 1XA5A 3DVJA 2K7DA 4CFRA 3FS7A 2WCBA 2NZ0A 4UPGA 1B7TZ 1DMOA 2EGDA 1BT6A 2LLUA 2KI4B 4GFTA 4PE1A 1LA3A 2COLB 2M29A 3BOWA 4NDCA 4PHJA 2JZIA 2OTGC 1U5IA 2I2RE 4N1FA 4MEWA 2LAPA 2KHNA 1K94A 1QJTA 1SR6B 3WHUB 3I5GB 1A03A 2PVBA 4I5LB 1QV1A 1EL4A 2HF5A 2I18A 1KK8C 2PSRA 2JT3A 4DRWA 4YGAA 1L2OB 2LMVA 3BYAA 4PCWA 1DGVA 4ICBA 1ZACA 1IH0A 1B8CA 1YRUB 1IQ5A 2KQYA 1EJ3A 3CZTX 1SNLA 1QIVA 2KQ6A 1GQMA 3DVKA 1WRLA 1QIWA 1CDLA 2K7CA 3AKAA 1NP8A 1DJGA 1KFUL 1Q80A 1DJZA 1AVSA 2KI6C 1PULA 2KSPA 2LUXA 1K9KA 5AXIA 2JU0A 2LMTA 4PDZA 1SL8A 4PHNA 1KWOB 4MSPA 3AAJA 3PLFB 5CSFA 4C0LA 3CR4X 2M9GA 1YUSA 4I5JA 3PN7B 1B7TY 2BBMA 3OB1B 4PE4A 2M49B 1TIZA 3DF0A 1YVLA 1CM1A 1DVIA 1EG4A 1AJ4A 2LHIA 3GK2A 4GGFA 4MRYA 4MZKA 1A29A 2LVKA 4JQ0D 1BR4B 2JRFA 5JJGA 1OMDA 2LUCA 1UWOA 1EG3A 4CPVA 4BY5A 1IJ6A 5HKWA 1Y1UA 1AUIB 2L4IA 3A8RA 4DUQA 3SG5A 3CLNA 1CNPA 1IJ5A 1DJXA 1QV0A 4WQ2A 4AOMA 2KGRA 2M0RA 1NPQA 1WRKA 1G4YR 1KSOA 5CSIA 2MLEC 1BJFA 5FYXA 4GGFC 5DKRA 3I5FC 2L98A 4XYNA 3TDUA 5JOLA 1UP5A 3I5IC 1JBAA 3C1VA 1MQ1A 2LNKA 1YR5A 2NLNA 1N0YA 4ETOA 1OSAA 4USLA 1S5GZ 1QLKA 1SW8A 3JTDB 4HRHA 1OZSA 5F6TA 1S36A 2KAXA 1QS7A 2ISDA 5KTYA 2AUCA 1YURA 3IQOA 4M2QA 1FW4A 2LLTA 1SCVA 1JFJA 1TOPA 1S1EA 2CT9A 2JNXA 1R2UA 1JUOA 1UUSA 2LVJA 2ZRTA 4QJ3B 4DCKA 1MUXA 3FWCA 5K89A 3BUWB 4YRUA 2JT8A 1CTRA 3CS1A 2F2OA 2KFFA 1M39A 1UHHA 2KFGA 4IL1A 4YI8A 2L2EA 1SL9A 1OOJA 1X02A 4P2YB 1AP4A 2BL0C 3PATA 4OKHA 5D69A 3LL8B 2G9BA 2ZKMX 1A2XA 1XFXO 4MVFA 1JSAA 5CSNA 3TZ1A 2MAZA 2LE9B 3EKHA 2JXLA 2ZRSA 2OTGB 1C07A 1K90D 2WOSA 2L51A 4YGDB 3KPXA 1YUUA 1GGWA 2AAOA 3ZWHA 2BKHB 2Q4UA 1QATA 3GOFA 3SG3A 1KK8B 2M3WA 3PM8A 1BLQA 2OS8C 1J7PA 1NCZA 1S5GY 1UHJA 2Y1NA 1M45A 4GBAA 2L5XB 1NX1A 4JPZB 1SCMC 3D0YB 2MJWB 2LANA 1QVIY 1NWDA 3OX6A 4ZCVA 3KHEA 1CFDA 1F4QA 3K21A 1QX5B 1S6JA 2BECA 1BODA 1NCXA 5PALA 1Y6WA 1M46A 2GGZA 2H2KA 3BOWB 4Q04A 1CKKA 1YX7A 1NYAA 2I94A 5IBWA 2CBLA 3LK0A 1U5IB 1WY9A 4R1EA 1CFFA 3D10A 1UHNA 1F54A 1ZMZA 1RJVA 2GGMA 4GGNA 1B9AA 1NSHA 2K7OA 1CLBA 1M63B 2R2IA 2HPSA 5AERA 2BBNA 1RWYA 3NXAA 3LCPC 1BR1B 2OPOA 3SG4A 3EVRA 4HREE 4GNKB 1ALWA 1A75A 2RGIA 3RM1A 1E8AA 2JTTA 1QXPA 1UURA 3SIAA 1MXEA 1AJ5A 1WLZA 3BUMB 2PASA 1JF0A 2Y5IA 1NX3A 1YVHA 1K9PA 2KAVA 1K8UA 1BMOA 4GUKA 3GK1A 4PHKA 2WNDA 1QTXA 4JWQA 1F8HA 2EHBA 5D7FA 3LK1A 1J7QA 1AHRA 1PSBA 2BKIB 1LVCD 4OCIA 3I5HC 2WC8A 2LLSA 5DKQA 1KQMB 1XFWO 4ZCUA 2CNPA 2I7AA 5B8IB 1B4CA 1CDPA 2D8NA 2DOQA 2TN4A 5AFPA 5TNCA 3KO0A 2NXQA 2KI4C 3BUNB 2SASA 3EK4A 1KSMA 3KEVA 4ORCB 1IWQA 4AQJA 4M2OA 2A4JA 1L7ZA 2FJUB 3EK8A 3TDZA 1EXRA 1ODBA 1XFVO 1J55A 1SR6C 1RK9A 3I5GC 5HYDA 2QACA 1XFUO 1YTZC 1HT9A 3O2PA 2VRGA 4I5NB 2KNEA 3CWGA 1CMGA 1KFXS 4PE0A 1SRAA 4GPLB 3SIBA 1Y0VH 1CDMA 1R6PA 3GK4X 1QLSA 4ORAB 3CGAA 3IQQA 1ZFSA 3OB2B 4A4BA 1DJWA 1C7WA 2JWWA 1OQPA 2K2FA 1DJYA 2LVIA 2WORA 2AMIA 3O4YA 4CIDA 1FI5A 1FBVA 1MF8B 2K8MB 1K96A 1K2HA 1IRJA 1OMVA 3BQ3A 3JVTC 1GGZA 4MRXA 4D1EA 5HKYA 4OV2A 2KBMA 3BUXB 2IS9A 2E30A 2JXCA 2L4HA 1N2DA 2BL0B 2Q91A 1M31A 3NSKA 4NQGA 5CPVA 1QVIZ 1WDCB 4N5XA 2BCXA 3TUYC 1B1GA 1GJYA 1S6IA 1KK7Z 1Y1AA 3A4UB
chains in the Genus database with same CATH superfamily
1NIWA 1RFJA 2LV7A 2L50A 4F0ZB 2KFHA 1W7IB 5G08A 3NHIA 2LC5A 1TNWA 3QMEA 1DELA 2K61A 2LMUA 1DT7B 1N65A 1NX0A 3EVVA 1J7RA 2B1UA 4XJKB 3WNXB 1H4BA 4A4CA 4L9MA 3F45A 2F8PA 1YX8A 5FI7A 3VRNA 3VRPA 4YGBB 1CMFA 1S3PA 3S0DA 2MLFC 4YBHB 1SBJA 1K95A 5DICA 1K9UA 1C3YA 2JULA 2LVVA 3L4AA 1DF0A 4MN0A 1XK4C 1BU3A 2PALA 2LCPA 2ZN8A 3OX5A 3M0WA 1XYDA 1C7VA 5I2OA 2FOTA 4QJ4B 5ER4X 5I8NA 2F3YA 2KBIA 1LA0A 3AKBA 3EVUA 3QRXA 1F55A 1CDNA 1LKJA 1TCFA 5AANA 3CR5X 3HX4A 2KGBC 4NDDA 3ZNIA 3MSEB 1CFCA 2JNFA 2O5GA 4MZJA 4MZLA 1XK4A 2BCAA 4YGEB 2F3ZA 1MXLC 3JTDC 3DZTA 1JC2A 4BY4A 2M7LA 2K7BA 3DXLA 1KK7Y 3HCMA 1ZOTB 4N1GA 2YGUA 4E68A 4HSZA 3VGOA 3NSLA 4ORBB 2QEHA 4MBEA 2KAYA 2ZNDA 3AAKA 1BF5A 1MHOA 1TTXA 1J1EA 2K2AA 3PALA 1F71A 2MRDA 2Y1MA 4YGCB 1RROA 2BE6A 1FPWA 3LLEA 1Y1XA 4WRIA 2EC6C 2BE4A 1V1FA 1OOHA 2HETA 1ORGA 3TS5C 2ZNEA 3D0YA 4WQ3A 1A75B 1SPYA 2CTNA 1UHIA 1GM0A 3PJIA 3NGVA 1WLMA 5HLVA 1KQVA 3WXAA 3KF9A 1DJIA 1TUJA 2M8UA 5KU1A 2Y4QA 3E3RA 3SG7A 1CM4A 1SK6D 2MA2A 2QEBA 1LXFC 2QPTA 3TDIA 4FTGA 4NDBA 3H4SE 1DGUA 2HQ8A 1CLMA 1J1DA 1NUBA 2L2CA 3R1VA 1J7OA 1H8BA 3DF0B 2JOJA 1F4OA 1KFUS 2KLEA 3O6BA 2K0JA 2PMYA 2LP3A 2L0PA 1IG5A 4OZDA 3I5FB 1MWNA 3BXKA 3B7AA 3D75A 1S6CA 3I5IB 4I5KA 1CFPA 1JWDA 3JVTB 2P71A 1SKTA 1DJHA 1TRFA 2CXJA 1FI6A 1FF1A 1B8LA 1W7JB 1V1GA 3CTNA 3EKJA 4PHMA 1OOGA 3RZSA 1TNPA 2M1KB 3CZ1A 1TNXA 1TUZA 5HLOA 3NHTA 3TUYB 1BG1A 2L5YA 2P6BB 1PVBA 1L2OC 3BFHA 2F2PA 3SG2A 2M1UA 3NSOA 5AEQA 1VRKA 3BFAA 1NX2A 3PM2A 2HQWA 5KSZA 1BOCA 1DEKA 1OZOA 4INWA 4CFQA 1C3ZA 3DD4A 1K93D 1EH2A 1XO5A 3OHMB 1KFXL 4YI9A 2LM5A 2GV5A 3VRRA 1IGVA 3FE8A 3D78A 1CB1A 2KYFA 1TNQA 3S0BA 1KCYA 1ZUZA 2MBXA 2LHLA 2PYQA 1LINA 1G8IA 5CSJA 3VROA 3WHTB 1PK0D 3EG5B 1RTP1 1B47A 1KWOC 2JPTA 2NCPA 4P5OE 3S0EA 4AQIA 4PE7A 3SS4A 1KQMC 4DIRA 1OW4A 1JF2A 3PN7C 3PFVA 1PVAA 3V2LA 1OE9B 4DS7A 3EK7A 1DTLA 1QX7A 1S26D 1SY9A 1YUTA 2MHHA 4C0KA 1IQ3A 1OMRA 2PRUA 3D73A 1NCYA 3CYZA 5DKNA 3R72A 5ER5A 4HRGA 3NSIA 1IKUA 5GQQC 3BUOB 1MR8A 3SJSA 2OS8B 2KI6D 4FQTA 1JFKA 2O60A 3PSRA 5BPJA 1SCMB 2G2BA 2JC2A 4C0JA 4OR9B 1PSRA 2M97A 1DF0B 3FWBA 1CLLA 2BCBA 3OBVA 3R1PA 3S0FA 2WC5A 4M2PA 5HKZA 1Z4HA 2H61A 2KYCA 4GAOA 4CLNA 1QASA 1F70A 3DVEA 2WCEA 5J3XA 2NCOA 1YRTB 1SL7A 3SG6A 4IJ7A 1PRWA 3CR2A 2JQ6A 3RLZA 3B87A 2FCDA 1TCOB 5I2QA 1B8RA 3FIAA 2FCEA 3ICBA 4OVNF 4XJKA 4MLWA 2EC6B 4QJ5B 2ZFDA 1G33A 2ZN9A 1WRZA 4INXA 2SCPA 2V53A 3TS5B 3DVMA 4F7FA 2JTZA 2KOTA 1WDCC 3O78A 3IVTA 2WCFA 2K60A 3BFBA 1SMGA 3OP0A 5D3OA 2H61C 1RECA 1D1OA 1SYMA 1QX2A 1AK8A 1XFZO 1XVJA 2CCMA 1UHKA 2M7NA 1OOIX 3IF7A 4U8DA 5I2LA 2E6WA 4FQOA 1HQVA 2KDHA 2LP2A 2JT0A 1TN4A 2F33A 4TNCA 1ALVA 1PALA 3I5HB 3BJHA 3S0AA 1A4PA 4PALA 1XFYO 3VRQA 1XA5A 3DVJA 2K7DA 4CFRA 3DY9A 3FS7A 2WCBA 2NZ0A 4UPGA 1B7TZ 1DMOA 2EGDA 1BT6A 2LLUA 1OOFA 2KI4B 4GFTA 4PE1A 5I94A 1LA3A 2COLB 2M29A 3BOWA 4NDCA 4PHJA 2JZIA 2OTGC 1U5IA 2I2RE 3R1OA 4N1FA 2PQLA 4MEWA 2LAPA 2KHNA 1K94A 1QJTA 1SR6B 3WHUB 3I5GB 1A03A 2PVBA 4I5LB 5EL2A 1QV1A 1EL4A 2HF5A 2I18A 1KK8C 2PSRA 3FE9A 2JT3A 4DRWA 3FE6A 1L2OB 2LMVA 2H8VA 3BYAA 4YGAA 4PCWA 3D74A 1DGVA 4ICBA 1ZACA 1IH0A 1B8CA 1YRUB 1IQ5A 2KQYA 1EJ3A 3CZTX 1SNLA 1QIVA 2KQ6A 1GQMA 3DVKA 1WRLA 1QIWA 1CDLA 2K7CA 3AKAA 4JD9A 1NP8A 1DJGA 1KFUL 1Q80A 1DJZA 1AVSA 2KI6C 1PULA 2KSPA 2LUXA 3SS3A 1K9KA 5AXIA 2JU0A 2LMTA 4PDZA 1SL8A 4JKTA 4PHNA 1KWOB 3DYEA 4MSPA 3UNWA 3AAJA 1LS8A 3PLFB 5CSFA 4C0LA 3CR4X 2M9GA 1YUSA 4I5JA 3PN7B 1B7TY 2BBMA 3OB1B 4PE4A 2M49B 1TIZA 3DF0A 1YVLA 1CM1A 1DVIA 1EG4A 1AJ4A 2LHIA 3GK2A 4GGFA 1DQEA 2WCKA 3CDNA 3K1EA 4MRYA 4MZKA 1A29A 2LVKA 4JQ0D 1BR4B 2JRFA 5JJGA 1OMDA 2LUCA 1UWOA 3L4LA 1EG3A 4CPVA 3B6XA 1IJ6A 5HKWA 4BY5A 1Y1UA 1AUIB 2L4IA 3A8RA 4DUQA 3SG5A 3CLNA 1CNPA 1IJ5A 1W9ZA 1DJXA 1QV0A 4WQ2A 4AOMA 2KGRA 2M0RA 1NPQA 1WRKA 1G4YR 1KSOA 5CSIA 2MLEC 1BJFA 5FYXA 2P70A 4GGFC 2JPOA 5DKRA 3I5FC 2L98A 4XYNA 3TDUA 5JOLA 1UP5A 3I5IC 1JBAA 3C1VA 1MQ1A 5HL1A 2BNXA 2LNKA 1YR5A 2NLNA 1N0YA 4ETOA 1OSAA 4USLA 1S5GZ 1QLKA 1SW8A 3JTDB 4HRHA 1OZSA 5F6TA 1S36A 2KAXA 1QS7A 2ISDA 5KTYA 2AUCA 1YURA 3B88A 3IQOA 4M2QA 1QWVA 1FW4A 2LLTA 1TWOA 3L47A 1SCVA 1JFJA 3SS5A 1TOPA 1S1EA 2CT9A 2JNXA 1R2UA 1JUOA 1UUSA 2LVJA 2ZRTA 4QJ3B 3CZ0A 3VB1A 1MUXA 3FWCA 4DCKA 5K89A 3BUWB 4YRUA 1IIOA 2JT8A 1CTRA 3CS1A 2F2OA 3CABA 2KFFA 1M39A 1UHHA 2KFGA 4IL1A 3D76A 4YI8A 2L2EA 1SL9A 3S0GA 1OOJA 1X02A 4P2YB 1AP4A 2BL0C 3PATA 4OKHA 5D69A 3LL8B 2G9BA 2ZKMX 1A2XA 1XFXO 4MVFA 1JSAA 5CSNA 3TZ1A 2MAZA 2LE9B 1XFRA 3EKHA 2JXLA 2ZRSA 2OTGB 1C07A 1K90D 2WOSA 2L51A 4YGDB 3KPXA 1YUUA 1GGWA 2AAOA 3ZWHA 2BKHB 2Q4UA 1QATA 3GOFA 3SG3A 1KK8B 2M3WA 3PM8A 1BLQA 2OS8C 1J7PA 1NCZA 1S5GY 1UHJA 2Y1NA 1M45A 4GBAA 2L5XB 1NX1A 4JPZB 1SCMC 3D0YB 2MJWB 2LANA 1QVIY 3Q8IA 1NWDA 3OX6A 4ZCVA 3KHEA 1CFDA 1F4QA 2ERBA 3K21A 1QX5B 1S6JA 2BECA 1BODA 1NCXA 5PALA 1Y6WA 1DC1A 1M46A 2GGZA 2H2KA 3BOWB 4Q04A 1CKKA 1YX7A 1NYAA 2I94A 5IBWA 2CBLA 3LK0A 1U5IB 1WY9A 2QEOA 4R1EA 1CFFA 3D10A 3CZ2A 1UHNA 2WC6A 1F54A 1ZMZA 1RJVA 2GGMA 4GGNA 1B9AA 1NSHA 2K7OA 1CLBA 1M63B 2R2IA 2HPSA 5AERA 2BBNA 1RWYA 3NXAA 3LCPC 1BR1B 3O4XA 2OPOA 1P28A 2WCMA 4PT1A 5FI6A 3SG4A 3EVRA 1Z2CB 3N7HA 4HREE 4GNKB 1ALWA 1A75A 2RGIA 3RM1A 1E8AA 2JTTA 1QXPA 1UURA 2WCLA 3SIAA 1MXEA 5FI2A 1AJ5A 1WLZA 3BUMB 2PASA 1JF0A 2Y5IA 1NX3A 1YVHA 1K9PA 2KAVA 3UO9A 1K8UA 1BMOA 4GUKA 4KYNA 3GK1A 4PHKA 2WNDA 1QTXA 4JWQA 1T14A 2EHBA 1F8HA 5D7FA 3LK1A 1J7QA 1AHRA 1PSBA 2BKIB 1LVCD 4OCIA 2BAPA 2WC8A 3B86A 3I5HC 2QEVA 2LLSA 5DKQA 2QDIA 1KQMB 2GTEA 1XFWO 4ZCUA 2CNPA 2I7AA 2KLDA 5B8IB 1B4CA 2WCHA 1CDPA 2D8NA 2DOQA 2TN4A 5AFPA 5TNCA 3KO0A 2NXQA 2KI4C 3BUNB 2SASA 3EK4A 1KSMA 3KEVA 4ORCB 1IWQA 4AQJA 4M2OA 3OGNA 2A4JA 1L7ZA 2FJUB 3EK8A 3TDZA 1EXRA 1ODBA 1XFVO 1J55A 1SR6C 1RK9A 3I5GC 5HYDA 2KPHA 2QACA 1XFUO 1YTZC 1HT9A 3O2PA 2WCJA 2VRGA 4I5NB 2KNEA 3CWGA 1CMGA 1KFXS 4PE0A 1SRAA 4GPLB 3SIBA 1Y0VH 1CDMA 1R6PA 3GK4X 1QLSA 4ORAB 3CGAA 3IQQA 1ZFSA 3OB2B 4A4BA 1DJWA 1C7WA 1SSEB 1OQPA 2JWWA 1DJYA 2K2FA 2LVIA 2AMIA 2WORA 3D77A 3O4YA 4CIDA 1FI5A 1FBVA 1MF8B 2K8MB 1K96A 1K2HA 1IRJA 1OMVA 3BQ3A 3JVTC 1GGZA 4MRXA 4D1EA 5HKYA 4OV2A 2KBMA 3BUXB 2IS9A 2E30A 2JXCA 2L4HA 1N2DA 2BL0B 2Q91A 1M31A 3NSKA 2FJYA 4NQGA 5CPVA 1QVIZ 1WDCB 4N5XA 2BCXA 3TUYC 1B1GA 1GJYA 1S6IA 1KK7Z 1Y1AA 3A4UB
chains in the Genus database with same CATH topology
1NIWA 1RFJA 2LV7A 2L50A 4F0ZB 2KFHA 1W7IB 5G08A 2LC5A 1TNWA 2K61A 2LMUA 1DT7B 1N65A 1NX0A 3EVVA 1J7RA 2B1UA 4XJKB 3WNXB 1H4BA 4A4CA 4L9MA 3F45A 2F8PA 1YX8A 3VRNA 3VRPA 4YGBB 1CMFA 1S3PA 2MLFC 4YBHB 1SBJA 1K95A 1K9UA 2JULA 2LVVA 4MN0A 1DF0A 1XK4C 1BU3A 2PALA 2LCPA 2ZN8A 3OX5A 3M0WA 1XYDA 1C7VA 5I2OA 2FOTA 4QJ4B 5ER4X 5I8NA 2F3YA 2KBIA 1LA0A 3AKBA 3EVUA 3QRXA 1F55A 1CDNA 1LKJA 1TCFA 5AANA 3CR5X 3HX4A 2KGBC 4NDDA 3ZNIA 3MSEB 1CFCA 2JNFA 2O5GA 4MZJA 4MZLA 1XK4A 2BCAA 4YGEB 2F3ZA 1MXLC 3JTDC 1JC2A 4BY4A 2M7LA 2K7BA 1KK7Y 3HCMA 1ZOTB 4N1GA 4E68A 4HSZA 3VGOA 3NSLA 4ORBB 4MBEA 2KAYA 2ZNDA 3AAKA 1BF5A 1MHOA 1TTXA 1J1EA 2K2AA 3PALA 1F71A 2MRDA 2Y1MA 4YGCB 1RROA 2BE6A 1FPWA 3LLEA 1Y1XA 4WRIA 2EC6C 2BE4A 1V1FA 2HETA 3TS5C 2ZNEA 3D0YA 4WQ3A 1A75B 1SPYA 2CTNA 1UHIA 1WLMA 5HLVA 1KQVA 3WXAA 3KF9A 1DJIA 2M8UA 5KU1A 2Y4QA 3E3RA 3SG7A 1CM4A 1SK6D 2MA2A 1LXFC 2QPTA 3TDIA 4FTGA 4NDBA 3H4SE 1DGUA 2HQ8A 1CLMA 1J1DA 1NUBA 1J7OA 1H8BA 3DF0B 2JOJA 1F4OA 1KFUS 3O6BA 2K0JA 2PMYA 2LP3A 2L0PA 1IG5A 3I5FB 1MWNA 3BXKA 4I5KA 1S6CA 3I5IB 1CFPA 1JWDA 3JVTB 1SKTA 1DJHA 1TRFA 2CXJA 1FI6A 1FF1A 1B8LA 1W7JB 1V1GA 3CTNA 3EKJA 4PHMA 1TNPA 2M1KB 5HLOA 1TNXA 3TUYB 1BG1A 2P6BB 1PVBA 1L2OC 2F2PA 3SG2A 2M1UA 3NSOA 5AEQA 1VRKA 5KSZA 1NX2A 2HQWA 1BOCA 1OZOA 4CFQA 3DD4A 1EH2A 1K93D 1XO5A 3OHMB 1KFXL 4YI9A 2LM5A 2GV5A 3VRRA 1IGVA 1CB1A 1KCYA 2KYFA 1TNQA 1ZUZA 2MBXA 2LHLA 1LINA 1G8IA 5CSJA 3VROA 3WHTB 1PK0D 1RTP1 1B47A 1KWOC 2JPTA 2NCPA 4P5OE 4AQIA 4PE7A 1KQMC 4DIRA 1JF2A 3PN7C 3PFVA 1PVAA 1OE9B 4DS7A 3EK7A 1DTLA 1QX7A 1S26D 1SY9A 1YUTA 2MHHA 4C0KA 1IQ3A 1OMRA 2PRUA 1NCYA 5DKNA 5ER5A 4HRGA 3NSIA 1IKUA 5GQQC 3BUOB 1MR8A 3SJSA 2OS8B 2KI6D 1JFKA 2O60A 3PSRA 5BPJA 1SCMB 2G2BA 2JC2A 4C0JA 4OR9B 1PSRA 2M97A 1DF0B 3FWBA 1CLLA 2BCBA 4M2PA 5HKZA 2H61A 2KYCA 4GAOA 4CLNA 1QASA 1F70A 3DVEA 2WCEA 5J3XA 2NCOA 1YRTB 1SL7A 3SG6A 1PRWA 3CR2A 2JQ6A 3RLZA 5I2QA 2FCDA 1TCOB 1B8RA 3FIAA 2FCEA 3ICBA 4OVNF 4XJKA 4MLWA 2EC6B 4QJ5B 2ZFDA 1G33A 2ZN9A 1WRZA 2SCPA 2V53A 3TS5B 3DVMA 2JTZA 2KOTA 1WDCC 3O78A 2WCFA 3OP0A 1SMGA 2H61C 1RECA 1D1OA 1SYMA 1QX2A 1AK8A 1XFZO 1XVJA 2CCMA 1UHKA 2M7NA 3IF7A 4U8DA 5I2LA 2E6WA 4FQOA 1HQVA 2KDHA 2LP2A 2JT0A 1TN4A 2F33A 4TNCA 1ALVA 1PALA 3I5HB 1A4PA 4PALA 1XFYO 3VRQA 1XA5A 3DVJA 2K7DA 4CFRA 3FS7A 2WCBA 2NZ0A 4UPGA 1B7TZ 1DMOA 2EGDA 1BT6A 2LLUA 2KI4B 4GFTA 4PE1A 1LA3A 2COLB 2M29A 3BOWA 4NDCA 4PHJA 2JZIA 2OTGC 1U5IA 2I2RE 4N1FA 4MEWA 2LAPA 2KHNA 1K94A 1QJTA 1SR6B 3WHUB 3I5GB 1A03A 2PVBA 4I5LB 1QV1A 1EL4A 2HF5A 2I18A 1KK8C 2PSRA 2JT3A 4DRWA 4YGAA 1L2OB 2LMVA 3BYAA 4PCWA 1DGVA 4ICBA 1ZACA 1IH0A 1B8CA 1YRUB 1IQ5A 2KQYA 1EJ3A 3CZTX 1SNLA 1QIVA 2KQ6A 1GQMA 3DVKA 1WRLA 1QIWA 1CDLA 2K7CA 3AKAA 1NP8A 1DJGA 1KFUL 1Q80A 1DJZA 1AVSA 2KI6C 1PULA 2KSPA 2LUXA 1K9KA 5AXIA 2JU0A 2LMTA 4PDZA 1SL8A 4PHNA 1KWOB 4MSPA 3AAJA 3PLFB 5CSFA 4C0LA 3CR4X 2M9GA 1YUSA 4I5JA 3PN7B 1B7TY 2BBMA 3OB1B 4PE4A 2M49B 1TIZA 3DF0A 1YVLA 1CM1A 1DVIA 1EG4A 1AJ4A 2LHIA 3GK2A 4GGFA 4MRYA 4MZKA 1A29A 2LVKA 4JQ0D 1BR4B 2JRFA 5JJGA 1OMDA 2LUCA 1UWOA 1EG3A 4CPVA 4BY5A 1IJ6A 5HKWA 1Y1UA 1AUIB 2L4IA 3A8RA 4DUQA 3SG5A 3CLNA 1CNPA 1IJ5A 1DJXA 1QV0A 4WQ2A 4AOMA 2KGRA 2M0RA 1NPQA 1WRKA 1G4YR 1KSOA 5CSIA 2MLEC 1BJFA 5FYXA 4GGFC 5DKRA 3I5FC 2L98A 4XYNA 3TDUA 5JOLA 1UP5A 3I5IC 1JBAA 3C1VA 1MQ1A 2LNKA 1YR5A 2NLNA 1N0YA 4ETOA 1OSAA 4USLA 1S5GZ 1QLKA 1SW8A 3JTDB 4HRHA 1OZSA 5F6TA 1S36A 2KAXA 1QS7A 2ISDA 5KTYA 2AUCA 1YURA 3IQOA 4M2QA 1FW4A 2LLTA 1SCVA 1JFJA 1TOPA 1S1EA 2CT9A 2JNXA 1R2UA 1JUOA 1UUSA 2LVJA 2ZRTA 4QJ3B 4DCKA 1MUXA 3FWCA 5K89A 3BUWB 4YRUA 2JT8A 1CTRA 3CS1A 2F2OA 2KFFA 1M39A 1UHHA 2KFGA 4IL1A 4YI8A 2L2EA 1SL9A 1OOJA 1X02A 4P2YB 1AP4A 2BL0C 3PATA 4OKHA 5D69A 3LL8B 2G9BA 2ZKMX 1A2XA 1XFXO 4MVFA 1JSAA 5CSNA 3TZ1A 2MAZA 2LE9B 3EKHA 2JXLA 2ZRSA 2OTGB 1C07A 1K90D 2WOSA 2L51A 4YGDB 3KPXA 1YUUA 1GGWA 2AAOA 3ZWHA 2BKHB 2Q4UA 1QATA 3GOFA 3SG3A 1KK8B 2M3WA 3PM8A 1BLQA 2OS8C 1J7PA 1NCZA 1S5GY 1UHJA 2Y1NA 1M45A 4GBAA 2L5XB 1NX1A 4JPZB 1SCMC 3D0YB 2MJWB 2LANA 1QVIY 1NWDA 3OX6A 4ZCVA 3KHEA 1CFDA 1F4QA 3K21A 1QX5B 1S6JA 2BECA 1BODA 1NCXA 5PALA 1Y6WA 1M46A 2GGZA 2H2KA 3BOWB 4Q04A 1CKKA 1YX7A 1NYAA 2I94A 5IBWA 2CBLA 3LK0A 1U5IB 1WY9A 4R1EA 1CFFA 3D10A 1UHNA 1F54A 1ZMZA 1RJVA 2GGMA 4GGNA 1B9AA 1NSHA 2K7OA 1CLBA 1M63B 2R2IA 2HPSA 5AERA 2BBNA 1RWYA 3NXAA 3LCPC 1BR1B 2OPOA 3SG4A 3EVRA 4HREE 4GNKB 1ALWA 1A75A 2RGIA 3RM1A 1E8AA 2JTTA 1QXPA 1UURA 3SIAA 1MXEA 1AJ5A 1WLZA 3BUMB 2PASA 1JF0A 2Y5IA 1NX3A 1YVHA 1K9PA 2KAVA 1K8UA 1BMOA 4GUKA 3GK1A 4PHKA 2WNDA 1QTXA 4JWQA 1F8HA 2EHBA 5D7FA 3LK1A 1J7QA 1AHRA 1PSBA 2BKIB 1LVCD 4OCIA 3I5HC 2WC8A 2LLSA 5DKQA 1KQMB 1XFWO 4ZCUA 2CNPA 2I7AA 5B8IB 1B4CA 1CDPA 2D8NA 2DOQA 2TN4A 5AFPA 5TNCA 3KO0A 2NXQA 2KI4C 3BUNB 2SASA 3EK4A 1KSMA 3KEVA 4ORCB 1IWQA 4AQJA 4M2OA 2A4JA 1L7ZA 2FJUB 3EK8A 3TDZA 1EXRA 1ODBA 1XFVO 1J55A 1SR6C 1RK9A 3I5GC 5HYDA 2QACA 1XFUO 1YTZC 1HT9A 3O2PA 2VRGA 4I5NB 2KNEA 3CWGA 1CMGA 1KFXS 4PE0A 1SRAA 4GPLB 3SIBA 1Y0VH 1CDMA 1R6PA 3GK4X 1QLSA 4ORAB 3CGAA 3IQQA 1ZFSA 3OB2B 4A4BA 1DJWA 1C7WA 2JWWA 1OQPA 2K2FA 1DJYA 2LVIA 2WORA 2AMIA 3O4YA 4CIDA 1FI5A 1FBVA 1MF8B 2K8MB 1K96A 1K2HA 1IRJA 1OMVA 3BQ3A 3JVTC 1GGZA 4MRXA 4D1EA 5HKYA 4OV2A 2KBMA 3BUXB 2IS9A 2E30A 2JXCA 2L4HA 1N2DA 2BL0B 2Q91A 1M31A 3NSKA 4NQGA 5CPVA 1QVIZ 1WDCB 4N5XA 2BCXA 3TUYC 1B1GA 1GJYA 1S6IA 1KK7Z 1Y1AA 3A4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NIW A;  1RFJ A;  2LV7 A;  2L50 A;  4F0Z B;  2KFH A;  1W7I B;  5G08 A;  2LC5 A;  1TNW A;  2K61 A;  2LMU A;  1DT7 B;  1N65 A;  1NX0 A;  3EVV A;  1J7R A;  2B1U A;  4XJK B;  3WNX B;  1H4B A;  4A4C A;  4L9M A;  3F45 A;  2F8P A;  1YX8 A;  3VRN A;  3VRP A;  4YGB B;  1CMF A;  1S3P A;  2MLF C;  4YBH B;  1SBJ A;  1K95 A;  1K9U A;  2JUL A;  2LVV A;  4MN0 A;  1DF0 A;  1XK4 C;  1BU3 A;  2PAL A;  2LCP A;  2ZN8 A;  3OX5 A;  3M0W A;  1XYD A;  1C7V A;  5I2O A;  2FOT A;  4QJ4 B;  5ER4 X;  5I8N A;  2F3Y A;  2KBI A;  1LA0 A;  3AKB A;  3EVU A;  3QRX A;  1F55 A;  1CDN A;  1LKJ A;  1TCF A;  5AAN A;  3CR5 X;  3HX4 A;  2KGB C;  4NDD A;  3ZNI A;  3MSE B;  1CFC A;  2JNF A;  2O5G A;  4MZJ A;  4MZL A;  1XK4 A;  2BCA A;  4YGE B;  2F3Z A;  1MXL C;  3JTD C;  1JC2 A;  4BY4 A;  2M7L A;  2K7B A;  1KK7 Y;  3HCM A;  1ZOT B;  4N1G A;  4E68 A;  4HSZ A;  3VGO A;  3NSL A;  4ORB B;  4MBE A;  2KAY A;  2ZND A;  3AAK A;  1BF5 A;  1MHO A;  1TTX A;  1J1E A;  2K2A A;  3PAL A;  1F71 A;  2MRD A;  2Y1M A;  4YGC B;  1RRO A;  2BE6 A;  1FPW A;  3LLE A;  1Y1X A;  4WRI A;  2EC6 C;  2BE4 A;  1V1F A;  2HET A;  3TS5 C;  2ZNE A;  3D0Y A;  4WQ3 A;  1A75 B;  1SPY A;  2CTN A;  1UHI A;  1WLM A;  5HLV A;  1KQV A;  3WXA A;  3KF9 A;  1DJI A;  2M8U A;  5KU1 A;  2Y4Q A;  3E3R A;  3SG7 A;  1CM4 A;  1SK6 D;  2MA2 A;  1LXF C;  2QPT A;  3TDI A;  4FTG A;  4NDB A;  3H4S E;  1DGU A;  2HQ8 A;  1CLM A;  1J1D A;  1NUB A;  1J7O A;  1H8B A;  3DF0 B;  2JOJ A;  1F4O A;  1KFU S;  3O6B A;  2K0J A;  2PMY A;  2LP3 A;  2L0P A;  1IG5 A;  3I5F B;  1MWN A;  3BXK A;  4I5K A;  1S6C A;  3I5I B;  1CFP A;  1JWD A;  3JVT B;  1SKT A;  1DJH A;  1TRF A;  2CXJ A;  1FI6 A;  1FF1 A;  1B8L A;  1W7J B;  1V1G A;  3CTN A;  3EKJ A;  4PHM A;  1TNP A;  2M1K B;  5HLO A;  1TNX A;  3TUY B;  1BG1 A;  2P6B B;  1PVB A;  1L2O C;  2F2P A;  3SG2 A;  2M1U A;  3NSO A;  5AEQ A;  1VRK A;  5KSZ A;  1NX2 A;  2HQW A;  1BOC A;  1OZO A;  4CFQ A;  3DD4 A;  1EH2 A;  1K93 D;  1XO5 A;  3OHM B;  1KFX L;  4YI9 A;  2LM5 A;  2GV5 A;  3VRR A;  1IGV A;  1CB1 A;  1KCY A;  2KYF A;  1TNQ A;  1ZUZ A;  2MBX A;  2LHL A;  1LIN A;  1G8I A;  5CSJ A;  3VRO A;  3WHT B;  1PK0 D;  1RTP 1;  1B47 A;  1KWO C;  2JPT A;  2NCP A;  4P5O E;  4AQI A;  4PE7 A;  1KQM C;  4DIR A;  1JF2 A;  3PN7 C;  3PFV A;  1PVA A;  1OE9 B;  4DS7 A;  3EK7 A;  1DTL A;  1QX7 A;  1S26 D;  1SY9 A;  1YUT A;  2MHH A;  4C0K A;  1IQ3 A;  1OMR A;  2PRU A;  1NCY A;  5DKN A;  5ER5 A;  4HRG A;  3NSI A;  1IKU A;  5GQQ C;  3BUO B;  1MR8 A;  3SJS A;  2OS8 B;  2KI6 D;  1JFK A;  2O60 A;  3PSR A;  5BPJ A;  1SCM B;  2G2B A;  2JC2 A;  4C0J A;  4OR9 B;  1PSR A;  2M97 A;  1DF0 B;  3FWB A;  1CLL A;  2BCB A;  4M2P A;  5HKZ A;  2H61 A;  2KYC A;  4GAO A;  4CLN A;  1QAS A;  1F70 A;  3DVE A;  2WCE A;  5J3X A;  2NCO A;  1YRT B;  1SL7 A;  3SG6 A;  1PRW A;  3CR2 A;  2JQ6 A;  3RLZ A;  5I2Q A;  2FCD A;  1TCO B;  1B8R A;  3FIA A;  2FCE A;  3ICB A;  4OVN F;  4XJK A;  4MLW A;  2EC6 B;  4QJ5 B;  2ZFD A;  1G33 A;  2ZN9 A;  1WRZ A;  2SCP A;  2V53 A;  3TS5 B;  3DVM A;  2JTZ A;  2KOT A;  1WDC C;  3O78 A;  2WCF A;  3OP0 A;  1SMG A;  2H61 C;  1REC A;  1D1O A;  1SYM A;  1QX2 A;  1AK8 A;  1XFZ O;  1XVJ A;  2CCM A;  1UHK A;  2M7N A;  3IF7 A;  4U8D A;  5I2L A;  2E6W A;  4FQO A;  1HQV A;  2KDH A;  2LP2 A;  2JT0 A;  1TN4 A;  2F33 A;  4TNC A;  1ALV A;  1PAL A;  3I5H B;  1A4P A;  4PAL A;  1XFY O;  3VRQ A;  1XA5 A;  3DVJ A;  2K7D A;  4CFR A;  3FS7 A;  2WCB A;  2NZ0 A;  4UPG A;  1B7T Z;  1DMO A;  2EGD A;  1BT6 A;  2LLU A;  2KI4 B;  4GFT A;  4PE1 A;  1LA3 A;  2COL B;  2M29 A;  3BOW A;  4NDC A;  4PHJ A;  2JZI A;  2OTG C;  1U5I A;  2I2R E;  4N1F A;  4MEW A;  2LAP A;  2KHN A;  1K94 A;  1QJT A;  1SR6 B;  3WHU B;  3I5G B;  1A03 A;  2PVB A;  4I5L B;  1QV1 A;  1EL4 A;  2HF5 A;  2I18 A;  1KK8 C;  2PSR A;  2JT3 A;  4DRW A;  4YGA A;  1L2O B;  2LMV A;  3BYA A;  4PCW A;  1DGV A;  4ICB A;  1ZAC A;  1IH0 A;  1B8C A;  1YRU B;  1IQ5 A;  2KQY A;  1EJ3 A;  3CZT X;  1SNL A;  1QIV A;  2KQ6 A;  1GQM A;  3DVK A;  1WRL A;  1QIW A;  1CDL A;  2K7C A;  3AKA A;  1NP8 A;  1DJG A;  1KFU L;  1Q80 A;  1DJZ A;  1AVS A;  2KI6 C;  1PUL A;  2KSP A;  2LUX A;  1K9K A;  5AXI A;  2JU0 A;  2LMT A;  4PDZ A;  1SL8 A;  4PHN A;  1KWO B;  4MSP A;  3AAJ A;  3PLF B;  5CSF A;  4C0L A;  3CR4 X;  2M9G A;  1YUS A;  4I5J A;  3PN7 B;  1B7T Y;  2BBM A;  3OB1 B;  4PE4 A;  2M49 B;  1TIZ A;  3DF0 A;  1YVL A;  1CM1 A;  1DVI A;  1EG4 A;  1AJ4 A;  2LHI A;  3GK2 A;  4GGF A;  4MRY A;  4MZK A;  1A29 A;  2LVK A;  4JQ0 D;  1BR4 B;  2JRF A;  5JJG A;  1OMD A;  2LUC A;  1UWO A;  1EG3 A;  4CPV A;  4BY5 A;  1IJ6 A;  5HKW A;  1Y1U A;  1AUI B;  2L4I A;  3A8R A;  4DUQ A;  3SG5 A;  3CLN A;  1CNP A;  1IJ5 A;  1DJX A;  1QV0 A;  4WQ2 A;  4AOM A;  2KGR A;  2M0R A;  1NPQ A;  1WRK A;  1G4Y R;  1KSO A;  5CSI A;  2MLE C;  1BJF A;  5FYX A;  4GGF C;  5DKR A;  3I5F C;  2L98 A;  4XYN A;  3TDU A;  5JOL A;  1UP5 A;  3I5I C;  1JBA A;  3C1V A;  1MQ1 A;  2LNK A;  1YR5 A;  2NLN A;  1N0Y A;  4ETO A;  1OSA A;  4USL A;  1S5G Z;  1QLK A;  1SW8 A;  3JTD B;  4HRH A;  1OZS A;  5F6T A;  1S36 A;  2KAX A;  1QS7 A;  2ISD A;  5KTY A;  2AUC A;  1YUR A;  3IQO A;  4M2Q A;  1FW4 A;  2LLT A;  1SCV A;  1JFJ A;  1TOP A;  1S1E A;  2CT9 A;  2JNX A;  1R2U A;  1JUO A;  1UUS A;  2LVJ A;  2ZRT A;  4QJ3 B;  4DCK A;  1MUX A;  3FWC A;  5K89 A;  3BUW B;  4YRU A;  2JT8 A;  1CTR A;  3CS1 A;  2F2O A;  2KFF A;  1M39 A;  1UHH A;  2KFG A;  4IL1 A;  4YI8 A;  2L2E A;  1SL9 A;  1OOJ A;  1X02 A;  4P2Y B;  1AP4 A;  2BL0 C;  3PAT A;  4OKH A;  5D69 A;  3LL8 B;  2G9B A;  2ZKM X;  1A2X A;  1XFX O;  4MVF A;  1JSA A;  5CSN A;  3TZ1 A;  2MAZ A;  2LE9 B;  3EKH A;  2JXL A;  2ZRS A;  2OTG B;  1C07 A;  1K90 D;  2WOS A;  2L51 A;  4YGD B;  3KPX A;  1YUU A;  1GGW A;  2AAO A;  3ZWH A;  2BKH B;  2Q4U A;  1QAT A;  3GOF A;  3SG3 A;  1KK8 B;  2M3W A;  3PM8 A;  1BLQ A;  2OS8 C;  1J7P A;  1NCZ A;  1S5G Y;  1UHJ A;  2Y1N A;  1M45 A;  4GBA A;  2L5X B;  1NX1 A;  4JPZ B;  1SCM C;  3D0Y B;  2MJW B;  2LAN A;  1QVI Y;  1NWD A;  3OX6 A;  4ZCV A;  3KHE A;  1CFD A;  1F4Q A;  3K21 A;  1QX5 B;  1S6J A;  2BEC A;  1BOD A;  1NCX A;  5PAL A;  1Y6W A;  1M46 A;  2GGZ A;  2H2K A;  3BOW B;  4Q04 A;  1CKK A;  1YX7 A;  1NYA A;  2I94 A;  5IBW A;  2CBL A;  3LK0 A;  1U5I B;  1WY9 A;  4R1E A;  1CFF A;  3D10 A;  1UHN A;  1F54 A;  1ZMZ A;  1RJV A;  2GGM A;  4GGN A;  1B9A A;  1NSH A;  2K7O A;  1CLB A;  1M63 B;  2R2I A;  2HPS A;  5AER A;  2BBN A;  1RWY A;  3NXA A;  3LCP C;  1BR1 B;  2OPO A;  3SG4 A;  3EVR A;  4HRE E;  4GNK B;  1ALW A;  1A75 A;  2RGI A;  3RM1 A;  1E8A A;  2JTT A;  1QXP A;  1UUR A;  3SIA A;  1MXE A;  1AJ5 A;  1WLZ A;  3BUM B;  2PAS A;  1JF0 A;  2Y5I A;  1NX3 A;  1YVH A;  1K9P A;  2KAV A;  1K8U A;  1BMO A;  4GUK A;  3GK1 A;  4PHK A;  2WND A;  1QTX A;  4JWQ A;  1F8H A;  2EHB A;  5D7F A;  3LK1 A;  1J7Q A;  1AHR A;  1PSB A;  2BKI B;  1LVC D;  4OCI A;  3I5H C;  2WC8 A;  2LLS A;  5DKQ A;  1KQM B;  1XFW O;  4ZCU A;  2CNP A;  2I7A A;  5B8I B;  1B4C A;  1CDP A;  2D8N A;  2DOQ A;  2TN4 A;  5AFP A;  5TNC A;  3KO0 A;  2NXQ A;  2KI4 C;  3BUN B;  2SAS A;  3EK4 A;  1KSM A;  3KEV A;  4ORC B;  1IWQ A;  4AQJ A;  4M2O A;  2A4J A;  1L7Z A;  2FJU B;  3EK8 A;  3TDZ A;  1EXR A;  1ODB A;  1XFV O;  1J55 A;  1SR6 C;  1RK9 A;  3I5G C;  5HYD A;  2QAC A;  1XFU O;  1YTZ C;  1HT9 A;  3O2P A;  2VRG A;  4I5N B;  2KNE A;  3CWG A;  1CMG A;  1KFX S;  4PE0 A;  1SRA A;  4GPL B;  3SIB A;  1Y0V H;  1CDM A;  1R6P A;  3GK4 X;  1QLS A;  4ORA B;  3CGA A;  3IQQ A;  1ZFS A;  3OB2 B;  4A4B A;  1DJW A;  1C7W A;  2JWW A;  1OQP A;  2K2F A;  1DJY A;  2LVI A;  2WOR A;  2AMI A;  3O4Y A;  4CID A;  1FI5 A;  1FBV A;  1MF8 B;  2K8M B;  1K96 A;  1K2H A;  1IRJ A;  1OMV A;  3BQ3 A;  3JVT C;  1GGZ A;  4MRX A;  4D1E A;  5HKY A;  4OV2 A;  2KBM A;  3BUX B;  2IS9 A;  2E30 A;  2JXC A;  2L4H A;  1N2D A;  2BL0 B;  2Q91 A;  1M31 A;  3NSK A;  4NQG A;  5CPV A;  1QVI Z;  1WDC B;  4N5X A;  2BCX A;  3TUY C;  1B1G A;  1GJY A;  1S6I A;  1KK7 Z;  1Y1A A;  3A4U B; 
#chains in the Genus database with same CATH topology
 1NIW A;  1RFJ A;  2LV7 A;  2L50 A;  4F0Z B;  2KFH A;  1W7I B;  5G08 A;  3NHI A;  2LC5 A;  1TNW A;  3QME A;  1DEL A;  2K61 A;  2LMU A;  1DT7 B;  1N65 A;  1NX0 A;  3EVV A;  1J7R A;  2B1U A;  4XJK B;  3WNX B;  1H4B A;  4A4C A;  4L9M A;  3F45 A;  2F8P A;  1YX8 A;  5FI7 A;  3VRN A;  3VRP A;  4YGB B;  1CMF A;  1S3P A;  3S0D A;  2MLF C;  4YBH B;  1SBJ A;  1K95 A;  5DIC A;  1K9U A;  1C3Y A;  2JUL A;  2LVV A;  3L4A A;  1DF0 A;  4MN0 A;  1XK4 C;  1BU3 A;  2PAL A;  2LCP A;  2ZN8 A;  3OX5 A;  3M0W A;  1XYD A;  1C7V A;  5I2O A;  2FOT A;  4QJ4 B;  5ER4 X;  5I8N A;  2F3Y A;  2KBI A;  1LA0 A;  3AKB A;  3EVU A;  3QRX A;  1F55 A;  1CDN A;  1LKJ A;  1TCF A;  5AAN A;  3CR5 X;  3HX4 A;  2KGB C;  4NDD A;  3ZNI A;  3MSE B;  1CFC A;  2JNF A;  2O5G A;  4MZJ A;  4MZL A;  1XK4 A;  2BCA A;  4YGE B;  2F3Z A;  1MXL C;  3JTD C;  3DZT A;  1JC2 A;  4BY4 A;  2M7L A;  2K7B A;  3DXL A;  1KK7 Y;  3HCM A;  1ZOT B;  4N1G A;  2YGU A;  4E68 A;  4HSZ A;  3VGO A;  3NSL A;  4ORB B;  2QEH A;  4MBE A;  2KAY A;  2ZND A;  3AAK A;  1BF5 A;  1MHO A;  1TTX A;  1J1E A;  2K2A A;  3PAL A;  1F71 A;  2MRD A;  2Y1M A;  4YGC B;  1RRO A;  2BE6 A;  1FPW A;  3LLE A;  1Y1X A;  4WRI A;  2EC6 C;  2BE4 A;  1V1F A;  1OOH A;  2HET A;  1ORG A;  3TS5 C;  2ZNE A;  3D0Y A;  4WQ3 A;  1A75 B;  1SPY A;  2CTN A;  1UHI A;  1GM0 A;  3PJI A;  3NGV A;  1WLM A;  5HLV A;  1KQV A;  3WXA A;  3KF9 A;  1DJI A;  1TUJ A;  2M8U A;  5KU1 A;  2Y4Q A;  3E3R A;  3SG7 A;  1CM4 A;  1SK6 D;  2MA2 A;  2QEB A;  1LXF C;  2QPT A;  3TDI A;  4FTG A;  4NDB A;  3H4S E;  1DGU A;  2HQ8 A;  1CLM A;  1J1D A;  1NUB A;  2L2C A;  3R1V A;  1J7O A;  1H8B A;  3DF0 B;  2JOJ A;  1F4O A;  1KFU S;  2KLE A;  3O6B A;  2K0J A;  2PMY A;  2LP3 A;  2L0P A;  1IG5 A;  4OZD A;  3I5F B;  1MWN A;  3BXK A;  3B7A A;  3D75 A;  1S6C A;  3I5I B;  4I5K A;  1CFP A;  1JWD A;  3JVT B;  2P71 A;  1SKT A;  1DJH A;  1TRF A;  2CXJ A;  1FI6 A;  1FF1 A;  1B8L A;  1W7J B;  1V1G A;  3CTN A;  3EKJ A;  4PHM A;  1OOG A;  3RZS A;  1TNP A;  2M1K B;  3CZ1 A;  1TNX A;  1TUZ A;  5HLO A;  3NHT A;  3TUY B;  1BG1 A;  2L5Y A;  2P6B B;  1PVB A;  1L2O C;  3BFH A;  2F2P A;  3SG2 A;  2M1U A;  3NSO A;  5AEQ A;  1VRK A;  3BFA A;  1NX2 A;  3PM2 A;  2HQW A;  5KSZ A;  1BOC A;  1DEK A;  1OZO A;  4INW A;  4CFQ A;  1C3Z A;  3DD4 A;  1K93 D;  1EH2 A;  1XO5 A;  3OHM B;  1KFX L;  4YI9 A;  2LM5 A;  2GV5 A;  3VRR A;  1IGV A;  3FE8 A;  3D78 A;  1CB1 A;  2KYF A;  1TNQ A;  3S0B A;  1KCY A;  1ZUZ A;  2MBX A;  2LHL A;  2PYQ A;  1LIN A;  1G8I A;  5CSJ A;  3VRO A;  3WHT B;  1PK0 D;  3EG5 B;  1RTP 1;  1B47 A;  1KWO C;  2JPT A;  2NCP A;  4P5O E;  3S0E A;  4AQI A;  4PE7 A;  3SS4 A;  1KQM C;  4DIR A;  1OW4 A;  1JF2 A;  3PN7 C;  3PFV A;  1PVA A;  3V2L A;  1OE9 B;  4DS7 A;  3EK7 A;  1DTL A;  1QX7 A;  1S26 D;  1SY9 A;  1YUT A;  2MHH A;  4C0K A;  1IQ3 A;  1OMR A;  2PRU A;  3D73 A;  1NCY A;  3CYZ A;  5DKN A;  3R72 A;  5ER5 A;  4HRG A;  3NSI A;  1IKU A;  5GQQ C;  3BUO B;  1MR8 A;  3SJS A;  2OS8 B;  2KI6 D;  4FQT A;  1JFK A;  2O60 A;  3PSR A;  5BPJ A;  1SCM B;  2G2B A;  2JC2 A;  4C0J A;  4OR9 B;  1PSR A;  2M97 A;  1DF0 B;  3FWB A;  1CLL A;  2BCB A;  3OBV A;  3R1P A;  3S0F A;  2WC5 A;  4M2P A;  5HKZ A;  1Z4H A;  2H61 A;  2KYC A;  4GAO A;  4CLN A;  1QAS A;  1F70 A;  3DVE A;  2WCE A;  5J3X A;  2NCO A;  1YRT B;  1SL7 A;  3SG6 A;  4IJ7 A;  1PRW A;  3CR2 A;  2JQ6 A;  3RLZ A;  3B87 A;  2FCD A;  1TCO B;  5I2Q A;  1B8R A;  3FIA A;  2FCE A;  3ICB A;  4OVN F;  4XJK A;  4MLW A;  2EC6 B;  4QJ5 B;  2ZFD A;  1G33 A;  2ZN9 A;  1WRZ A;  4INX A;  2SCP A;  2V53 A;  3TS5 B;  3DVM A;  4F7F A;  2JTZ A;  2KOT A;  1WDC C;  3O78 A;  3IVT A;  2WCF A;  2K60 A;  3BFB A;  1SMG A;  3OP0 A;  5D3O A;  2H61 C;  1REC A;  1D1O A;  1SYM A;  1QX2 A;  1AK8 A;  1XFZ O;  1XVJ A;  2CCM A;  1UHK A;  2M7N A;  1OOI X;  3IF7 A;  4U8D A;  5I2L A;  2E6W A;  4FQO A;  1HQV A;  2KDH A;  2LP2 A;  2JT0 A;  1TN4 A;  2F33 A;  4TNC A;  1ALV A;  1PAL A;  3I5H B;  3BJH A;  3S0A A;  1A4P A;  4PAL A;  1XFY O;  3VRQ A;  1XA5 A;  3DVJ A;  2K7D A;  4CFR A;  3DY9 A;  3FS7 A;  2WCB A;  2NZ0 A;  4UPG A;  1B7T Z;  1DMO A;  2EGD A;  1BT6 A;  2LLU A;  1OOF A;  2KI4 B;  4GFT A;  4PE1 A;  5I94 A;  1LA3 A;  2COL B;  2M29 A;  3BOW A;  4NDC A;  4PHJ A;  2JZI A;  2OTG C;  1U5I A;  2I2R E;  3R1O A;  4N1F A;  2PQL A;  4MEW A;  2LAP A;  2KHN A;  1K94 A;  1QJT A;  1SR6 B;  3WHU B;  3I5G B;  1A03 A;  2PVB A;  4I5L B;  5EL2 A;  1QV1 A;  1EL4 A;  2HF5 A;  2I18 A;  1KK8 C;  2PSR A;  3FE9 A;  2JT3 A;  4DRW A;  3FE6 A;  1L2O B;  2LMV A;  2H8V A;  3BYA A;  4YGA A;  4PCW A;  3D74 A;  1DGV A;  4ICB A;  1ZAC A;  1IH0 A;  1B8C A;  1YRU B;  1IQ5 A;  2KQY A;  1EJ3 A;  3CZT X;  1SNL A;  1QIV A;  2KQ6 A;  1GQM A;  3DVK A;  1WRL A;  1QIW A;  1CDL A;  2K7C A;  3AKA A;  4JD9 A;  1NP8 A;  1DJG A;  1KFU L;  1Q80 A;  1DJZ A;  1AVS A;  2KI6 C;  1PUL A;  2KSP A;  2LUX A;  3SS3 A;  1K9K A;  5AXI A;  2JU0 A;  2LMT A;  4PDZ A;  1SL8 A;  4JKT A;  4PHN A;  1KWO B;  3DYE A;  4MSP A;  3UNW A;  3AAJ A;  1LS8 A;  3PLF B;  5CSF A;  4C0L A;  3CR4 X;  2M9G A;  1YUS A;  4I5J A;  3PN7 B;  1B7T Y;  2BBM A;  3OB1 B;  4PE4 A;  2M49 B;  1TIZ A;  3DF0 A;  1YVL A;  1CM1 A;  1DVI A;  1EG4 A;  1AJ4 A;  2LHI A;  3GK2 A;  4GGF A;  1DQE A;  2WCK A;  3CDN A;  3K1E A;  4MRY A;  4MZK A;  1A29 A;  2LVK A;  4JQ0 D;  1BR4 B;  2JRF A;  5JJG A;  1OMD A;  2LUC A;  1UWO A;  3L4L A;  1EG3 A;  4CPV A;  3B6X A;  1IJ6 A;  5HKW A;  4BY5 A;  1Y1U A;  1AUI B;  2L4I A;  3A8R A;  4DUQ A;  3SG5 A;  3CLN A;  1CNP A;  1IJ5 A;  1W9Z A;  1DJX A;  1QV0 A;  4WQ2 A;  4AOM A;  2KGR A;  2M0R A;  1NPQ A;  1WRK A;  1G4Y R;  1KSO A;  5CSI A;  2MLE C;  1BJF A;  5FYX A;  2P70 A;  4GGF C;  2JPO A;  5DKR A;  3I5F C;  2L98 A;  4XYN A;  3TDU A;  5JOL A;  1UP5 A;  3I5I C;  1JBA A;  3C1V A;  1MQ1 A;  5HL1 A;  2BNX A;  2LNK A;  1YR5 A;  2NLN A;  1N0Y A;  4ETO A;  1OSA A;  4USL A;  1S5G Z;  1QLK A;  1SW8 A;  3JTD B;  4HRH A;  1OZS A;  5F6T A;  1S36 A;  2KAX A;  1QS7 A;  2ISD A;  5KTY A;  2AUC A;  1YUR A;  3B88 A;  3IQO A;  4M2Q A;  1QWV A;  1FW4 A;  2LLT A;  1TWO A;  3L47 A;  1SCV A;  1JFJ A;  3SS5 A;  1TOP A;  1S1E A;  2CT9 A;  2JNX A;  1R2U A;  1JUO A;  1UUS A;  2LVJ A;  2ZRT A;  4QJ3 B;  3CZ0 A;  3VB1 A;  1MUX A;  3FWC A;  4DCK A;  5K89 A;  3BUW B;  4YRU A;  1IIO A;  2JT8 A;  1CTR A;  3CS1 A;  2F2O A;  3CAB A;  2KFF A;  1M39 A;  1UHH A;  2KFG A;  4IL1 A;  3D76 A;  4YI8 A;  2L2E A;  1SL9 A;  3S0G A;  1OOJ A;  1X02 A;  4P2Y B;  1AP4 A;  2BL0 C;  3PAT A;  4OKH A;  5D69 A;  3LL8 B;  2G9B A;  2ZKM X;  1A2X A;  1XFX O;  4MVF A;  1JSA A;  5CSN A;  3TZ1 A;  2MAZ A;  2LE9 B;  1XFR A;  3EKH A;  2JXL A;  2ZRS A;  2OTG B;  1C07 A;  1K90 D;  2WOS A;  2L51 A;  4YGD B;  3KPX A;  1YUU A;  1GGW A;  2AAO A;  3ZWH A;  2BKH B;  2Q4U A;  1QAT A;  3GOF A;  3SG3 A;  1KK8 B;  2M3W A;  3PM8 A;  1BLQ A;  2OS8 C;  1J7P A;  1NCZ A;  1S5G Y;  1UHJ A;  2Y1N A;  1M45 A;  4GBA A;  2L5X B;  1NX1 A;  4JPZ B;  1SCM C;  3D0Y B;  2MJW B;  2LAN A;  1QVI Y;  3Q8I A;  1NWD A;  3OX6 A;  4ZCV A;  3KHE A;  1CFD A;  1F4Q A;  2ERB A;  3K21 A;  1QX5 B;  1S6J A;  2BEC A;  1BOD A;  1NCX A;  5PAL A;  1Y6W A;  1DC1 A;  1M46 A;  2GGZ A;  2H2K A;  3BOW B;  4Q04 A;  1CKK A;  1YX7 A;  1NYA A;  2I94 A;  5IBW A;  2CBL A;  3LK0 A;  1U5I B;  1WY9 A;  2QEO A;  4R1E A;  1CFF A;  3D10 A;  3CZ2 A;  1UHN A;  2WC6 A;  1F54 A;  1ZMZ A;  1RJV A;  2GGM A;  4GGN A;  1B9A A;  1NSH A;  2K7O A;  1CLB A;  1M63 B;  2R2I A;  2HPS A;  5AER A;  2BBN A;  1RWY A;  3NXA A;  3LCP C;  1BR1 B;  3O4X A;  2OPO A;  1P28 A;  2WCM A;  4PT1 A;  5FI6 A;  3SG4 A;  3EVR A;  1Z2C B;  3N7H A;  4HRE E;  4GNK B;  1ALW A;  1A75 A;  2RGI A;  3RM1 A;  1E8A A;  2JTT A;  1QXP A;  1UUR A;  2WCL A;  3SIA A;  1MXE A;  5FI2 A;  1AJ5 A;  1WLZ A;  3BUM B;  2PAS A;  1JF0 A;  2Y5I A;  1NX3 A;  1YVH A;  1K9P A;  2KAV A;  3UO9 A;  1K8U A;  1BMO A;  4GUK A;  4KYN A;  3GK1 A;  4PHK A;  2WND A;  1QTX A;  4JWQ A;  1T14 A;  2EHB A;  1F8H A;  5D7F A;  3LK1 A;  1J7Q A;  1AHR A;  1PSB A;  2BKI B;  1LVC D;  4OCI A;  2BAP A;  2WC8 A;  3B86 A;  3I5H C;  2QEV A;  2LLS A;  5DKQ A;  2QDI A;  1KQM B;  2GTE A;  1XFW O;  4ZCU A;  2CNP A;  2I7A A;  2KLD A;  5B8I B;  1B4C A;  2WCH A;  1CDP A;  2D8N A;  2DOQ A;  2TN4 A;  5AFP A;  5TNC A;  3KO0 A;  2NXQ A;  2KI4 C;  3BUN B;  2SAS A;  3EK4 A;  1KSM A;  3KEV A;  4ORC B;  1IWQ A;  4AQJ A;  4M2O A;  3OGN A;  2A4J A;  1L7Z A;  2FJU B;  3EK8 A;  3TDZ A;  1EXR A;  1ODB A;  1XFV O;  1J55 A;  1SR6 C;  1RK9 A;  3I5G C;  5HYD A;  2KPH A;  2QAC A;  1XFU O;  1YTZ C;  1HT9 A;  3O2P A;  2WCJ A;  2VRG A;  4I5N B;  2KNE A;  3CWG A;  1CMG A;  1KFX S;  4PE0 A;  1SRA A;  4GPL B;  3SIB A;  1Y0V H;  1CDM A;  1R6P A;  3GK4 X;  1QLS A;  4ORA B;  3CGA A;  3IQQ A;  1ZFS A;  3OB2 B;  4A4B A;  1DJW A;  1C7W A;  1SSE B;  1OQP A;  2JWW A;  1DJY A;  2K2F A;  2LVI A;  2AMI A;  2WOR A;  3D77 A;  3O4Y A;  4CID A;  1FI5 A;  1FBV A;  1MF8 B;  2K8M B;  1K96 A;  1K2H A;  1IRJ A;  1OMV A;  3BQ3 A;  3JVT C;  1GGZ A;  4MRX A;  4D1E A;  5HKY A;  4OV2 A;  2KBM A;  3BUX B;  2IS9 A;  2E30 A;  2JXC A;  2L4H A;  1N2D A;  2BL0 B;  2Q91 A;  1M31 A;  3NSK A;  2FJY A;  4NQG A;  5CPV A;  1QVI Z;  1WDC B;  4N5X A;  2BCX A;  3TUY C;  1B1G A;  1GJY A;  1S6I A;  1KK7 Z;  1Y1A A;  3A4U B; 
#chains in the Genus database with same CATH homology
 1NIW A;  1RFJ A;  2LV7 A;  2L50 A;  4F0Z B;  2KFH A;  1W7I B;  5G08 A;  2LC5 A;  1TNW A;  2K61 A;  2LMU A;  1DT7 B;  1N65 A;  1NX0 A;  3EVV A;  1J7R A;  2B1U A;  4XJK B;  3WNX B;  1H4B A;  4A4C A;  4L9M A;  3F45 A;  2F8P A;  1YX8 A;  3VRN A;  3VRP A;  4YGB B;  1CMF A;  1S3P A;  2MLF C;  4YBH B;  1SBJ A;  1K95 A;  1K9U A;  2JUL A;  2LVV A;  4MN0 A;  1DF0 A;  1XK4 C;  1BU3 A;  2PAL A;  2LCP A;  2ZN8 A;  3OX5 A;  3M0W A;  1XYD A;  1C7V A;  5I2O A;  2FOT A;  4QJ4 B;  5ER4 X;  5I8N A;  2F3Y A;  2KBI A;  1LA0 A;  3AKB A;  3EVU A;  3QRX A;  1F55 A;  1CDN A;  1LKJ A;  1TCF A;  5AAN A;  3CR5 X;  3HX4 A;  2KGB C;  4NDD A;  3ZNI A;  3MSE B;  1CFC A;  2JNF A;  2O5G A;  4MZJ A;  4MZL A;  1XK4 A;  2BCA A;  4YGE B;  2F3Z A;  1MXL C;  3JTD C;  1JC2 A;  4BY4 A;  2M7L A;  2K7B A;  1KK7 Y;  3HCM A;  1ZOT B;  4N1G A;  4E68 A;  4HSZ A;  3VGO A;  3NSL A;  4ORB B;  4MBE A;  2KAY A;  2ZND A;  3AAK A;  1BF5 A;  1MHO A;  1TTX A;  1J1E A;  2K2A A;  3PAL A;  1F71 A;  2MRD A;  2Y1M A;  4YGC B;  1RRO A;  2BE6 A;  1FPW A;  3LLE A;  1Y1X A;  4WRI A;  2EC6 C;  2BE4 A;  1V1F A;  2HET A;  3TS5 C;  2ZNE A;  3D0Y A;  4WQ3 A;  1A75 B;  1SPY A;  2CTN A;  1UHI A;  1WLM A;  5HLV A;  1KQV A;  3WXA A;  3KF9 A;  1DJI A;  2M8U A;  5KU1 A;  2Y4Q A;  3E3R A;  3SG7 A;  1CM4 A;  1SK6 D;  2MA2 A;  1LXF C;  2QPT A;  3TDI A;  4FTG A;  4NDB A;  3H4S E;  1DGU A;  2HQ8 A;  1CLM A;  1J1D A;  1NUB A;  1J7O A;  1H8B A;  3DF0 B;  2JOJ A;  1F4O A;  1KFU S;  3O6B A;  2K0J A;  2PMY A;  2LP3 A;  2L0P A;  1IG5 A;  3I5F B;  1MWN A;  3BXK A;  4I5K A;  1S6C A;  3I5I B;  1CFP A;  1JWD A;  3JVT B;  1SKT A;  1DJH A;  1TRF A;  2CXJ A;  1FI6 A;  1FF1 A;  1B8L A;  1W7J B;  1V1G A;  3CTN A;  3EKJ A;  4PHM A;  1TNP A;  2M1K B;  5HLO A;  1TNX A;  3TUY B;  1BG1 A;  2P6B B;  1PVB A;  1L2O C;  2F2P A;  3SG2 A;  2M1U A;  3NSO A;  5AEQ A;  1VRK A;  5KSZ A;  1NX2 A;  2HQW A;  1BOC A;  1OZO A;  4CFQ A;  3DD4 A;  1EH2 A;  1K93 D;  1XO5 A;  3OHM B;  1KFX L;  4YI9 A;  2LM5 A;  2GV5 A;  3VRR A;  1IGV A;  1CB1 A;  1KCY A;  2KYF A;  1TNQ A;  1ZUZ A;  2MBX A;  2LHL A;  1LIN A;  1G8I A;  5CSJ A;  3VRO A;  3WHT B;  1PK0 D;  1RTP 1;  1B47 A;  1KWO C;  2JPT A;  2NCP A;  4P5O E;  4AQI A;  4PE7 A;  1KQM C;  4DIR A;  1JF2 A;  3PN7 C;  3PFV A;  1PVA A;  1OE9 B;  4DS7 A;  3EK7 A;  1DTL A;  1QX7 A;  1S26 D;  1SY9 A;  1YUT A;  2MHH A;  4C0K A;  1IQ3 A;  1OMR A;  2PRU A;  1NCY A;  5DKN A;  5ER5 A;  4HRG A;  3NSI A;  1IKU A;  5GQQ C;  3BUO B;  1MR8 A;  3SJS A;  2OS8 B;  2KI6 D;  1JFK A;  2O60 A;  3PSR A;  5BPJ A;  1SCM B;  2G2B A;  2JC2 A;  4C0J A;  4OR9 B;  1PSR A;  2M97 A;  1DF0 B;  3FWB A;  1CLL A;  2BCB A;  4M2P A;  5HKZ A;  2H61 A;  2KYC A;  4GAO A;  4CLN A;  1QAS A;  1F70 A;  3DVE A;  2WCE A;  5J3X A;  2NCO A;  1YRT B;  1SL7 A;  3SG6 A;  1PRW A;  3CR2 A;  2JQ6 A;  3RLZ A;  5I2Q A;  2FCD A;  1TCO B;  1B8R A;  3FIA A;  2FCE A;  3ICB A;  4OVN F;  4XJK A;  4MLW A;  2EC6 B;  4QJ5 B;  2ZFD A;  1G33 A;  2ZN9 A;  1WRZ A;  2SCP A;  2V53 A;  3TS5 B;  3DVM A;  2JTZ A;  2KOT A;  1WDC C;  3O78 A;  2WCF A;  3OP0 A;  1SMG A;  2H61 C;  1REC A;  1D1O A;  1SYM A;  1QX2 A;  1AK8 A;  1XFZ O;  1XVJ A;  2CCM A;  1UHK A;  2M7N A;  3IF7 A;  4U8D A;  5I2L A;  2E6W A;  4FQO A;  1HQV A;  2KDH A;  2LP2 A;  2JT0 A;  1TN4 A;  2F33 A;  4TNC A;  1ALV A;  1PAL A;  3I5H B;  1A4P A;  4PAL A;  1XFY O;  3VRQ A;  1XA5 A;  3DVJ A;  2K7D A;  4CFR A;  3FS7 A;  2WCB A;  2NZ0 A;  4UPG A;  1B7T Z;  1DMO A;  2EGD A;  1BT6 A;  2LLU A;  2KI4 B;  4GFT A;  4PE1 A;  1LA3 A;  2COL B;  2M29 A;  3BOW A;  4NDC A;  4PHJ A;  2JZI A;  2OTG C;  1U5I A;  2I2R E;  4N1F A;  4MEW A;  2LAP A;  2KHN A;  1K94 A;  1QJT A;  1SR6 B;  3WHU B;  3I5G B;  1A03 A;  2PVB A;  4I5L B;  1QV1 A;  1EL4 A;  2HF5 A;  2I18 A;  1KK8 C;  2PSR A;  2JT3 A;  4DRW A;  4YGA A;  1L2O B;  2LMV A;  3BYA A;  4PCW A;  1DGV A;  4ICB A;  1ZAC A;  1IH0 A;  1B8C A;  1YRU B;  1IQ5 A;  2KQY A;  1EJ3 A;  3CZT X;  1SNL A;  1QIV A;  2KQ6 A;  1GQM A;  3DVK A;  1WRL A;  1QIW A;  1CDL A;  2K7C A;  3AKA A;  1NP8 A;  1DJG A;  1KFU L;  1Q80 A;  1DJZ A;  1AVS A;  2KI6 C;  1PUL A;  2KSP A;  2LUX A;  1K9K A;  5AXI A;  2JU0 A;  2LMT A;  4PDZ A;  1SL8 A;  4PHN A;  1KWO B;  4MSP A;  3AAJ A;  3PLF B;  5CSF A;  4C0L A;  3CR4 X;  2M9G A;  1YUS A;  4I5J A;  3PN7 B;  1B7T Y;  2BBM A;  3OB1 B;  4PE4 A;  2M49 B;  1TIZ A;  3DF0 A;  1YVL A;  1CM1 A;  1DVI A;  1EG4 A;  1AJ4 A;  2LHI A;  3GK2 A;  4GGF A;  4MRY A;  4MZK A;  1A29 A;  2LVK A;  4JQ0 D;  1BR4 B;  2JRF A;  5JJG A;  1OMD A;  2LUC A;  1UWO A;  1EG3 A;  4CPV A;  4BY5 A;  1IJ6 A;  5HKW A;  1Y1U A;  1AUI B;  2L4I A;  3A8R A;  4DUQ A;  3SG5 A;  3CLN A;  1CNP A;  1IJ5 A;  1DJX A;  1QV0 A;  4WQ2 A;  4AOM A;  2KGR A;  2M0R A;  1NPQ A;  1WRK A;  1G4Y R;  1KSO A;  5CSI A;  2MLE C;  1BJF A;  5FYX A;  4GGF C;  5DKR A;  3I5F C;  2L98 A;  4XYN A;  3TDU A;  5JOL A;  1UP5 A;  3I5I C;  1JBA A;  3C1V A;  1MQ1 A;  2LNK A;  1YR5 A;  2NLN A;  1N0Y A;  4ETO A;  1OSA A;  4USL A;  1S5G Z;  1QLK A;  1SW8 A;  3JTD B;  4HRH A;  1OZS A;  5F6T A;  1S36 A;  2KAX A;  1QS7 A;  2ISD A;  5KTY A;  2AUC A;  1YUR A;  3IQO A;  4M2Q A;  1FW4 A;  2LLT A;  1SCV A;  1JFJ A;  1TOP A;  1S1E A;  2CT9 A;  2JNX A;  1R2U A;  1JUO A;  1UUS A;  2LVJ A;  2ZRT A;  4QJ3 B;  4DCK A;  1MUX A;  3FWC A;  5K89 A;  3BUW B;  4YRU A;  2JT8 A;  1CTR A;  3CS1 A;  2F2O A;  2KFF A;  1M39 A;  1UHH A;  2KFG A;  4IL1 A;  4YI8 A;  2L2E A;  1SL9 A;  1OOJ A;  1X02 A;  4P2Y B;  1AP4 A;  2BL0 C;  3PAT A;  4OKH A;  5D69 A;  3LL8 B;  2G9B A;  2ZKM X;  1A2X A;  1XFX O;  4MVF A;  1JSA A;  5CSN A;  3TZ1 A;  2MAZ A;  2LE9 B;  3EKH A;  2JXL A;  2ZRS A;  2OTG B;  1C07 A;  1K90 D;  2WOS A;  2L51 A;  4YGD B;  3KPX A;  1YUU A;  1GGW A;  2AAO A;  3ZWH A;  2BKH B;  2Q4U A;  1QAT A;  3GOF A;  3SG3 A;  1KK8 B;  2M3W A;  3PM8 A;  1BLQ A;  2OS8 C;  1J7P A;  1NCZ A;  1S5G Y;  1UHJ A;  2Y1N A;  1M45 A;  4GBA A;  2L5X B;  1NX1 A;  4JPZ B;  1SCM C;  3D0Y B;  2MJW B;  2LAN A;  1QVI Y;  1NWD A;  3OX6 A;  4ZCV A;  3KHE A;  1CFD A;  1F4Q A;  3K21 A;  1QX5 B;  1S6J A;  2BEC A;  1BOD A;  1NCX A;  5PAL A;  1Y6W A;  1M46 A;  2GGZ A;  2H2K A;  3BOW B;  4Q04 A;  1CKK A;  1YX7 A;  1NYA A;  2I94 A;  5IBW A;  2CBL A;  3LK0 A;  1U5I B;  1WY9 A;  4R1E A;  1CFF A;  3D10 A;  1UHN A;  1F54 A;  1ZMZ A;  1RJV A;  2GGM A;  4GGN A;  1B9A A;  1NSH A;  2K7O A;  1CLB A;  1M63 B;  2R2I A;  2HPS A;  5AER A;  2BBN A;  1RWY A;  3NXA A;  3LCP C;  1BR1 B;  2OPO A;  3SG4 A;  3EVR A;  4HRE E;  4GNK B;  1ALW A;  1A75 A;  2RGI A;  3RM1 A;  1E8A A;  2JTT A;  1QXP A;  1UUR A;  3SIA A;  1MXE A;  1AJ5 A;  1WLZ A;  3BUM B;  2PAS A;  1JF0 A;  2Y5I A;  1NX3 A;  1YVH A;  1K9P A;  2KAV A;  1K8U A;  1BMO A;  4GUK A;  3GK1 A;  4PHK A;  2WND A;  1QTX A;  4JWQ A;  1F8H A;  2EHB A;  5D7F A;  3LK1 A;  1J7Q A;  1AHR A;  1PSB A;  2BKI B;  1LVC D;  4OCI A;  3I5H C;  2WC8 A;  2LLS A;  5DKQ A;  1KQM B;  1XFW O;  4ZCU A;  2CNP A;  2I7A A;  5B8I B;  1B4C A;  1CDP A;  2D8N A;  2DOQ A;  2TN4 A;  5AFP A;  5TNC A;  3KO0 A;  2NXQ A;  2KI4 C;  3BUN B;  2SAS A;  3EK4 A;  1KSM A;  3KEV A;  4ORC B;  1IWQ A;  4AQJ A;  4M2O A;  2A4J A;  1L7Z A;  2FJU B;  3EK8 A;  3TDZ A;  1EXR A;  1ODB A;  1XFV O;  1J55 A;  1SR6 C;  1RK9 A;  3I5G C;  5HYD A;  2QAC A;  1XFU O;  1YTZ C;  1HT9 A;  3O2P A;  2VRG A;  4I5N B;  2KNE A;  3CWG A;  1CMG A;  1KFX S;  4PE0 A;  1SRA A;  4GPL B;  3SIB A;  1Y0V H;  1CDM A;  1R6P A;  3GK4 X;  1QLS A;  4ORA B;  3CGA A;  3IQQ A;  1ZFS A;  3OB2 B;  4A4B A;  1DJW A;  1C7W A;  2JWW A;  1OQP A;  2K2F A;  1DJY A;  2LVI A;  2WOR A;  2AMI A;  3O4Y A;  4CID A;  1FI5 A;  1FBV A;  1MF8 B;  2K8M B;  1K96 A;  1K2H A;  1IRJ A;  1OMV A;  3BQ3 A;  3JVT C;  1GGZ A;  4MRX A;  4D1E A;  5HKY A;  4OV2 A;  2KBM A;  3BUX B;  2IS9 A;  2E30 A;  2JXC A;  2L4H A;  1N2D A;  2BL0 B;  2Q91 A;  1M31 A;  3NSK A;  4NQG A;  5CPV A;  1QVI Z;  1WDC B;  4N5X A;  2BCX A;  3TUY C;  1B1G A;  1GJY A;  1S6I A;  1KK7 Z;  1Y1A A;  3A4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...