1H8BA

Ef-hands 3,4 from alpha-actinin / z-repeat 7 from titin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
MADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ALPHA-ACTININ 2, SKELETAL MUSCLE ISOFORM
publication title Ca2+-Independent Binding of an EF-Hand Domain to a Novel Motif in the Alpha-Actinin-Titin Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1h8bA00
1CDPA 3TDZA 3KEVA 2VRGA 1YUUA 3PSRA 1IKUA 4L9MA 4ORAB 1CDMA 1XFUO 3PN7C 1IGVA 2CTNA 3PFVA 5TNCA 3IQQA 3KF9A 3SG5A 1DJZA 1ZACA 1E8AA 3AKBA 1RECA 4OR9B 1NWDA 4HRGA 2NCOA 3I5GC 1FW4A 1LA3A 2GGMA 1IJ5A 1C7VA 1RFJA 1Y0VH 3D0YA 3PM8A 1CMGA 1EG3A 1FBVA 1KQMB 3C1VA 2Y1NA 5JOLA 1QVIZ 2WORA 1MWNA 4DCKA 5CSJA 2HQWA 1SBJA 4QJ3B 1K9KA 1N0YA 1UHKA 1CFCA 4AQJA 4CIDA 2L5XB 1CLLA 1LKJA 2L98A 1KFXL 1NPQA 2EC6B 3D10A 2RGIA 3NSIA 4JQ0D 2EC6C 1SCVA 1SYMA 1YRUB 2PVBA 2MRDA 1C07A 1SKTA 2LMUA 5BPJA 1CFFA 3VRNA 1BLQA 1WDCB 1U5IB 4GBAA 1WDCC 3OP0A 2H61A 5K89A 3OB2B 3I5HC 1A4PA 1QJTA 4NQGA 1JBAA 4YGDB 1SNLA 2HF5A 2OTGC 4I5NB 4OKHA 3M0WA 2L4HA 1BG1A 1BF5A 1NX3A 1RJVA 4I5LB 5PALA 1OZOA 1W7JB 1K9PA 4ORBB 5G08A 1TNXA 3EVUA 2PASA 1L7ZA 2KHNA 4GPLB 4M2QA 4MRYA 1EG4A 3RLZA 4MEWA 1MUXA 3O2PA 4NDDA 2WCFA 4OV2A 1OMRA 4I5KA 1FI6A 2KFFA 2BL0B 2ZN8A 1NCYA 2ZRTA 3SG3A 3JVTC 1GGWA 1ZUZA 2ZN9A 2H2KA 1NYAA 2Y5IA 3D0YB 3TDUA 2K8MB 2M1KB 1K90D 1SL7A 4XJKB 3DVEA 5DKNA 1CLBA 1BT6A 3MSEB 3SG2A 1R2UA 3VROA 1OE9B 1KFXS 4PE7A 1ALWA 2ZNDA 1F55A 5DKQA 2KI6D 1G4YR 2BCAA 1M46A 3ZWHA 2K0JA 1PSRA 2A4JA 4AOMA 3DF0A 1IQ5A 1SPYA 2JOJA 1LXFC 4BY5A 1BODA 3BUNB 4GFTA 3BUXB 2MAZA 4GGFA 1TOPA 3CR4X 1SCMB 1YX7A 1Y1UA 1TCOB 3AAJA 1PVAA 5B8IB 2CNPA 2MLEC 1KQVA 3CR2A 3VRQA 1PRWA 2BBNA 1DVIA 1UHJA 5CSIA 1RWYA 2FCEA 5HKZA 1OMDA 3CZTX 3FWBA 5KU1A 3DVMA 1HQVA 4GNKB 3OHMB 3ICBA 3ZNIA 1YVLA 4A4CA 5HKWA 1B7TY 5CPVA 3SIBA 2KQ6A 2OS8B 1OQPA 5HYDA 2Y4QA 1FPWA 1TRFA 1JC2A 5KTYA 1TTXA 3VRPA 3BQ3A 1KWOB 3EK7A 4U8DA 1OMVA 1NX2A 5F6TA 2F2OA 3I5FB 1SR6C 2JXCA 3I5IB 2M7LA 1UHHA 1A29A 3EVVA 3I5IC 2NXQA 1ALVA 1S5GY 2BKHB 1WRLA 2KI4B 2JNXA 1K94A 2M29A 5AERA 1DGUA 4PDZA 5I8NA 2I7AA 2K7BA 4GAOA 1J7QA 1EL4A 5D7FA 4CFQA 1ZFSA 1UURA 4D1EA 2K7OA 4M2OA 5CSNA 1S26D 3BYAA 1F4OA 1DJIA 1K95A 4DUQA 2MBXA 2LP2A 5I2QA 2AAOA 1B7TZ 1XFZO 2CBLA 1RK9A 2L4IA 3LK1A 1NUBA 4YRUA 1DT7B 1B4CA 1K9UA 2G9BA 1H8BA 4OCIA 1JWDA 4P5OE 4ZCVA 1NIWA 2KI6C 1HT9A 2JTZA 3LK0A 4FTGA 1TCFA 1YVHA 3KHEA 2F3YA 4MBEA 3O78A 2MJWB 2I94A 3OX5A 3CGAA 2Q91A 1B47A 1DJGA 1YTZC 1B8LA 4E68A 1R6PA 2LANA 3LCPC 4PALA 1KQMC 1CB1A 1NSHA 2I18A 2Y1MA 1BJFA 2SASA 4ZCUA 1UWOA 1TN4A 1JSAA 4PE4A 5AFPA 3OX6A 4YI8A 2BKIB 1J7PA 2PALA 4GGNA 1B1GA 3EK8A 5HLOA 3SG4A 3VRRA 4ETOA 4NDBA 2NCPA 4CPVA 1F4QA 3TS5B 2LE9B 3WHTB 1TNQA 1XVJA 1SL9A 2JU0A 3KO0A 4MLWA 5FYXA 2LVIA 1IH0A 4QJ5B 1M31A 2PRUA 2LNKA 2PSRA 2NZ0A 1IRJA 1XK4C 2AMIA 2ZNEA 3FS7A 4YBHB 4DS7A 1KSOA 1QIVA 2EGDA 2FOTA 4MVFA 1WLMA 1ZMZA 4A4BA 1EJ3A 3TDIA 1M45A 1LA0A 3GK2A 1D1OA 1JUOA 2JPTA 3IF7A 4MSPA 1A75A 2KFGA 2KDHA 2BL0C 1M39A 2R2IA 1S1EA 3BXKA 1UHNA 2LUCA 3DVKA 2ZFDA 4N1GA 3HX4A 3O6BA 3CS1A 1CDLA 3EKJA 2JT0A 2B1UA 4C0KA 3JTDB 4N5XA 3JTDC 3NXAA 2MA2A 3DVJA 1BOCA 1WRZA 4FQOA 1BU3A 1J7RA 2GGZA 2LP3A 4CLNA 1MXEA 2CT9A 1OSAA 1B8RA 4GUKA 3H4SE 4PHMA 4CFRA 1YURA 1GGZA 1L2OB 1AVSA 2LMVA 2FJUB 2I2RE 3A8RA 3CWGA 2M0RA 4YGBB 1SCMC 2F8PA 1KCYA 3AAKA 3NSLA 1F8HA 1PVBA 3RM1A 1V1GA 2H61C 4HSZA 1BR1B 4QJ4B 1NCXA 1FI5A 3BOWA 2CCMA 3LL8B 1YUSA 1PALA 1DJHA 2KYFA 1AJ4A 1WY9A 2COLB 1UHIA 2IS9A 2L0PA 2OS8C 1G8IA 1SW8A 4MZJA 1SL8A 1ODBA 1QATA 4WQ3A 3BUWB 2LUXA 2WOSA 5D69A 3SJSA 2JWWA 5I2LA 2E6WA 1KWOC 4PHNA 4TNCA 4Q04A 1A03A 2K61A 2NLNA 1DJXA 1A75B 3I5FC 1JFJA 1B9AA 4PCWA 3SG6A 2JRFA 5CSFA 5JJGA 5IBWA 1Y1AA 3O4YA 1QIWA 4C0JA 1GQMA 1M63B 4YGEB 5J3XA 1S3PA 2KI4C 1QX2A 1F71A 4PHKA 1VRKA 1MQ1A 1KK7Y 2JNFA 2KGBC 2JTTA 1C7WA 3GK1A 1K93D 1UP5A 1WRKA 1MXLC 4JPZB 1EXRA 1G33A 1FF1A 1JFKA 1B8CA 2ISDA 1SMGA 3DD4A 3DF0B 1K2HA 1UUSA 4DRWA 1S6CA 1N65A 1X02A 1XFYO 1TNPA 2KQYA 3HCMA 3TUYB 1ZOTB 3WXAA 1QS7A 1DGVA 4GGFC 2F33A 3SG7A 1XFXO 2LVKA 1AJ5A 2JC2A 1U5IA 4M2PA 2WNDA 3CLNA 1QV1A 5AEQA 2L51A 1RTP1 1XFVO 2LHIA 2WCEA 2LAPA 2TN4A 1S5GZ 3BOWB 1MR8A 4YGCB 1Y6WA 2KSPA 3VGOA 1DF0A 1LINA 3PN7B 1WLZA 1W7IB 2LHLA 1XA5A 4NDCA 1KK7Z 1V1FA 3EVRA 2JQ6A 4ICBA 3SIAA 5HLVA 3FWCA 2HPSA 2BCXA 4N1FA 4YI9A 2O60A 5KSZA 2JULA 1YX8A 4HRHA 2BBMA 2JZIA 4DIRA 3I5GB 5AXIA 1JF0A 4XYNA 2JT8A 2KNEA 2LM5A 2HQ8A 4F0ZB 5GQQC 1QASA 5ER5A 3PLFB 1PK0D 2WCBA 3TS5C 1QLSA 4I5JA 4AQIA 2QACA 4XJKA 1PULA 2G2BA 1CMFA 2JXLA 2LLUA 4OVNF 3LLEA 1MHOA 1IJ6A 3WHUB 1LVCD 2F3ZA 2AUCA 1CLMA 1AHRA 2LV7A 4BY4A 2KAVA 2HETA 1K8UA 2E30A 1F70A 1CFDA 2DOQA 2M8UA 3OB1B 3EKHA 1DMOA 5HKYA 1YRTB 1GJYA 3GK4X 3NSOA 1SY9A 2O5GA 2OPOA 3I5HB 2OTGB 4PHJA 3IQOA 1OZSA 2K2AA 2LLSA 1KFUL 1DF0B 3FIAA 1CM1A 1AK8A 1CNPA 1DTLA 2LCPA 4WQ2A 1SRAA 1QV0A 2BE4A 4P2YB 2KFHA 4C0LA 1OOJA 1IG5A 2MLFC 1DJYA 2P6BB 1H4BA 1Q80A 1QX5B 3EK4A 1N2DA 2LC5A 5DKRA 3JVTB 1NX0A 1NP8A 1CTRA 1L2OC 4UPGA 1EH2A 4HREE 2BECA 1JF2A 3E3RA 3F45A 1MF8B 1NX1A 1J1DA 1IWQA 1PSBA 2JT3A 2M1UA 2FCDA 3QRXA 1QX7A 4WRIA 1XO5A 1A2XA 4PE1A 1S6JA 2KYCA 2M3WA 3CR5X 2KGRA 3WNXB 2KOTA 1BMOA 2M97A 4IL1A 1QXPA 4MZLA 1QTXA 2KBMA 1F54A 2ZRSA 1KFUS 2LMTA 1S6IA 4USLA 2BE6A 1RROA 2CXJA 2F2PA 2ZKMX 3PATA 5AANA 1Y1XA 3BUOB 2SCPA 3PALA 2M49B 2K7CA 1NCZA 1IQ3A 4MRXA 2K7DA 3AKAA 1K96A 2QPTA 4JWQA 1CDNA 2M9GA 3KPXA 2LVVA 1J55A 2BCBA 1BR4B 1QLKA 1AUIB 4YGAA 1J7OA 1KK8B 4R1EA 1J1EA 5I2OA 1AP4A 4MN0A 1KK8C 2KBIA 2D8NA 2Q4UA 1TNWA 2K2FA 2KAXA 1SR6B 2WC8A 3NSKA 3BUMB 1CKKA 3TZ1A 1S36A 2GV5A 4MZKA 2LLTA 2LVJA 3CTNA 3A4UB 4PE0A 5ER4X 3TUYC 1YR5A 1CFPA 1DJWA 2EHBA 2PMYA 1XFWO 1YUTA 3GOFA 1TIZA 2L50A 1CM4A 1KSMA 1SK6D 2V53A 2M7NA 1XYDA 4ORCB 1QVIY 2KAYA 2L2EA 3K21A 1XK4A 2MHHA
chains in the Genus database with same CATH superfamily
1CDPA 3TDZA 2P70A 3S0AA 3KEVA 2VRGA 1YUUA 3PSRA 1IKUA 4L9MA 4ORAB 1CDMA 1XFUO 3PN7C 1IGVA 2CTNA 3PFVA 5TNCA 3BFBA 3N7HA 3R1PA 3IQQA 3KF9A 3OBVA 1GM0A 3SG5A 1DJZA 1ZACA 1E8AA 3AKBA 1RECA 4OR9B 1NWDA 4HRGA 2NCOA 3I5GC 1FW4A 1LA3A 2GGMA 1IJ5A 1C7VA 1RFJA 1OOHA 1Y0VH 3D0YA 3PM8A 3S0EA 2QEVA 1CMGA 1EG3A 3RZSA 1FBVA 1KQMB 3C1VA 2Y1NA 5JOLA 1QVIZ 2WORA 1MWNA 4DCKA 5CSJA 2HQWA 3D73A 1SBJA 3FE9A 4QJ3B 1K9KA 1N0YA 1UHKA 1CFCA 4AQJA 3CZ0A 4CIDA 2L5XB 1CLLA 1LKJA 2L98A 1KFXL 1NPQA 2EC6B 3D10A 3CYZA 2RGIA 3NSIA 4JQ0D 2EC6C 1SCVA 1SYMA 1YRUB 2PVBA 2MRDA 1C07A 1SKTA 2LMUA 3FE8A 5BPJA 3VRNA 1BLQA 1WDCB 1CFFA 1U5IB 4GBAA 1DC1A 1WDCC 3OP0A 2H61A 3CABA 5K89A 3OB2B 3I5HC 3D75A 2KLDA 1A4PA 1QJTA 4NQGA 1JBAA 4YGDB 1SNLA 2HF5A 2OTGC 4I5NB 4OKHA 3M0WA 2L4HA 1BG1A 1BF5A 1NX3A 1RJVA 4I5LB 5PALA 1OZOA 1W7JB 1K9PA 4ORBB 5G08A 1TNXA 3EVUA 2PASA 1L7ZA 2KHNA 3IVTA 2KPHA 3PM2A 1EG4A 4GPLB 2WC5A 4M2QA 1SSEB 4MEWA 1MUXA 4MRYA 3O2PA 3RLZA 4NDDA 2WCFA 4OV2A 1OMRA 4I5KA 4OZDA 2KFFA 1FI6A 2BL0B 2ZN8A 2YGUA 1NCYA 2ZRTA 3SG3A 3JVTC 1GGWA 1ZUZA 2ZN9A 2H2KA 1NYAA 2Y5IA 3D0YB 3CDNA 3TDUA 2K8MB 2M1KB 1K90D 1SL7A 4XJKB 3DVEA 5DKNA 1CLBA 1BT6A 3MSEB 3SG2A 1R2UA 3VROA 1OE9B 1KFXS 4PE7A 1ALWA 2ZNDA 1F55A 5DKQA 2KI6D 1G4YR 2BCAA 1M46A 3ZWHA 3D74A 1LS8A 2K0JA 1PSRA 1Z2CB 4F7FA 2A4JA 4AOMA 3DF0A 1IQ5A 1SPYA 2JOJA 1LXFC 3B87A 4BY5A 1BODA 3BUNB 4GFTA 3BUXB 2MAZA 2WC6A 4GGFA 1TOPA 2GTEA 3CR4X 4JKTA 1SCMB 1YX7A 1Y1UA 1TCOB 3AAJA 1PVAA 5B8IB 2CNPA 2MLEC 1KQVA 3CR2A 3VRQA 1PRWA 2BBNA 1DVIA 1UHJA 5CSIA 1RWYA 2FCEA 5HKZA 1OMDA 1DEKA 3CZTX 3FWBA 5KU1A 3DVMA 1HQVA 4GNKB 3OHMB 3ICBA 4PT1A 3ZNIA 1YVLA 4A4CA 5HKWA 1B7TY 5CPVA 3R1OA 2KQ6A 2OS8B 1OW4A 1OQPA 2K60A 2Y4QA 3SIBA 5HYDA 3S0FA 1FPWA 1TRFA 1JC2A 5KTYA 1TTXA 3VRPA 3BQ3A 1KWOB 3EK7A 4U8DA 1OMVA 1NX2A 5F6TA 1P28A 3DYEA 2F2OA 3I5FB 1SR6C 2JXCA 3I5IB 2M7LA 1UHHA 1A29A 3EVVA 3I5IC 1XFRA 2JPOA 2NXQA 1ALVA 3SS4A 1S5GY 2BKHB 1WRLA 2KI4B 2JNXA 1K94A 2M29A 5AERA 1DGUA 4PDZA 2BAPA 2I7AA 2K7BA 4GAOA 5I8NA 1J7QA 1EL4A 5D7FA 3O4XA 3B7AA 3D77A 4CFQA 1ZFSA 1UURA 4D1EA 2K7OA 4M2OA 5CSNA 1S26D 3BYAA 1F4OA 1DJIA 1K95A 4DUQA 2MBXA 2LP2A 5I2QA 2AAOA 1B7TZ 1XFZO 2CBLA 1RK9A 2L4IA 3LK1A 1NUBA 4YRUA 1DT7B 1B4CA 1K9UA 2G9BA 1H8BA 4OCIA 3DY9A 1JWDA 4P5OE 4ZCVA 1NIWA 2KI6C 1HT9A 2JTZA 3LK0A 4FTGA 1TCFA 2L5YA 1YVHA 3KHEA 2F3YA 4MBEA 1OOFA 1IIOA 3O78A 2MJWB 2I94A 3OX5A 3CGAA 2Q91A 1B47A 3D76A 3DXLA 1DJGA 1YTZC 3SS3A 1B8LA 4E68A 1R6PA 2LANA 3LCPC 4PALA 1KQMC 1CB1A 1NSHA 2I18A 2Y1MA 1BJFA 2SASA 4ZCUA 1UWOA 1TN4A 3UNWA 1JSAA 4PE4A 5AFPA 3OX6A 1TUJA 4YI8A 2BKIB 1J7PA 2PALA 4GGNA 3S0BA 1B1GA 3EK8A 5HLOA 3SG4A 3R72A 3VRRA 4ETOA 4NDBA 2NCPA 1W9ZA 4CPVA 1QWVA 5I94A 1F4QA 3TS5B 2LE9B 3V2LA 3WHTB 3EG5B 1TNQA 1XVJA 1SL9A 2JU0A 3B88A 3KO0A 4MLWA 5FYXA 2LVIA 1IH0A 4QJ5B 1M31A 2PRUA 2LNKA 2PSRA 2NZ0A 1IRJA 1XK4C 2AMIA 2ZNEA 3FS7A 4YBHB 4DS7A 1KSOA 1QIVA 2EGDA 2FOTA 4MVFA 1WLMA 1ZMZA 4A4BA 1EJ3A 3TDIA 1M45A 1LA0A 3GK2A 1D1OA 1JUOA 2JPTA 3IF7A 4MSPA 1A75A 2KFGA 2KDHA 2BL0C 1M39A 2R2IA 1S1EA 3BXKA 1UHNA 2LUCA 3DVKA 2ZFDA 3L47A 4N1GA 3HX4A 3O6BA 3CS1A 1CDLA 3EKJA 5D3OA 2JT0A 2B1UA 3PJIA 2QDIA 4C0KA 3JTDB 4N5XA 2WCLA 3JTDC 3NXAA 2MA2A 3DVJA 1BOCA 1WRZA 4FQOA 1BU3A 1J7RA 2GGZA 2LP3A 4CLNA 1MXEA 2CT9A 1OSAA 1B8RA 4GUKA 3H4SE 4PHMA 3CZ1A 4CFRA 1YURA 1GGZA 1L2OB 1AVSA 2LMVA 2FJUB 1DQEA 5FI7A 2I2RE 3A8RA 3CWGA 2M0RA 4YGBB 1SCMC 2F8PA 2BNXA 3K1EA 1KCYA 3AAKA 3NSLA 1F8HA 1PVBA 3RM1A 1TWOA 1V1GA 2H61C 4HSZA 1BR1B 4QJ4B 1NCXA 1FI5A 3BOWA 2CCMA 3LL8B 1YUSA 1PALA 1DJHA 2KYFA 1AJ4A 1WY9A 2QEBA 2COLB 1UHIA 2IS9A 2L0PA 2OS8C 3NGVA 1G8IA 1SW8A 4MZJA 1SL8A 1ODBA 1QATA 4WQ3A 3BUWB 2LUXA 2WOSA 5D69A 3SJSA 2JWWA 3BJHA 5I2LA 2E6WA 1KWOC 4PHNA 4TNCA 4Q04A 1A03A 2K61A 2NLNA 1DJXA 1A75B 3I5FC 1JFJA 1B9AA 4PCWA 3SG6A 2JRFA 5CSFA 5JJGA 5IBWA 1Y1AA 3O4YA 1QIWA 4C0JA 1GQMA 1M63B 4YGEB 5J3XA 1S3PA 2KI4C 1ORGA 1QX2A 5HL1A 1F71A 4PHKA 1VRKA 1MQ1A 1KK7Y 2JNFA 3B86A 2KGBC 2JTTA 1C7WA 2ERBA 3GK1A 1K93D 1UP5A 1WRKA 1MXLC 3VB1A 4JPZB 1EXRA 1G33A 1FF1A 1JFKA 1B8CA 2ISDA 1SMGA 3DD4A 3DF0B 1K2HA 1UUSA 4DRWA 1S6CA 1N65A 1X02A 3DZTA 1XFYO 1TNPA 2KQYA 3HCMA 3TUYB 1ZOTB 3WXAA 1QS7A 1DGVA 4GGFC 2F33A 5FI2A 3SG7A 1XFXO 2LVKA 1AJ5A 2JC2A 1U5IA 3S0GA 3UO9A 4M2PA 1C3YA 2WNDA 3CLNA 1QV1A 5DICA 2L51A 1RTP1 1XFVO 2LHIA 5AEQA 2WCEA 4IJ7A 2LAPA 2TN4A 1S5GZ 3BOWB 1MR8A 5FI6A 4YGCB 1Y6WA 2KSPA 3VGOA 1DF0A 3CZ2A 1LINA 3PN7B 1WLZA 1W7IB 2LHLA 1XA5A 4INXA 4NDCA 1KK7Z 1V1FA 3EVRA 2JQ6A 4ICBA 3SIAA 1DELA 5HLVA 3FWCA 2HPSA 2BCXA 1T14A 4KYNA 4N1FA 2O60A 4YI9A 2JULA 5EL2A 1YX8A 3FE6A 4HRHA 2BBMA 5KSZA 1C3ZA 2JZIA 4DIRA 3I5GB 5AXIA 1JF0A 4XYNA 2JT8A 2KNEA 2LM5A 2HQ8A 4F0ZB 5GQQC 1QASA 5ER5A 3PLFB 1PK0D 2WCBA 3TS5C 1QLSA 4I5JA 4AQIA 2QACA 4XJKA 1PULA 2L2CA 2G2BA 2WCMA 1CMFA 2JXLA 2WCHA 2LLUA 4OVNF 3LLEA 1MHOA 1IJ6A 3WHUB 1LVCD 2PYQA 2F3ZA 2AUCA 1CLMA 1AHRA 2LV7A 4BY4A 2KAVA 2HETA 1K8UA 2E30A 2PQLA 1CFDA 1F70A 2DOQA 2M8UA 3OB1B 3EKHA 1DMOA 5HKYA 1YRTB 1Z4HA 1GJYA 3GK4X 3NSOA 1SY9A 2O5GA 3B6XA 2WCJA 2OPOA 3I5HB 2OTGB 4PHJA 3IQOA 1OZSA 2K2AA 2LLSA 3L4AA 1KFUL 1DF0B 3FIAA 1CM1A 1AK8A 1CNPA 1TUZA 1DTLA 2LCPA 4WQ2A 1SRAA 1QV0A 2BE4A 2KLEA 4P2YB 2KFHA 4C0LA 2QEOA 1OOJA 1IG5A 2MLFC 1DJYA 2FJYA 2P6BB 3R1VA 1H4BA 1Q80A 1QX5B 3EK4A 1N2DA 2LC5A 3BFHA 5DKRA 3JVTB 1NX0A 1NP8A 1CTRA 1L2OC 1OOIX 4UPGA 1EH2A 4HREE 2BECA 1JF2A 3E3RA 3F45A 3SS5A 1MF8B 1NX1A 1J1DA 1IWQA 1PSBA 2JT3A 2M1UA 2FCDA 3QRXA 1QX7A 4WRIA 1XO5A 1A2XA 4FQTA 4PE1A 1S6JA 2KYCA 2M3WA 3CR5X 2KGRA 3WNXB 2KOTA 1BMOA 4JD9A 2M97A 4IL1A 1QXPA 3Q8IA 4MZLA 1QTXA 2KBMA 1F54A 2ZRSA 1KFUS 2LMTA 1S6IA 4USLA 2BE6A 1RROA 2WCKA 2CXJA 2F2PA 2ZKMX 3NHTA 3PATA 4INWA 5AANA 1Y1XA 3BUOB 3NHIA 2SCPA 3PALA 2M49B 2K7CA 2QEHA 1NCZA 1IQ3A 1OOGA 2H8VA 4MRXA 2K7DA 3AKAA 1K96A 2QPTA 3BFAA 4JWQA 1CDNA 2M9GA 3KPXA 2LVVA 3D78A 1J55A 2BCBA 3QMEA 1BR4B 1QLKA 1AUIB 4YGAA 1J7OA 1KK8B 4R1EA 1J1EA 3S0DA 5I2OA 4MN0A 1AP4A 1KK8C 2KBIA 2D8NA 2Q4UA 1TNWA 2K2FA 2KAXA 1SR6B 3OGNA 2WC8A 3NSKA 3BUMB 1CKKA 3TZ1A 1S36A 2GV5A 4MZKA 2LLTA 2LVJA 3CTNA 3A4UB 4PE0A 5ER4X 3TUYC 1YR5A 1CFPA 1DJWA 2EHBA 2PMYA 1XFWO 1YUTA 2P71A 3GOFA 1TIZA 2L50A 1CM4A 1KSMA 1SK6D 3L4LA 2V53A 2M7NA 1XYDA 4ORCB 1QVIY 2KAYA 2L2EA 3K21A 1XK4A 2MHHA
chains in the Genus database with same CATH topology
1CDPA 3TDZA 3KEVA 2VRGA 1YUUA 3PSRA 1IKUA 4L9MA 4ORAB 1CDMA 1XFUO 3PN7C 1IGVA 2CTNA 3PFVA 5TNCA 3IQQA 3KF9A 3SG5A 1DJZA 1ZACA 1E8AA 3AKBA 1RECA 4OR9B 1NWDA 4HRGA 2NCOA 3I5GC 1FW4A 1LA3A 2GGMA 1IJ5A 1C7VA 1RFJA 1Y0VH 3D0YA 3PM8A 1CMGA 1EG3A 1FBVA 1KQMB 3C1VA 2Y1NA 5JOLA 1QVIZ 2WORA 1MWNA 4DCKA 5CSJA 2HQWA 1SBJA 4QJ3B 1K9KA 1N0YA 1UHKA 1CFCA 4AQJA 4CIDA 2L5XB 1CLLA 1LKJA 2L98A 1KFXL 1NPQA 2EC6B 3D10A 2RGIA 3NSIA 4JQ0D 2EC6C 1SCVA 1SYMA 1YRUB 2PVBA 2MRDA 1C07A 1SKTA 2LMUA 5BPJA 1CFFA 3VRNA 1BLQA 1WDCB 1U5IB 4GBAA 1WDCC 3OP0A 2H61A 5K89A 3OB2B 3I5HC 1A4PA 1QJTA 4NQGA 1JBAA 4YGDB 1SNLA 2HF5A 2OTGC 4I5NB 4OKHA 3M0WA 2L4HA 1BG1A 1BF5A 1NX3A 1RJVA 4I5LB 5PALA 1OZOA 1W7JB 1K9PA 4ORBB 5G08A 1TNXA 3EVUA 2PASA 1L7ZA 2KHNA 4GPLB 4M2QA 4MRYA 1EG4A 3RLZA 4MEWA 1MUXA 3O2PA 4NDDA 2WCFA 4OV2A 1OMRA 4I5KA 1FI6A 2KFFA 2BL0B 2ZN8A 1NCYA 2ZRTA 3SG3A 3JVTC 1GGWA 1ZUZA 2ZN9A 2H2KA 1NYAA 2Y5IA 3D0YB 3TDUA 2K8MB 2M1KB 1K90D 1SL7A 4XJKB 3DVEA 5DKNA 1CLBA 1BT6A 3MSEB 3SG2A 1R2UA 3VROA 1OE9B 1KFXS 4PE7A 1ALWA 2ZNDA 1F55A 5DKQA 2KI6D 1G4YR 2BCAA 1M46A 3ZWHA 2K0JA 1PSRA 2A4JA 4AOMA 3DF0A 1IQ5A 1SPYA 2JOJA 1LXFC 4BY5A 1BODA 3BUNB 4GFTA 3BUXB 2MAZA 4GGFA 1TOPA 3CR4X 1SCMB 1YX7A 1Y1UA 1TCOB 3AAJA 1PVAA 5B8IB 2CNPA 2MLEC 1KQVA 3CR2A 3VRQA 1PRWA 2BBNA 1DVIA 1UHJA 5CSIA 1RWYA 2FCEA 5HKZA 1OMDA 3CZTX 3FWBA 5KU1A 3DVMA 1HQVA 4GNKB 3OHMB 3ICBA 3ZNIA 1YVLA 4A4CA 5HKWA 1B7TY 5CPVA 3SIBA 2KQ6A 2OS8B 1OQPA 5HYDA 2Y4QA 1FPWA 1TRFA 1JC2A 5KTYA 1TTXA 3VRPA 3BQ3A 1KWOB 3EK7A 4U8DA 1OMVA 1NX2A 5F6TA 2F2OA 3I5FB 1SR6C 2JXCA 3I5IB 2M7LA 1UHHA 1A29A 3EVVA 3I5IC 2NXQA 1ALVA 1S5GY 2BKHB 1WRLA 2KI4B 2JNXA 1K94A 2M29A 5AERA 1DGUA 4PDZA 5I8NA 2I7AA 2K7BA 4GAOA 1J7QA 1EL4A 5D7FA 4CFQA 1ZFSA 1UURA 4D1EA 2K7OA 4M2OA 5CSNA 1S26D 3BYAA 1F4OA 1DJIA 1K95A 4DUQA 2MBXA 2LP2A 5I2QA 2AAOA 1B7TZ 1XFZO 2CBLA 1RK9A 2L4IA 3LK1A 1NUBA 4YRUA 1DT7B 1B4CA 1K9UA 2G9BA 1H8BA 4OCIA 1JWDA 4P5OE 4ZCVA 1NIWA 2KI6C 1HT9A 2JTZA 3LK0A 4FTGA 1TCFA 1YVHA 3KHEA 2F3YA 4MBEA 3O78A 2MJWB 2I94A 3OX5A 3CGAA 2Q91A 1B47A 1DJGA 1YTZC 1B8LA 4E68A 1R6PA 2LANA 3LCPC 4PALA 1KQMC 1CB1A 1NSHA 2I18A 2Y1MA 1BJFA 2SASA 4ZCUA 1UWOA 1TN4A 1JSAA 4PE4A 5AFPA 3OX6A 4YI8A 2BKIB 1J7PA 2PALA 4GGNA 1B1GA 3EK8A 5HLOA 3SG4A 3VRRA 4ETOA 4NDBA 2NCPA 4CPVA 1F4QA 3TS5B 2LE9B 3WHTB 1TNQA 1XVJA 1SL9A 2JU0A 3KO0A 4MLWA 5FYXA 2LVIA 1IH0A 4QJ5B 1M31A 2PRUA 2LNKA 2PSRA 2NZ0A 1IRJA 1XK4C 2AMIA 2ZNEA 3FS7A 4YBHB 4DS7A 1KSOA 1QIVA 2EGDA 2FOTA 4MVFA 1WLMA 1ZMZA 4A4BA 1EJ3A 3TDIA 1M45A 1LA0A 3GK2A 1D1OA 1JUOA 2JPTA 3IF7A 4MSPA 1A75A 2KFGA 2KDHA 2BL0C 1M39A 2R2IA 1S1EA 3BXKA 1UHNA 2LUCA 3DVKA 2ZFDA 4N1GA 3HX4A 3O6BA 3CS1A 1CDLA 3EKJA 2JT0A 2B1UA 4C0KA 3JTDB 4N5XA 3JTDC 3NXAA 2MA2A 3DVJA 1BOCA 1WRZA 4FQOA 1BU3A 1J7RA 2GGZA 2LP3A 4CLNA 1MXEA 2CT9A 1OSAA 1B8RA 4GUKA 3H4SE 4PHMA 4CFRA 1YURA 1GGZA 1L2OB 1AVSA 2LMVA 2FJUB 2I2RE 3A8RA 3CWGA 2M0RA 4YGBB 1SCMC 2F8PA 1KCYA 3AAKA 3NSLA 1F8HA 1PVBA 3RM1A 1V1GA 2H61C 4HSZA 1BR1B 4QJ4B 1NCXA 1FI5A 3BOWA 2CCMA 3LL8B 1YUSA 1PALA 1DJHA 2KYFA 1AJ4A 1WY9A 2COLB 1UHIA 2IS9A 2L0PA 2OS8C 1G8IA 1SW8A 4MZJA 1SL8A 1ODBA 1QATA 4WQ3A 3BUWB 2LUXA 2WOSA 5D69A 3SJSA 2JWWA 5I2LA 2E6WA 1KWOC 4PHNA 4TNCA 4Q04A 1A03A 2K61A 2NLNA 1DJXA 1A75B 3I5FC 1JFJA 1B9AA 4PCWA 3SG6A 2JRFA 5CSFA 5JJGA 5IBWA 1Y1AA 3O4YA 1QIWA 4C0JA 1GQMA 1M63B 4YGEB 5J3XA 1S3PA 2KI4C 1QX2A 1F71A 4PHKA 1VRKA 1MQ1A 1KK7Y 2JNFA 2KGBC 2JTTA 1C7WA 3GK1A 1K93D 1UP5A 1WRKA 1MXLC 4JPZB 1EXRA 1G33A 1FF1A 1JFKA 1B8CA 2ISDA 1SMGA 3DD4A 3DF0B 1K2HA 1UUSA 4DRWA 1S6CA 1N65A 1X02A 1XFYO 1TNPA 2KQYA 3HCMA 3TUYB 1ZOTB 3WXAA 1QS7A 1DGVA 4GGFC 2F33A 3SG7A 1XFXO 2LVKA 1AJ5A 2JC2A 1U5IA 4M2PA 2WNDA 3CLNA 1QV1A 5AEQA 2L51A 1RTP1 1XFVO 2LHIA 2WCEA 2LAPA 2TN4A 1S5GZ 3BOWB 1MR8A 4YGCB 1Y6WA 2KSPA 3VGOA 1DF0A 1LINA 3PN7B 1WLZA 1W7IB 2LHLA 1XA5A 4NDCA 1KK7Z 1V1FA 3EVRA 2JQ6A 4ICBA 3SIAA 5HLVA 3FWCA 2HPSA 2BCXA 4N1FA 4YI9A 2O60A 5KSZA 2JULA 1YX8A 4HRHA 2BBMA 2JZIA 4DIRA 3I5GB 5AXIA 1JF0A 4XYNA 2JT8A 2KNEA 2LM5A 2HQ8A 4F0ZB 5GQQC 1QASA 5ER5A 3PLFB 1PK0D 2WCBA 3TS5C 1QLSA 4I5JA 4AQIA 2QACA 4XJKA 1PULA 2G2BA 1CMFA 2JXLA 2LLUA 4OVNF 3LLEA 1MHOA 1IJ6A 3WHUB 1LVCD 2F3ZA 2AUCA 1CLMA 1AHRA 2LV7A 4BY4A 2KAVA 2HETA 1K8UA 2E30A 1F70A 1CFDA 2DOQA 2M8UA 3OB1B 3EKHA 1DMOA 5HKYA 1YRTB 1GJYA 3GK4X 3NSOA 1SY9A 2O5GA 2OPOA 3I5HB 2OTGB 4PHJA 3IQOA 1OZSA 2K2AA 2LLSA 1KFUL 1DF0B 3FIAA 1CM1A 1AK8A 1CNPA 1DTLA 2LCPA 4WQ2A 1SRAA 1QV0A 2BE4A 4P2YB 2KFHA 4C0LA 1OOJA 1IG5A 2MLFC 1DJYA 2P6BB 1H4BA 1Q80A 1QX5B 3EK4A 1N2DA 2LC5A 5DKRA 3JVTB 1NX0A 1NP8A 1CTRA 1L2OC 4UPGA 1EH2A 4HREE 2BECA 1JF2A 3E3RA 3F45A 1MF8B 1NX1A 1J1DA 1IWQA 1PSBA 2JT3A 2M1UA 2FCDA 3QRXA 1QX7A 4WRIA 1XO5A 1A2XA 4PE1A 1S6JA 2KYCA 2M3WA 3CR5X 2KGRA 3WNXB 2KOTA 1BMOA 2M97A 4IL1A 1QXPA 4MZLA 1QTXA 2KBMA 1F54A 2ZRSA 1KFUS 2LMTA 1S6IA 4USLA 2BE6A 1RROA 2CXJA 2F2PA 2ZKMX 3PATA 5AANA 1Y1XA 3BUOB 2SCPA 3PALA 2M49B 2K7CA 1NCZA 1IQ3A 4MRXA 2K7DA 3AKAA 1K96A 2QPTA 4JWQA 1CDNA 2M9GA 3KPXA 2LVVA 1J55A 2BCBA 1BR4B 1QLKA 1AUIB 4YGAA 1J7OA 1KK8B 4R1EA 1J1EA 5I2OA 1AP4A 4MN0A 1KK8C 2KBIA 2D8NA 2Q4UA 1TNWA 2K2FA 2KAXA 1SR6B 2WC8A 3NSKA 3BUMB 1CKKA 3TZ1A 1S36A 2GV5A 4MZKA 2LLTA 2LVJA 3CTNA 3A4UB 4PE0A 5ER4X 3TUYC 1YR5A 1CFPA 1DJWA 2EHBA 2PMYA 1XFWO 1YUTA 3GOFA 1TIZA 2L50A 1CM4A 1KSMA 1SK6D 2V53A 2M7NA 1XYDA 4ORCB 1QVIY 2KAYA 2L2EA 3K21A 1XK4A 2MHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDP A;  3TDZ A;  3KEV A;  2VRG A;  1YUU A;  3PSR A;  1IKU A;  4L9M A;  4ORA B;  1CDM A;  1XFU O;  3PN7 C;  1IGV A;  2CTN A;  3PFV A;  5TNC A;  3IQQ A;  3KF9 A;  3SG5 A;  1DJZ A;  1ZAC A;  1E8A A;  3AKB A;  1REC A;  4OR9 B;  1NWD A;  4HRG A;  2NCO A;  3I5G C;  1FW4 A;  1LA3 A;  2GGM A;  1IJ5 A;  1C7V A;  1RFJ A;  1Y0V H;  3D0Y A;  3PM8 A;  1CMG A;  1EG3 A;  1FBV A;  1KQM B;  3C1V A;  2Y1N A;  5JOL A;  1QVI Z;  2WOR A;  1MWN A;  4DCK A;  5CSJ A;  2HQW A;  1SBJ A;  4QJ3 B;  1K9K A;  1N0Y A;  1UHK A;  1CFC A;  4AQJ A;  4CID A;  2L5X B;  1CLL A;  1LKJ A;  2L98 A;  1KFX L;  1NPQ A;  2EC6 B;  3D10 A;  2RGI A;  3NSI A;  4JQ0 D;  2EC6 C;  1SCV A;  1SYM A;  1YRU B;  2PVB A;  2MRD A;  1C07 A;  1SKT A;  2LMU A;  5BPJ A;  1CFF A;  3VRN A;  1BLQ A;  1WDC B;  1U5I B;  4GBA A;  1WDC C;  3OP0 A;  2H61 A;  5K89 A;  3OB2 B;  3I5H C;  1A4P A;  1QJT A;  4NQG A;  1JBA A;  4YGD B;  1SNL A;  2HF5 A;  2OTG C;  4I5N B;  4OKH A;  3M0W A;  2L4H A;  1BG1 A;  1BF5 A;  1NX3 A;  1RJV A;  4I5L B;  5PAL A;  1OZO A;  1W7J B;  1K9P A;  4ORB B;  5G08 A;  1TNX A;  3EVU A;  2PAS A;  1L7Z A;  2KHN A;  4GPL B;  4M2Q A;  4MRY A;  1EG4 A;  3RLZ A;  4MEW A;  1MUX A;  3O2P A;  4NDD A;  2WCF A;  4OV2 A;  1OMR A;  4I5K A;  1FI6 A;  2KFF A;  2BL0 B;  2ZN8 A;  1NCY A;  2ZRT A;  3SG3 A;  3JVT C;  1GGW A;  1ZUZ A;  2ZN9 A;  2H2K A;  1NYA A;  2Y5I A;  3D0Y B;  3TDU A;  2K8M B;  2M1K B;  1K90 D;  1SL7 A;  4XJK B;  3DVE A;  5DKN A;  1CLB A;  1BT6 A;  3MSE B;  3SG2 A;  1R2U A;  3VRO A;  1OE9 B;  1KFX S;  4PE7 A;  1ALW A;  2ZND A;  1F55 A;  5DKQ A;  2KI6 D;  1G4Y R;  2BCA A;  1M46 A;  3ZWH A;  2K0J A;  1PSR A;  2A4J A;  4AOM A;  3DF0 A;  1IQ5 A;  1SPY A;  2JOJ A;  1LXF C;  4BY5 A;  1BOD A;  3BUN B;  4GFT A;  3BUX B;  2MAZ A;  4GGF A;  1TOP A;  3CR4 X;  1SCM B;  1YX7 A;  1Y1U A;  1TCO B;  3AAJ A;  1PVA A;  5B8I B;  2CNP A;  2MLE C;  1KQV A;  3CR2 A;  3VRQ A;  1PRW A;  2BBN A;  1DVI A;  1UHJ A;  5CSI A;  1RWY A;  2FCE A;  5HKZ A;  1OMD A;  3CZT X;  3FWB A;  5KU1 A;  3DVM A;  1HQV A;  4GNK B;  3OHM B;  3ICB A;  3ZNI A;  1YVL A;  4A4C A;  5HKW A;  1B7T Y;  5CPV A;  3SIB A;  2KQ6 A;  2OS8 B;  1OQP A;  5HYD A;  2Y4Q A;  1FPW A;  1TRF A;  1JC2 A;  5KTY A;  1TTX A;  3VRP A;  3BQ3 A;  1KWO B;  3EK7 A;  4U8D A;  1OMV A;  1NX2 A;  5F6T A;  2F2O A;  3I5F B;  1SR6 C;  2JXC A;  3I5I B;  2M7L A;  1UHH A;  1A29 A;  3EVV A;  3I5I C;  2NXQ A;  1ALV A;  1S5G Y;  2BKH B;  1WRL A;  2KI4 B;  2JNX A;  1K94 A;  2M29 A;  5AER A;  1DGU A;  4PDZ A;  5I8N A;  2I7A A;  2K7B A;  4GAO A;  1J7Q A;  1EL4 A;  5D7F A;  4CFQ A;  1ZFS A;  1UUR A;  4D1E A;  2K7O A;  4M2O A;  5CSN A;  1S26 D;  3BYA A;  1F4O A;  1DJI A;  1K95 A;  4DUQ A;  2MBX A;  2LP2 A;  5I2Q A;  2AAO A;  1B7T Z;  1XFZ O;  2CBL A;  1RK9 A;  2L4I A;  3LK1 A;  1NUB A;  4YRU A;  1DT7 B;  1B4C A;  1K9U A;  2G9B A;  1H8B A;  4OCI A;  1JWD A;  4P5O E;  4ZCV A;  1NIW A;  2KI6 C;  1HT9 A;  2JTZ A;  3LK0 A;  4FTG A;  1TCF A;  1YVH A;  3KHE A;  2F3Y A;  4MBE A;  3O78 A;  2MJW B;  2I94 A;  3OX5 A;  3CGA A;  2Q91 A;  1B47 A;  1DJG A;  1YTZ C;  1B8L A;  4E68 A;  1R6P A;  2LAN A;  3LCP C;  4PAL A;  1KQM C;  1CB1 A;  1NSH A;  2I18 A;  2Y1M A;  1BJF A;  2SAS A;  4ZCU A;  1UWO A;  1TN4 A;  1JSA A;  4PE4 A;  5AFP A;  3OX6 A;  4YI8 A;  2BKI B;  1J7P A;  2PAL A;  4GGN A;  1B1G A;  3EK8 A;  5HLO A;  3SG4 A;  3VRR A;  4ETO A;  4NDB A;  2NCP A;  4CPV A;  1F4Q A;  3TS5 B;  2LE9 B;  3WHT B;  1TNQ A;  1XVJ A;  1SL9 A;  2JU0 A;  3KO0 A;  4MLW A;  5FYX A;  2LVI A;  1IH0 A;  4QJ5 B;  1M31 A;  2PRU A;  2LNK A;  2PSR A;  2NZ0 A;  1IRJ A;  1XK4 C;  2AMI A;  2ZNE A;  3FS7 A;  4YBH B;  4DS7 A;  1KSO A;  1QIV A;  2EGD A;  2FOT A;  4MVF A;  1WLM A;  1ZMZ A;  4A4B A;  1EJ3 A;  3TDI A;  1M45 A;  1LA0 A;  3GK2 A;  1D1O A;  1JUO A;  2JPT A;  3IF7 A;  4MSP A;  1A75 A;  2KFG A;  2KDH A;  2BL0 C;  1M39 A;  2R2I A;  1S1E A;  3BXK A;  1UHN A;  2LUC A;  3DVK A;  2ZFD A;  4N1G A;  3HX4 A;  3O6B A;  3CS1 A;  1CDL A;  3EKJ A;  2JT0 A;  2B1U A;  4C0K A;  3JTD B;  4N5X A;  3JTD C;  3NXA A;  2MA2 A;  3DVJ A;  1BOC A;  1WRZ A;  4FQO A;  1BU3 A;  1J7R A;  2GGZ A;  2LP3 A;  4CLN A;  1MXE A;  2CT9 A;  1OSA A;  1B8R A;  4GUK A;  3H4S E;  4PHM A;  4CFR A;  1YUR A;  1GGZ A;  1L2O B;  1AVS A;  2LMV A;  2FJU B;  2I2R E;  3A8R A;  3CWG A;  2M0R A;  4YGB B;  1SCM C;  2F8P A;  1KCY A;  3AAK A;  3NSL A;  1F8H A;  1PVB A;  3RM1 A;  1V1G A;  2H61 C;  4HSZ A;  1BR1 B;  4QJ4 B;  1NCX A;  1FI5 A;  3BOW A;  2CCM A;  3LL8 B;  1YUS A;  1PAL A;  1DJH A;  2KYF A;  1AJ4 A;  1WY9 A;  2COL B;  1UHI A;  2IS9 A;  2L0P A;  2OS8 C;  1G8I A;  1SW8 A;  4MZJ A;  1SL8 A;  1ODB A;  1QAT A;  4WQ3 A;  3BUW B;  2LUX A;  2WOS A;  5D69 A;  3SJS A;  2JWW A;  5I2L A;  2E6W A;  1KWO C;  4PHN A;  4TNC A;  4Q04 A;  1A03 A;  2K61 A;  2NLN A;  1DJX A;  1A75 B;  3I5F C;  1JFJ A;  1B9A A;  4PCW A;  3SG6 A;  2JRF A;  5CSF A;  5JJG A;  5IBW A;  1Y1A A;  3O4Y A;  1QIW A;  4C0J A;  1GQM A;  1M63 B;  4YGE B;  5J3X A;  1S3P A;  2KI4 C;  1QX2 A;  1F71 A;  4PHK A;  1VRK A;  1MQ1 A;  1KK7 Y;  2JNF A;  2KGB C;  2JTT A;  1C7W A;  3GK1 A;  1K93 D;  1UP5 A;  1WRK A;  1MXL C;  4JPZ B;  1EXR A;  1G33 A;  1FF1 A;  1JFK A;  1B8C A;  2ISD A;  1SMG A;  3DD4 A;  3DF0 B;  1K2H A;  1UUS A;  4DRW A;  1S6C A;  1N65 A;  1X02 A;  1XFY O;  1TNP A;  2KQY A;  3HCM A;  3TUY B;  1ZOT B;  3WXA A;  1QS7 A;  1DGV A;  4GGF C;  2F33 A;  3SG7 A;  1XFX O;  2LVK A;  1AJ5 A;  2JC2 A;  1U5I A;  4M2P A;  2WND A;  3CLN A;  1QV1 A;  5AEQ A;  2L51 A;  1RTP 1;  1XFV O;  2LHI A;  2WCE A;  2LAP A;  2TN4 A;  1S5G Z;  3BOW B;  1MR8 A;  4YGC B;  1Y6W A;  2KSP A;  3VGO A;  1DF0 A;  1LIN A;  3PN7 B;  1WLZ A;  1W7I B;  2LHL A;  1XA5 A;  4NDC A;  1KK7 Z;  1V1F A;  3EVR A;  2JQ6 A;  4ICB A;  3SIA A;  5HLV A;  3FWC A;  2HPS A;  2BCX A;  4N1F A;  4YI9 A;  2O60 A;  5KSZ A;  2JUL A;  1YX8 A;  4HRH A;  2BBM A;  2JZI A;  4DIR A;  3I5G B;  5AXI A;  1JF0 A;  4XYN A;  2JT8 A;  2KNE A;  2LM5 A;  2HQ8 A;  4F0Z B;  5GQQ C;  1QAS A;  5ER5 A;  3PLF B;  1PK0 D;  2WCB A;  3TS5 C;  1QLS A;  4I5J A;  4AQI A;  2QAC A;  4XJK A;  1PUL A;  2G2B A;  1CMF A;  2JXL A;  2LLU A;  4OVN F;  3LLE A;  1MHO A;  1IJ6 A;  3WHU B;  1LVC D;  2F3Z A;  2AUC A;  1CLM A;  1AHR A;  2LV7 A;  4BY4 A;  2KAV A;  2HET A;  1K8U A;  2E30 A;  1F70 A;  1CFD A;  2DOQ A;  2M8U A;  3OB1 B;  3EKH A;  1DMO A;  5HKY A;  1YRT B;  1GJY A;  3GK4 X;  3NSO A;  1SY9 A;  2O5G A;  2OPO A;  3I5H B;  2OTG B;  4PHJ A;  3IQO A;  1OZS A;  2K2A A;  2LLS A;  1KFU L;  1DF0 B;  3FIA A;  1CM1 A;  1AK8 A;  1CNP A;  1DTL A;  2LCP A;  4WQ2 A;  1SRA A;  1QV0 A;  2BE4 A;  4P2Y B;  2KFH A;  4C0L A;  1OOJ A;  1IG5 A;  2MLF C;  1DJY A;  2P6B B;  1H4B A;  1Q80 A;  1QX5 B;  3EK4 A;  1N2D A;  2LC5 A;  5DKR A;  3JVT B;  1NX0 A;  1NP8 A;  1CTR A;  1L2O C;  4UPG A;  1EH2 A;  4HRE E;  2BEC A;  1JF2 A;  3E3R A;  3F45 A;  1MF8 B;  1NX1 A;  1J1D A;  1IWQ A;  1PSB A;  2JT3 A;  2M1U A;  2FCD A;  3QRX A;  1QX7 A;  4WRI A;  1XO5 A;  1A2X A;  4PE1 A;  1S6J A;  2KYC A;  2M3W A;  3CR5 X;  2KGR A;  3WNX B;  2KOT A;  1BMO A;  2M97 A;  4IL1 A;  1QXP A;  4MZL A;  1QTX A;  2KBM A;  1F54 A;  2ZRS A;  1KFU S;  2LMT A;  1S6I A;  4USL A;  2BE6 A;  1RRO A;  2CXJ A;  2F2P A;  2ZKM X;  3PAT A;  5AAN A;  1Y1X A;  3BUO B;  2SCP A;  3PAL A;  2M49 B;  2K7C A;  1NCZ A;  1IQ3 A;  4MRX A;  2K7D A;  3AKA A;  1K96 A;  2QPT A;  4JWQ A;  1CDN A;  2M9G A;  3KPX A;  2LVV A;  1J55 A;  2BCB A;  1BR4 B;  1QLK A;  1AUI B;  4YGA A;  1J7O A;  1KK8 B;  4R1E A;  1J1E A;  5I2O A;  1AP4 A;  4MN0 A;  1KK8 C;  2KBI A;  2D8N A;  2Q4U A;  1TNW A;  2K2F A;  2KAX A;  1SR6 B;  2WC8 A;  3NSK A;  3BUM B;  1CKK A;  3TZ1 A;  1S36 A;  2GV5 A;  4MZK A;  2LLT A;  2LVJ A;  3CTN A;  3A4U B;  4PE0 A;  5ER4 X;  3TUY C;  1YR5 A;  1CFP A;  1DJW A;  2EHB A;  2PMY A;  1XFW O;  1YUT A;  3GOF A;  1TIZ A;  2L50 A;  1CM4 A;  1KSM A;  1SK6 D;  2V53 A;  2M7N A;  1XYD A;  4ORC B;  1QVI Y;  2KAY A;  2L2E A;  3K21 A;  1XK4 A;  2MHH A; 
#chains in the Genus database with same CATH topology
 1CDP A;  3TDZ A;  2P70 A;  3S0A A;  3KEV A;  2VRG A;  1YUU A;  3PSR A;  1IKU A;  4L9M A;  4ORA B;  1CDM A;  1XFU O;  3PN7 C;  1IGV A;  2CTN A;  3PFV A;  5TNC A;  3BFB A;  3N7H A;  3R1P A;  3IQQ A;  3KF9 A;  3OBV A;  1GM0 A;  3SG5 A;  1DJZ A;  1ZAC A;  1E8A A;  3AKB A;  1REC A;  4OR9 B;  1NWD A;  4HRG A;  2NCO A;  3I5G C;  1FW4 A;  1LA3 A;  2GGM A;  1IJ5 A;  1C7V A;  1RFJ A;  1OOH A;  1Y0V H;  3D0Y A;  3PM8 A;  3S0E A;  2QEV A;  1CMG A;  1EG3 A;  3RZS A;  1FBV A;  1KQM B;  3C1V A;  2Y1N A;  5JOL A;  1QVI Z;  2WOR A;  1MWN A;  4DCK A;  5CSJ A;  2HQW A;  3D73 A;  1SBJ A;  3FE9 A;  4QJ3 B;  1K9K A;  1N0Y A;  1UHK A;  1CFC A;  4AQJ A;  3CZ0 A;  4CID A;  2L5X B;  1CLL A;  1LKJ A;  2L98 A;  1KFX L;  1NPQ A;  2EC6 B;  3D10 A;  3CYZ A;  2RGI A;  3NSI A;  4JQ0 D;  2EC6 C;  1SCV A;  1SYM A;  1YRU B;  2PVB A;  2MRD A;  1C07 A;  1SKT A;  2LMU A;  3FE8 A;  5BPJ A;  3VRN A;  1BLQ A;  1WDC B;  1CFF A;  1U5I B;  4GBA A;  1DC1 A;  1WDC C;  3OP0 A;  2H61 A;  3CAB A;  5K89 A;  3OB2 B;  3I5H C;  3D75 A;  2KLD A;  1A4P A;  1QJT A;  4NQG A;  1JBA A;  4YGD B;  1SNL A;  2HF5 A;  2OTG C;  4I5N B;  4OKH A;  3M0W A;  2L4H A;  1BG1 A;  1BF5 A;  1NX3 A;  1RJV A;  4I5L B;  5PAL A;  1OZO A;  1W7J B;  1K9P A;  4ORB B;  5G08 A;  1TNX A;  3EVU A;  2PAS A;  1L7Z A;  2KHN A;  3IVT A;  2KPH A;  3PM2 A;  1EG4 A;  4GPL B;  2WC5 A;  4M2Q A;  1SSE B;  4MEW A;  1MUX A;  4MRY A;  3O2P A;  3RLZ A;  4NDD A;  2WCF A;  4OV2 A;  1OMR A;  4I5K A;  4OZD A;  2KFF A;  1FI6 A;  2BL0 B;  2ZN8 A;  2YGU A;  1NCY A;  2ZRT A;  3SG3 A;  3JVT C;  1GGW A;  1ZUZ A;  2ZN9 A;  2H2K A;  1NYA A;  2Y5I A;  3D0Y B;  3CDN A;  3TDU A;  2K8M B;  2M1K B;  1K90 D;  1SL7 A;  4XJK B;  3DVE A;  5DKN A;  1CLB A;  1BT6 A;  3MSE B;  3SG2 A;  1R2U A;  3VRO A;  1OE9 B;  1KFX S;  4PE7 A;  1ALW A;  2ZND A;  1F55 A;  5DKQ A;  2KI6 D;  1G4Y R;  2BCA A;  1M46 A;  3ZWH A;  3D74 A;  1LS8 A;  2K0J A;  1PSR A;  1Z2C B;  4F7F A;  2A4J A;  4AOM A;  3DF0 A;  1IQ5 A;  1SPY A;  2JOJ A;  1LXF C;  3B87 A;  4BY5 A;  1BOD A;  3BUN B;  4GFT A;  3BUX B;  2MAZ A;  2WC6 A;  4GGF A;  1TOP A;  2GTE A;  3CR4 X;  4JKT A;  1SCM B;  1YX7 A;  1Y1U A;  1TCO B;  3AAJ A;  1PVA A;  5B8I B;  2CNP A;  2MLE C;  1KQV A;  3CR2 A;  3VRQ A;  1PRW A;  2BBN A;  1DVI A;  1UHJ A;  5CSI A;  1RWY A;  2FCE A;  5HKZ A;  1OMD A;  1DEK A;  3CZT X;  3FWB A;  5KU1 A;  3DVM A;  1HQV A;  4GNK B;  3OHM B;  3ICB A;  4PT1 A;  3ZNI A;  1YVL A;  4A4C A;  5HKW A;  1B7T Y;  5CPV A;  3R1O A;  2KQ6 A;  2OS8 B;  1OW4 A;  1OQP A;  2K60 A;  2Y4Q A;  3SIB A;  5HYD A;  3S0F A;  1FPW A;  1TRF A;  1JC2 A;  5KTY A;  1TTX A;  3VRP A;  3BQ3 A;  1KWO B;  3EK7 A;  4U8D A;  1OMV A;  1NX2 A;  5F6T A;  1P28 A;  3DYE A;  2F2O A;  3I5F B;  1SR6 C;  2JXC A;  3I5I B;  2M7L A;  1UHH A;  1A29 A;  3EVV A;  3I5I C;  1XFR A;  2JPO A;  2NXQ A;  1ALV A;  3SS4 A;  1S5G Y;  2BKH B;  1WRL A;  2KI4 B;  2JNX A;  1K94 A;  2M29 A;  5AER A;  1DGU A;  4PDZ A;  2BAP A;  2I7A A;  2K7B A;  4GAO A;  5I8N A;  1J7Q A;  1EL4 A;  5D7F A;  3O4X A;  3B7A A;  3D77 A;  4CFQ A;  1ZFS A;  1UUR A;  4D1E A;  2K7O A;  4M2O A;  5CSN A;  1S26 D;  3BYA A;  1F4O A;  1DJI A;  1K95 A;  4DUQ A;  2MBX A;  2LP2 A;  5I2Q A;  2AAO A;  1B7T Z;  1XFZ O;  2CBL A;  1RK9 A;  2L4I A;  3LK1 A;  1NUB A;  4YRU A;  1DT7 B;  1B4C A;  1K9U A;  2G9B A;  1H8B A;  4OCI A;  3DY9 A;  1JWD A;  4P5O E;  4ZCV A;  1NIW A;  2KI6 C;  1HT9 A;  2JTZ A;  3LK0 A;  4FTG A;  1TCF A;  2L5Y A;  1YVH A;  3KHE A;  2F3Y A;  4MBE A;  1OOF A;  1IIO A;  3O78 A;  2MJW B;  2I94 A;  3OX5 A;  3CGA A;  2Q91 A;  1B47 A;  3D76 A;  3DXL A;  1DJG A;  1YTZ C;  3SS3 A;  1B8L A;  4E68 A;  1R6P A;  2LAN A;  3LCP C;  4PAL A;  1KQM C;  1CB1 A;  1NSH A;  2I18 A;  2Y1M A;  1BJF A;  2SAS A;  4ZCU A;  1UWO A;  1TN4 A;  3UNW A;  1JSA A;  4PE4 A;  5AFP A;  3OX6 A;  1TUJ A;  4YI8 A;  2BKI B;  1J7P A;  2PAL A;  4GGN A;  3S0B A;  1B1G A;  3EK8 A;  5HLO A;  3SG4 A;  3R72 A;  3VRR A;  4ETO A;  4NDB A;  2NCP A;  1W9Z A;  4CPV A;  1QWV A;  5I94 A;  1F4Q A;  3TS5 B;  2LE9 B;  3V2L A;  3WHT B;  3EG5 B;  1TNQ A;  1XVJ A;  1SL9 A;  2JU0 A;  3B88 A;  3KO0 A;  4MLW A;  5FYX A;  2LVI A;  1IH0 A;  4QJ5 B;  1M31 A;  2PRU A;  2LNK A;  2PSR A;  2NZ0 A;  1IRJ A;  1XK4 C;  2AMI A;  2ZNE A;  3FS7 A;  4YBH B;  4DS7 A;  1KSO A;  1QIV A;  2EGD A;  2FOT A;  4MVF A;  1WLM A;  1ZMZ A;  4A4B A;  1EJ3 A;  3TDI A;  1M45 A;  1LA0 A;  3GK2 A;  1D1O A;  1JUO A;  2JPT A;  3IF7 A;  4MSP A;  1A75 A;  2KFG A;  2KDH A;  2BL0 C;  1M39 A;  2R2I A;  1S1E A;  3BXK A;  1UHN A;  2LUC A;  3DVK A;  2ZFD A;  3L47 A;  4N1G A;  3HX4 A;  3O6B A;  3CS1 A;  1CDL A;  3EKJ A;  5D3O A;  2JT0 A;  2B1U A;  3PJI A;  2QDI A;  4C0K A;  3JTD B;  4N5X A;  2WCL A;  3JTD C;  3NXA A;  2MA2 A;  3DVJ A;  1BOC A;  1WRZ A;  4FQO A;  1BU3 A;  1J7R A;  2GGZ A;  2LP3 A;  4CLN A;  1MXE A;  2CT9 A;  1OSA A;  1B8R A;  4GUK A;  3H4S E;  4PHM A;  3CZ1 A;  4CFR A;  1YUR A;  1GGZ A;  1L2O B;  1AVS A;  2LMV A;  2FJU B;  1DQE A;  5FI7 A;  2I2R E;  3A8R A;  3CWG A;  2M0R A;  4YGB B;  1SCM C;  2F8P A;  2BNX A;  3K1E A;  1KCY A;  3AAK A;  3NSL A;  1F8H A;  1PVB A;  3RM1 A;  1TWO A;  1V1G A;  2H61 C;  4HSZ A;  1BR1 B;  4QJ4 B;  1NCX A;  1FI5 A;  3BOW A;  2CCM A;  3LL8 B;  1YUS A;  1PAL A;  1DJH A;  2KYF A;  1AJ4 A;  1WY9 A;  2QEB A;  2COL B;  1UHI A;  2IS9 A;  2L0P A;  2OS8 C;  3NGV A;  1G8I A;  1SW8 A;  4MZJ A;  1SL8 A;  1ODB A;  1QAT A;  4WQ3 A;  3BUW B;  2LUX A;  2WOS A;  5D69 A;  3SJS A;  2JWW A;  3BJH A;  5I2L A;  2E6W A;  1KWO C;  4PHN A;  4TNC A;  4Q04 A;  1A03 A;  2K61 A;  2NLN A;  1DJX A;  1A75 B;  3I5F C;  1JFJ A;  1B9A A;  4PCW A;  3SG6 A;  2JRF A;  5CSF A;  5JJG A;  5IBW A;  1Y1A A;  3O4Y A;  1QIW A;  4C0J A;  1GQM A;  1M63 B;  4YGE B;  5J3X A;  1S3P A;  2KI4 C;  1ORG A;  1QX2 A;  5HL1 A;  1F71 A;  4PHK A;  1VRK A;  1MQ1 A;  1KK7 Y;  2JNF A;  3B86 A;  2KGB C;  2JTT A;  1C7W A;  2ERB A;  3GK1 A;  1K93 D;  1UP5 A;  1WRK A;  1MXL C;  3VB1 A;  4JPZ B;  1EXR A;  1G33 A;  1FF1 A;  1JFK A;  1B8C A;  2ISD A;  1SMG A;  3DD4 A;  3DF0 B;  1K2H A;  1UUS A;  4DRW A;  1S6C A;  1N65 A;  1X02 A;  3DZT A;  1XFY O;  1TNP A;  2KQY A;  3HCM A;  3TUY B;  1ZOT B;  3WXA A;  1QS7 A;  1DGV A;  4GGF C;  2F33 A;  5FI2 A;  3SG7 A;  1XFX O;  2LVK A;  1AJ5 A;  2JC2 A;  1U5I A;  3S0G A;  3UO9 A;  4M2P A;  1C3Y A;  2WND A;  3CLN A;  1QV1 A;  5DIC A;  2L51 A;  1RTP 1;  1XFV O;  2LHI A;  5AEQ A;  2WCE A;  4IJ7 A;  2LAP A;  2TN4 A;  1S5G Z;  3BOW B;  1MR8 A;  5FI6 A;  4YGC B;  1Y6W A;  2KSP A;  3VGO A;  1DF0 A;  3CZ2 A;  1LIN A;  3PN7 B;  1WLZ A;  1W7I B;  2LHL A;  1XA5 A;  4INX A;  4NDC A;  1KK7 Z;  1V1F A;  3EVR A;  2JQ6 A;  4ICB A;  3SIA A;  1DEL A;  5HLV A;  3FWC A;  2HPS A;  2BCX A;  1T14 A;  4KYN A;  4N1F A;  2O60 A;  4YI9 A;  2JUL A;  5EL2 A;  1YX8 A;  3FE6 A;  4HRH A;  2BBM A;  5KSZ A;  1C3Z A;  2JZI A;  4DIR A;  3I5G B;  5AXI A;  1JF0 A;  4XYN A;  2JT8 A;  2KNE A;  2LM5 A;  2HQ8 A;  4F0Z B;  5GQQ C;  1QAS A;  5ER5 A;  3PLF B;  1PK0 D;  2WCB A;  3TS5 C;  1QLS A;  4I5J A;  4AQI A;  2QAC A;  4XJK A;  1PUL A;  2L2C A;  2G2B A;  2WCM A;  1CMF A;  2JXL A;  2WCH A;  2LLU A;  4OVN F;  3LLE A;  1MHO A;  1IJ6 A;  3WHU B;  1LVC D;  2PYQ A;  2F3Z A;  2AUC A;  1CLM A;  1AHR A;  2LV7 A;  4BY4 A;  2KAV A;  2HET A;  1K8U A;  2E30 A;  2PQL A;  1CFD A;  1F70 A;  2DOQ A;  2M8U A;  3OB1 B;  3EKH A;  1DMO A;  5HKY A;  1YRT B;  1Z4H A;  1GJY A;  3GK4 X;  3NSO A;  1SY9 A;  2O5G A;  3B6X A;  2WCJ A;  2OPO A;  3I5H B;  2OTG B;  4PHJ A;  3IQO A;  1OZS A;  2K2A A;  2LLS A;  3L4A A;  1KFU L;  1DF0 B;  3FIA A;  1CM1 A;  1AK8 A;  1CNP A;  1TUZ A;  1DTL A;  2LCP A;  4WQ2 A;  1SRA A;  1QV0 A;  2BE4 A;  2KLE A;  4P2Y B;  2KFH A;  4C0L A;  2QEO A;  1OOJ A;  1IG5 A;  2MLF C;  1DJY A;  2FJY A;  2P6B B;  3R1V A;  1H4B A;  1Q80 A;  1QX5 B;  3EK4 A;  1N2D A;  2LC5 A;  3BFH A;  5DKR A;  3JVT B;  1NX0 A;  1NP8 A;  1CTR A;  1L2O C;  1OOI X;  4UPG A;  1EH2 A;  4HRE E;  2BEC A;  1JF2 A;  3E3R A;  3F45 A;  3SS5 A;  1MF8 B;  1NX1 A;  1J1D A;  1IWQ A;  1PSB A;  2JT3 A;  2M1U A;  2FCD A;  3QRX A;  1QX7 A;  4WRI A;  1XO5 A;  1A2X A;  4FQT A;  4PE1 A;  1S6J A;  2KYC A;  2M3W A;  3CR5 X;  2KGR A;  3WNX B;  2KOT A;  1BMO A;  4JD9 A;  2M97 A;  4IL1 A;  1QXP A;  3Q8I A;  4MZL A;  1QTX A;  2KBM A;  1F54 A;  2ZRS A;  1KFU S;  2LMT A;  1S6I A;  4USL A;  2BE6 A;  1RRO A;  2WCK A;  2CXJ A;  2F2P A;  2ZKM X;  3NHT A;  3PAT A;  4INW A;  5AAN A;  1Y1X A;  3BUO B;  3NHI A;  2SCP A;  3PAL A;  2M49 B;  2K7C A;  2QEH A;  1NCZ A;  1IQ3 A;  1OOG A;  2H8V A;  4MRX A;  2K7D A;  3AKA A;  1K96 A;  2QPT A;  3BFA A;  4JWQ A;  1CDN A;  2M9G A;  3KPX A;  2LVV A;  3D78 A;  1J55 A;  2BCB A;  3QME A;  1BR4 B;  1QLK A;  1AUI B;  4YGA A;  1J7O A;  1KK8 B;  4R1E A;  1J1E A;  3S0D A;  5I2O A;  4MN0 A;  1AP4 A;  1KK8 C;  2KBI A;  2D8N A;  2Q4U A;  1TNW A;  2K2F A;  2KAX A;  1SR6 B;  3OGN A;  2WC8 A;  3NSK A;  3BUM B;  1CKK A;  3TZ1 A;  1S36 A;  2GV5 A;  4MZK A;  2LLT A;  2LVJ A;  3CTN A;  3A4U B;  4PE0 A;  5ER4 X;  3TUY C;  1YR5 A;  1CFP A;  1DJW A;  2EHB A;  2PMY A;  1XFW O;  1YUT A;  2P71 A;  3GOF A;  1TIZ A;  2L50 A;  1CM4 A;  1KSM A;  1SK6 D;  3L4L A;  2V53 A;  2M7N A;  1XYD A;  4ORC B;  1QVI Y;  2KAY A;  2L2E A;  3K21 A;  1XK4 A;  2MHH A; 
#chains in the Genus database with same CATH homology
 1CDP A;  3TDZ A;  3KEV A;  2VRG A;  1YUU A;  3PSR A;  1IKU A;  4L9M A;  4ORA B;  1CDM A;  1XFU O;  3PN7 C;  1IGV A;  2CTN A;  3PFV A;  5TNC A;  3IQQ A;  3KF9 A;  3SG5 A;  1DJZ A;  1ZAC A;  1E8A A;  3AKB A;  1REC A;  4OR9 B;  1NWD A;  4HRG A;  2NCO A;  3I5G C;  1FW4 A;  1LA3 A;  2GGM A;  1IJ5 A;  1C7V A;  1RFJ A;  1Y0V H;  3D0Y A;  3PM8 A;  1CMG A;  1EG3 A;  1FBV A;  1KQM B;  3C1V A;  2Y1N A;  5JOL A;  1QVI Z;  2WOR A;  1MWN A;  4DCK A;  5CSJ A;  2HQW A;  1SBJ A;  4QJ3 B;  1K9K A;  1N0Y A;  1UHK A;  1CFC A;  4AQJ A;  4CID A;  2L5X B;  1CLL A;  1LKJ A;  2L98 A;  1KFX L;  1NPQ A;  2EC6 B;  3D10 A;  2RGI A;  3NSI A;  4JQ0 D;  2EC6 C;  1SCV A;  1SYM A;  1YRU B;  2PVB A;  2MRD A;  1C07 A;  1SKT A;  2LMU A;  5BPJ A;  1CFF A;  3VRN A;  1BLQ A;  1WDC B;  1U5I B;  4GBA A;  1WDC C;  3OP0 A;  2H61 A;  5K89 A;  3OB2 B;  3I5H C;  1A4P A;  1QJT A;  4NQG A;  1JBA A;  4YGD B;  1SNL A;  2HF5 A;  2OTG C;  4I5N B;  4OKH A;  3M0W A;  2L4H A;  1BG1 A;  1BF5 A;  1NX3 A;  1RJV A;  4I5L B;  5PAL A;  1OZO A;  1W7J B;  1K9P A;  4ORB B;  5G08 A;  1TNX A;  3EVU A;  2PAS A;  1L7Z A;  2KHN A;  4GPL B;  4M2Q A;  4MRY A;  1EG4 A;  3RLZ A;  4MEW A;  1MUX A;  3O2P A;  4NDD A;  2WCF A;  4OV2 A;  1OMR A;  4I5K A;  1FI6 A;  2KFF A;  2BL0 B;  2ZN8 A;  1NCY A;  2ZRT A;  3SG3 A;  3JVT C;  1GGW A;  1ZUZ A;  2ZN9 A;  2H2K A;  1NYA A;  2Y5I A;  3D0Y B;  3TDU A;  2K8M B;  2M1K B;  1K90 D;  1SL7 A;  4XJK B;  3DVE A;  5DKN A;  1CLB A;  1BT6 A;  3MSE B;  3SG2 A;  1R2U A;  3VRO A;  1OE9 B;  1KFX S;  4PE7 A;  1ALW A;  2ZND A;  1F55 A;  5DKQ A;  2KI6 D;  1G4Y R;  2BCA A;  1M46 A;  3ZWH A;  2K0J A;  1PSR A;  2A4J A;  4AOM A;  3DF0 A;  1IQ5 A;  1SPY A;  2JOJ A;  1LXF C;  4BY5 A;  1BOD A;  3BUN B;  4GFT A;  3BUX B;  2MAZ A;  4GGF A;  1TOP A;  3CR4 X;  1SCM B;  1YX7 A;  1Y1U A;  1TCO B;  3AAJ A;  1PVA A;  5B8I B;  2CNP A;  2MLE C;  1KQV A;  3CR2 A;  3VRQ A;  1PRW A;  2BBN A;  1DVI A;  1UHJ A;  5CSI A;  1RWY A;  2FCE A;  5HKZ A;  1OMD A;  3CZT X;  3FWB A;  5KU1 A;  3DVM A;  1HQV A;  4GNK B;  3OHM B;  3ICB A;  3ZNI A;  1YVL A;  4A4C A;  5HKW A;  1B7T Y;  5CPV A;  3SIB A;  2KQ6 A;  2OS8 B;  1OQP A;  5HYD A;  2Y4Q A;  1FPW A;  1TRF A;  1JC2 A;  5KTY A;  1TTX A;  3VRP A;  3BQ3 A;  1KWO B;  3EK7 A;  4U8D A;  1OMV A;  1NX2 A;  5F6T A;  2F2O A;  3I5F B;  1SR6 C;  2JXC A;  3I5I B;  2M7L A;  1UHH A;  1A29 A;  3EVV A;  3I5I C;  2NXQ A;  1ALV A;  1S5G Y;  2BKH B;  1WRL A;  2KI4 B;  2JNX A;  1K94 A;  2M29 A;  5AER A;  1DGU A;  4PDZ A;  5I8N A;  2I7A A;  2K7B A;  4GAO A;  1J7Q A;  1EL4 A;  5D7F A;  4CFQ A;  1ZFS A;  1UUR A;  4D1E A;  2K7O A;  4M2O A;  5CSN A;  1S26 D;  3BYA A;  1F4O A;  1DJI A;  1K95 A;  4DUQ A;  2MBX A;  2LP2 A;  5I2Q A;  2AAO A;  1B7T Z;  1XFZ O;  2CBL A;  1RK9 A;  2L4I A;  3LK1 A;  1NUB A;  4YRU A;  1DT7 B;  1B4C A;  1K9U A;  2G9B A;  1H8B A;  4OCI A;  1JWD A;  4P5O E;  4ZCV A;  1NIW A;  2KI6 C;  1HT9 A;  2JTZ A;  3LK0 A;  4FTG A;  1TCF A;  1YVH A;  3KHE A;  2F3Y A;  4MBE A;  3O78 A;  2MJW B;  2I94 A;  3OX5 A;  3CGA A;  2Q91 A;  1B47 A;  1DJG A;  1YTZ C;  1B8L A;  4E68 A;  1R6P A;  2LAN A;  3LCP C;  4PAL A;  1KQM C;  1CB1 A;  1NSH A;  2I18 A;  2Y1M A;  1BJF A;  2SAS A;  4ZCU A;  1UWO A;  1TN4 A;  1JSA A;  4PE4 A;  5AFP A;  3OX6 A;  4YI8 A;  2BKI B;  1J7P A;  2PAL A;  4GGN A;  1B1G A;  3EK8 A;  5HLO A;  3SG4 A;  3VRR A;  4ETO A;  4NDB A;  2NCP A;  4CPV A;  1F4Q A;  3TS5 B;  2LE9 B;  3WHT B;  1TNQ A;  1XVJ A;  1SL9 A;  2JU0 A;  3KO0 A;  4MLW A;  5FYX A;  2LVI A;  1IH0 A;  4QJ5 B;  1M31 A;  2PRU A;  2LNK A;  2PSR A;  2NZ0 A;  1IRJ A;  1XK4 C;  2AMI A;  2ZNE A;  3FS7 A;  4YBH B;  4DS7 A;  1KSO A;  1QIV A;  2EGD A;  2FOT A;  4MVF A;  1WLM A;  1ZMZ A;  4A4B A;  1EJ3 A;  3TDI A;  1M45 A;  1LA0 A;  3GK2 A;  1D1O A;  1JUO A;  2JPT A;  3IF7 A;  4MSP A;  1A75 A;  2KFG A;  2KDH A;  2BL0 C;  1M39 A;  2R2I A;  1S1E A;  3BXK A;  1UHN A;  2LUC A;  3DVK A;  2ZFD A;  4N1G A;  3HX4 A;  3O6B A;  3CS1 A;  1CDL A;  3EKJ A;  2JT0 A;  2B1U A;  4C0K A;  3JTD B;  4N5X A;  3JTD C;  3NXA A;  2MA2 A;  3DVJ A;  1BOC A;  1WRZ A;  4FQO A;  1BU3 A;  1J7R A;  2GGZ A;  2LP3 A;  4CLN A;  1MXE A;  2CT9 A;  1OSA A;  1B8R A;  4GUK A;  3H4S E;  4PHM A;  4CFR A;  1YUR A;  1GGZ A;  1L2O B;  1AVS A;  2LMV A;  2FJU B;  2I2R E;  3A8R A;  3CWG A;  2M0R A;  4YGB B;  1SCM C;  2F8P A;  1KCY A;  3AAK A;  3NSL A;  1F8H A;  1PVB A;  3RM1 A;  1V1G A;  2H61 C;  4HSZ A;  1BR1 B;  4QJ4 B;  1NCX A;  1FI5 A;  3BOW A;  2CCM A;  3LL8 B;  1YUS A;  1PAL A;  1DJH A;  2KYF A;  1AJ4 A;  1WY9 A;  2COL B;  1UHI A;  2IS9 A;  2L0P A;  2OS8 C;  1G8I A;  1SW8 A;  4MZJ A;  1SL8 A;  1ODB A;  1QAT A;  4WQ3 A;  3BUW B;  2LUX A;  2WOS A;  5D69 A;  3SJS A;  2JWW A;  5I2L A;  2E6W A;  1KWO C;  4PHN A;  4TNC A;  4Q04 A;  1A03 A;  2K61 A;  2NLN A;  1DJX A;  1A75 B;  3I5F C;  1JFJ A;  1B9A A;  4PCW A;  3SG6 A;  2JRF A;  5CSF A;  5JJG A;  5IBW A;  1Y1A A;  3O4Y A;  1QIW A;  4C0J A;  1GQM A;  1M63 B;  4YGE B;  5J3X A;  1S3P A;  2KI4 C;  1QX2 A;  1F71 A;  4PHK A;  1VRK A;  1MQ1 A;  1KK7 Y;  2JNF A;  2KGB C;  2JTT A;  1C7W A;  3GK1 A;  1K93 D;  1UP5 A;  1WRK A;  1MXL C;  4JPZ B;  1EXR A;  1G33 A;  1FF1 A;  1JFK A;  1B8C A;  2ISD A;  1SMG A;  3DD4 A;  3DF0 B;  1K2H A;  1UUS A;  4DRW A;  1S6C A;  1N65 A;  1X02 A;  1XFY O;  1TNP A;  2KQY A;  3HCM A;  3TUY B;  1ZOT B;  3WXA A;  1QS7 A;  1DGV A;  4GGF C;  2F33 A;  3SG7 A;  1XFX O;  2LVK A;  1AJ5 A;  2JC2 A;  1U5I A;  4M2P A;  2WND A;  3CLN A;  1QV1 A;  5AEQ A;  2L51 A;  1RTP 1;  1XFV O;  2LHI A;  2WCE A;  2LAP A;  2TN4 A;  1S5G Z;  3BOW B;  1MR8 A;  4YGC B;  1Y6W A;  2KSP A;  3VGO A;  1DF0 A;  1LIN A;  3PN7 B;  1WLZ A;  1W7I B;  2LHL A;  1XA5 A;  4NDC A;  1KK7 Z;  1V1F A;  3EVR A;  2JQ6 A;  4ICB A;  3SIA A;  5HLV A;  3FWC A;  2HPS A;  2BCX A;  4N1F A;  4YI9 A;  2O60 A;  5KSZ A;  2JUL A;  1YX8 A;  4HRH A;  2BBM A;  2JZI A;  4DIR A;  3I5G B;  5AXI A;  1JF0 A;  4XYN A;  2JT8 A;  2KNE A;  2LM5 A;  2HQ8 A;  4F0Z B;  5GQQ C;  1QAS A;  5ER5 A;  3PLF B;  1PK0 D;  2WCB A;  3TS5 C;  1QLS A;  4I5J A;  4AQI A;  2QAC A;  4XJK A;  1PUL A;  2G2B A;  1CMF A;  2JXL A;  2LLU A;  4OVN F;  3LLE A;  1MHO A;  1IJ6 A;  3WHU B;  1LVC D;  2F3Z A;  2AUC A;  1CLM A;  1AHR A;  2LV7 A;  4BY4 A;  2KAV A;  2HET A;  1K8U A;  2E30 A;  1F70 A;  1CFD A;  2DOQ A;  2M8U A;  3OB1 B;  3EKH A;  1DMO A;  5HKY A;  1YRT B;  1GJY A;  3GK4 X;  3NSO A;  1SY9 A;  2O5G A;  2OPO A;  3I5H B;  2OTG B;  4PHJ A;  3IQO A;  1OZS A;  2K2A A;  2LLS A;  1KFU L;  1DF0 B;  3FIA A;  1CM1 A;  1AK8 A;  1CNP A;  1DTL A;  2LCP A;  4WQ2 A;  1SRA A;  1QV0 A;  2BE4 A;  4P2Y B;  2KFH A;  4C0L A;  1OOJ A;  1IG5 A;  2MLF C;  1DJY A;  2P6B B;  1H4B A;  1Q80 A;  1QX5 B;  3EK4 A;  1N2D A;  2LC5 A;  5DKR A;  3JVT B;  1NX0 A;  1NP8 A;  1CTR A;  1L2O C;  4UPG A;  1EH2 A;  4HRE E;  2BEC A;  1JF2 A;  3E3R A;  3F45 A;  1MF8 B;  1NX1 A;  1J1D A;  1IWQ A;  1PSB A;  2JT3 A;  2M1U A;  2FCD A;  3QRX A;  1QX7 A;  4WRI A;  1XO5 A;  1A2X A;  4PE1 A;  1S6J A;  2KYC A;  2M3W A;  3CR5 X;  2KGR A;  3WNX B;  2KOT A;  1BMO A;  2M97 A;  4IL1 A;  1QXP A;  4MZL A;  1QTX A;  2KBM A;  1F54 A;  2ZRS A;  1KFU S;  2LMT A;  1S6I A;  4USL A;  2BE6 A;  1RRO A;  2CXJ A;  2F2P A;  2ZKM X;  3PAT A;  5AAN A;  1Y1X A;  3BUO B;  2SCP A;  3PAL A;  2M49 B;  2K7C A;  1NCZ A;  1IQ3 A;  4MRX A;  2K7D A;  3AKA A;  1K96 A;  2QPT A;  4JWQ A;  1CDN A;  2M9G A;  3KPX A;  2LVV A;  1J55 A;  2BCB A;  1BR4 B;  1QLK A;  1AUI B;  4YGA A;  1J7O A;  1KK8 B;  4R1E A;  1J1E A;  5I2O A;  1AP4 A;  4MN0 A;  1KK8 C;  2KBI A;  2D8N A;  2Q4U A;  1TNW A;  2K2F A;  2KAX A;  1SR6 B;  2WC8 A;  3NSK A;  3BUM B;  1CKK A;  3TZ1 A;  1S36 A;  2GV5 A;  4MZK A;  2LLT A;  2LVJ A;  3CTN A;  3A4U B;  4PE0 A;  5ER4 X;  3TUY C;  1YR5 A;  1CFP A;  1DJW A;  2EHB A;  2PMY A;  1XFW O;  1YUT A;  3GOF A;  1TIZ A;  2L50 A;  1CM4 A;  1KSM A;  1SK6 D;  2V53 A;  2M7N A;  1XYD A;  4ORC B;  1QVI Y;  2KAY A;  2L2E A;  3K21 A;  1XK4 A;  2MHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...