1IH0A

Structure of the c-domain of human cardiac troponin c in complex with ca2+ sensitizer emd 57033
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
GKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
publication title Structure of the C-domain of human cardiac troponin C in complex with the Ca2+ sensitizing drug EMD 57033.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1ih0A00
2OTGB 1QV1A 2LUXA 1J1EA 3VRQA 4AOMA 2P6BB 1FPWA 4I5KA 4QJ3B 1QLKA 2LLTA 2MBXA 1F70A 3AAJA 2NCOA 4GGNA 3SG4A 2BCAA 3BUNB 4GGFA 2KQYA 2PALA 2PASA 2I7AA 1SCMB 1NUBA 1NYAA 2EGDA 2WC8A 1NCXA 1NPQA 1QX5B 3K21A 1MUXA 2WOSA 4CLNA 2SCPA 4PHMA 1NX2A 1NIWA 1AHRA 2LLSA 4WRIA 3OB2B 4NDBA 1F71A 3GK4X 1KWOB 3RM1A 2KBMA 1F54A 3PN7B 1L7ZA 2KFFA 2KNEA 1YVHA 3BOWA 1UHIA 3BXKA 2I2RE 2JXLA 2F3ZA 3EVRA 1H4BA 2KYFA 1BT6A 1FW4A 4BY5A 1DGVA 2BL0B 1IGVA 1RROA 2HQ8A 2JT3A 1MR8A 1HQVA 4M2QA 3VGOA 2M1UA 4R1EA 1ZFSA 1TRFA 1XFXO 1YRTB 3BYAA 4HRGA 4YGBB 5ER4X 4L9MA 1DF0A 2M7NA 4FQOA 4MN0A 1DJZA 2L4HA 3CR4X 1YRUB 1CLLA 1CLMA 1OQPA 2BECA 4PHKA 5AEQA 2M9GA 4DRWA 1QATA 2LP3A 4PCWA 2G9BA 4OKHA 2Y1MA 1FI6A 1G4YR 3F45A 3KF9A 3EVVA 1NCZA 3I5GC 2L0PA 2K7BA 1F55A 1A75A 1PK0D 3I5IC 1CDPA 1PVAA 4PHNA 4QJ5B 1SR6C 5CSFA 2FCDA 2K2AA 4MZKA 1M31A 1K9PA 1L2OC 1WDCC 1DJGA 2M97A 4ICBA 2KGBC 2L50A 1OMRA 1RFJA 1CDLA 2JQ6A 2Y5IA 1J7OA 2NLNA 3MSEB 1AVSA 1SL7A 4MEWA 1PULA 1WRKA 3TUYB 2L5XB 4GPLB 1TN4A 3CR5X 1SBJA 2PVBA 4GGFC 3KO0A 1J7PA 1CFPA 2KDHA 3OP0A 3LL8B 1FF1A 1KFUS 1MXLC 1E8AA 5BPJA 1B4CA 1NX1A 4YGCB 1S3PA 1X02A 5KSZA 1G8IA 1JC2A 4F0ZB 1UHJA 2I94A 3GOFA 1MQ1A 2AUCA 2NCPA 5J3XA 5DKNA 4AQJA 1JBAA 2F33A 1QX2A 3JVTC 2E6WA 3OHMB 2JNFA 1FBVA 2KOTA 3FWBA 4GNKB 1SY9A 1KSOA 4DS7A 5I8NA 1DJHA 2OS8C 5HKWA 1PSRA 4OVNF 2Y4QA 1K95A 1SKTA 2DOQA 2K2FA 4OCIA 2LVKA 3TDZA 3NSLA 1BJFA 4DCKA 1RWYA 3LK1A 1DT7B 3CGAA 2KFGA 1EG4A 2KI6C 2CT9A 1LA3A 1YTZC 2B1UA 2LC5A 2LVVA 1CMGA 1KK7Z 5I2OA 1ODBA 4DUQA 5AERA 1SW8A 2D8NA 2M8UA 4JPZB 2BE6A 3VRNA 1DJYA 2LLUA 3CS1A 1QVIZ 3CLNA 2KSPA 1Y1UA 2MRDA 4NDCA 1NWDA 5G08A 2LM5A 1S26D 3DVJA 1A2XA 2LP2A 2K0JA 1IH0A 3NSIA 1S6JA 4PE4A 4YGAA 1KFXS 1KK7Y 4MSPA 1YUSA 2Q91A 2M1KB 2LAPA 5HKYA 2PSRA 4A4CA 5JJGA 2ZFDA 3O4YA 4ORAB 1N0YA 1BF5A 2LNKA 5CSJA 3AKAA 4CIDA 2SASA 1K2HA 2KYCA 4MRYA 2O60A 1K93D 1XK4A 3O78A 4I5LB 4NDDA 1YVLA 1K9UA 1RECA 1QJTA 4UPGA 1SMGA 1M63B 1KSMA 1BMOA 2MA2A 3EVUA 2RGIA 1PALA 5CSIA 1MHOA 1QLSA 1K94A 1QTXA 2EC6B 5HYDA 4CFRA 4MZLA 2L2EA 4DIRA 1LVCD 2IS9A 3FWCA 5I2LA 2PMYA 1PVBA 2ZRTA 3CR2A 4P5OE 4OV2A 2WCBA 3SJSA 4C0KA 3PLFB 3GK1A 1J7QA 3D0YA 4YI9A 1DJWA 2KBIA 2NZ0A 3I5GB 1AUIB 3KHEA 3LCPC 2ZNDA 3I5IB 1MXEA 1K9KA 3H4SE 3PSRA 1C7VA 1C7WA 1G33A 1TNQA 2F2OA 2L51A 4M2OA 1L2OB 1WDCB 1U5IB 1WY9A 2FJUB 1AJ4A 3TS5B 3WHUB 1BLQA 2LANA 4XJKA 4HREE 1OSAA 1AP4A 3FIAA 1R6PA 1OOJA 3VRPA 5GQQC 1ZACA 1F4OA 1KFXL 2JU0A 2QPTA 1A4PA 5HLVA 5KTYA 4YI8A 2JNXA 1YR5A 1H8BA 2K7DA 2KHNA 3IQQA 3ICBA 4HSZA 2ZRSA 2K7CA 1S6IA 2HPSA 1B47A 2R2IA 1K96A 5PALA 2WCEA 3D10A 3SG5A 5K89A 2HETA 3HCMA 2KAYA 3DVMA 1W7IB 1Y1XA 4BY4A 1BR4B 1RTP1 2GGZA 3I5FC 3JVTB 1IRJA 4A4BA 2ZN8A 3DF0B 1M46A 1N65A 5DKRA 2O5GA 2LCPA 4IL1A 4PALA 3PFVA 3RLZA 4GAOA 3A8RA 1XK4C 3M0WA 1AK8A 2KQ6A 3I5HC 3BQ3A 3O6BA 1S36A 3EKJA 1NSHA 1LXFC 2MLEC 4HRHA 1K90D 3PN7C 2MAZA 1XFUO 4MRXA 1OMVA 2ZNEA 2JOJA 1KQVA 1Y1AA 2BKHB 1DF0B 5JOLA 1BU3A 1NP8A 1NX3A 2CCMA 2KAXA 3KEVA 4N5XA 5KU1A 1JF0A 2AMIA 1ZUZA 4WQ3A 1JFKA 3BUOB 1NX0A 4C0LA 1EH2A 1QASA 3AKBA 1AJ5A 4ETOA 1XA5A 3TZ1A 1XFYO 1XFZO 1LINA 3GK2A 5D7FA 1DVIA 2BCBA 4OR9B 1BOCA 1TNPA 4PE1A 1JWDA 2BE4A 5HLOA 2MLFC 3WNXB 1LA0A 4AQIA 1CFCA 2LUCA 4MBEA 2GV5A 3NSKA 1EG3A 1S6CA 4M2PA 1SCVA 4WQ2A 1CFFA 1YX8A 1CLBA 3SIAA 3JTDC 1QXPA 3LLEA 1YX7A 3ZNIA 1S5GZ 1TIZA 5B8IB 2COLB 1A03A 3CTNA 4NQGA 1XFVO 2JULA 1IJ5A 2JT8A 3WHTB 1K8UA 3QRXA 1CB1A 5F6TA 1UHNA 4MLWA 3BUMB 1DTLA 4USLA 1ALWA 3VROA 2M0RA 2F3YA 4PE7A 1CM4A 2K8MB 1UUSA 1GJYA 4FTGA 3EKHA 1PSBA 2H2KA 1XO5A 1S5GY 1ZMZA 1QVIY 3SG7A 3NXAA 1QS7A 1UURA 2LHIA 1A29A 2WNDA 4ORCB 1B7TZ 3SG3A 1SNLA 3DVEA 1D1OA 1Q80A 3C1VA 2VRGA 2JZIA 1W7JB 1CNPA 1SK6D 1GGWA 1KK8C 2ISDA 1BR1B 1IKUA 1LKJA 3KPXA 5HKZA 1Y6WA 3EK7A 3SG2A 1V1GA 1WLMA 1EXRA 2I18A 2KFHA 2H61A 2WCFA 1B7TY 3IF7A 2LHLA 4E68A 1EJ3A 1WRZA 2BBNA 2F8PA 2KI4C 1SR6B 3I5FB 1R2UA 2MHHA 4MVFA 1KQMC 3E3RA 2M7LA 1CMFA 1JSAA 1IQ3A 5AANA 1SL9A 3OX6A 1V1FA 2BCXA 2LMTA 1XVJA 3EK8A 2Y1NA 3FS7A 4ZCVA 4C0JA 1UHKA 3I5HB 3EK4A 1TNXA 1QIWA 2OPOA 1VRKA 2MJWB 2JXCA 1TCFA 5CPVA 3ZWHA 3A4UB 3CZTX 2E30A 1XFWO 3DF0A 1IG5A 1GQMA 4GFTA 2OTGC 2KGRA 2M3WA 1Y0VH 2CBLA 2WORA 2HQWA 2F2PA 2LMUA 2JTTA 2CXJA 1QIVA 1ZOTB 3D0YB 2L4IA 2GGMA 4U8DA 1RJVA 3BOWB 2EC6C 1B9AA 2OS8B 2K7OA 5DKQA 1C07A 1WRLA 1SCMC 2Q4UA 1IWQA 1SYMA 2HF5A 2JWWA 1EL4A 1WLZA 4I5NB 3WXAA 4XJKB 4D1EA 1BODA 1KWOC 1SRAA 1GGZA 1TOPA 1CFDA 1MWNA 1UHHA 1DGUA 4CPVA 1B8CA 1B8RA 1YUUA 4ZCUA 3DVKA 1CDMA 1OZOA 3DD4A 1IQ5A 1J55A 2K61A 3JTDB 3VRRA 4JQ0D 2BL0C 2QACA 1CKKA 4I5JA 3TS5C 4N1GA 4XYNA 2H61C 1SPYA 1J1DA 3PALA 2KAVA 2ZKMX 1JFJA 1M39A 4CFQA 1A75B 2V53A 5I2QA 2G2BA 1IJ6A 2LVJA 2LV7A 2LE9B 4ORBB 5D69A 1OMDA 2BKIB 4YGEB 2L98A 3BUWB 3TDUA 1S1EA 2TN4A 1FI5A 2PRUA 4YRUA 3BUXB 1NCYA 3PM8A 1UWOA 3PATA 1HT9A 1N2DA 1DJIA 1XYDA 2BBMA 2LMVA 2LVIA 1ALVA 2CNPA 3SG6A 2JTZA 2A4JA 1CTRA 3OX5A 2FCEA 3IQOA 3NSOA 4PHJA 1KK8B 2JT0A 5AXIA 1CDNA 1KCYA 2FOTA 4P2YB 2JRFA 5TNCA 2CTNA 3TDIA 1RK9A 1M45A 5CSNA 1B1GA 1DJXA 1YUTA 2M49B 4N1FA 4GBAA 3TUYC 3SIBA 2M29A 3AAKA 4PDZA 1OZSA 1B8LA 1YURA 1DMOA 4MZJA 4GUKA 4Q04A 2ZN9A 2AAOA 2KI4B 2EHBA 1QX7A 1F8HA 3CWGA 1OE9B 4PE0A 1KQMB 1J7RA 4JWQA 1QV0A 4YBHB 3OB1B 2NXQA 5ER5A 4QJ4B 1JF2A 1TCOB 3O2PA 1TTXA 5FYXA 1UP5A 2KI6D 1MF8B 4TNCA 1SL8A 3HX4A 1TNWA 5IBWA 2JPTA 1BG1A 2JC2A 1JUOA 1PRWA 1KFUL 1F4QA 5AFPA 4YGDB 1U5IA 3LK0A 1CM1A
chains in the Genus database with same CATH superfamily
2OTGB 1QV1A 3CYZA 1TWOA 2LUXA 1J1EA 3VRQA 4AOMA 2P6BB 1FPWA 4I5KA 4QJ3B 4PT1A 1QLKA 2LLTA 2MBXA 2QEOA 1F70A 3AAJA 2NCOA 4GGNA 3SG4A 2BCAA 3BUNB 4GGFA 3DZTA 2KQYA 2PALA 2PASA 2I7AA 1SCMB 1NUBA 1NYAA 2EGDA 2WC8A 1NCXA 1NPQA 1QX5B 3K21A 1MUXA 2WOSA 4CLNA 2SCPA 3L4AA 4PHMA 1NX2A 1NIWA 1AHRA 2LLSA 3R72A 3OB2B 4NDBA 4WRIA 1F71A 3V2LA 3GK4X 1KWOB 3RM1A 2KBMA 1F54A 3PN7B 1L7ZA 3VB1A 2KFFA 2KNEA 1YVHA 3BOWA 1UHIA 3BXKA 2I2RE 2JXLA 3O4XA 2F3ZA 3EVRA 1OOHA 1H4BA 3D76A 2KYFA 1BT6A 4IJ7A 1FW4A 4BY5A 5KU1A 3Q8IA 1DGVA 2BL0B 1IGVA 1RROA 2HQ8A 2JT3A 1MR8A 1HQVA 4M2QA 3VGOA 2M1UA 4R1EA 1ZFSA 1TRFA 1XFXO 1YRTB 3BYAA 4HRGA 4YGBB 4JD9A 5ER4X 4L9MA 1DF0A 2M7NA 1LS8A 4FQOA 4MN0A 2ERBA 1DJZA 2L4HA 3CR4X 1YRUB 1CLLA 1CLMA 1OQPA 2BECA 4PHKA 5AEQA 2M9GA 4DRWA 1QATA 2LP3A 4PCWA 2G9BA 3S0GA 4OKHA 2Y1MA 1FI6A 1G4YR 2PYQA 3F45A 3KF9A 3EVVA 1NCZA 3I5GC 2L0PA 2K7BA 1F55A 1A75A 1PK0D 3EG5B 1CDPA 1PVAA 2L5YA 3I5IC 4PHNA 4QJ5B 1SR6C 5CSFA 3S0FA 3B87A 2FCDA 3CABA 2K2AA 4MZKA 1M31A 1K9PA 1L2OC 1WDCC 3QMEA 1DJGA 2M97A 4ICBA 2KGBC 2L50A 1OMRA 1RFJA 1CDLA 2JQ6A 2Y5IA 1J7OA 2NLNA 3MSEB 1AVSA 1SL7A 2FJYA 4MEWA 1PULA 1WRKA 3TUYB 2L5XB 4GPLB 1TN4A 3CR5X 1SBJA 2PVBA 3CDNA 3PM2A 4GGFC 3KO0A 1J7PA 1CFPA 2KDHA 3OP0A 3B86A 3LL8B 1FF1A 1KFUS 1MXLC 1E8AA 5BPJA 3R1PA 1B4CA 3L47A 1NX1A 4YGCB 1S3PA 1X02A 1IIOA 5KSZA 1G8IA 1JC2A 5EL2A 4F0ZB 1UHJA 2I94A 3GOFA 1MQ1A 2AUCA 2NCPA 5J3XA 5DKNA 4AQJA 1JBAA 2F33A 1QX2A 3JVTC 2E6WA 3OHMB 2JNFA 1FBVA 2KOTA 3FWBA 4GNKB 1SY9A 1KSOA 4DS7A 5I8NA 1DJHA 2OS8C 5HKWA 1PSRA 3D78A 2Y4QA 4OVNF 1K95A 1SKTA 2DOQA 2K2FA 4OCIA 2LVKA 3TDZA 3NSLA 1BJFA 4DCKA 1Z2CB 1RWYA 3LK1A 1DT7B 3CGAA 2KFGA 1EG4A 2KI6C 2CT9A 1LA3A 1YTZC 2B1UA 4INXA 2LC5A 2LVVA 1CMGA 1KK7Z 5I2OA 1ODBA 2YGUA 4DUQA 3RZSA 5AERA 2KPHA 1SW8A 2D8NA 2M8UA 4JPZB 2BE6A 2JPOA 3VRNA 1DJYA 2LLUA 3CS1A 1OW4A 1QVIZ 3CLNA 2KSPA 1Y1UA 2MRDA 4NDCA 1NWDA 3NGVA 2LM5A 1S26D 2KLEA 1A2XA 2LP2A 2K0JA 3DVJA 5G08A 1IH0A 3NSIA 1S6JA 4PE4A 4YGAA 1KFXS 1KK7Y 4MSPA 1YUSA 2Q91A 1W9ZA 2M1KB 2LAPA 5HKYA 2PSRA 4A4CA 5JJGA 2ZFDA 3O4YA 4ORAB 1N0YA 1BF5A 2LNKA 5CSJA 3AKAA 4CIDA 2SASA 1K2HA 2KYCA 4MRYA 2O60A 1K93D 1XK4A 3BFBA 3O78A 4I5LB 4NDDA 1YVLA 1K9UA 1RECA 1QJTA 3PJIA 1SMGA 4UPGA 1M63B 2P71A 1KSMA 1BMOA 3D75A 2MA2A 3EVUA 1GM0A 2RGIA 1PALA 5I94A 5CSIA 1MHOA 1QLSA 1K94A 1QTXA 2EC6B 5HYDA 4CFRA 4MZLA 2WCKA 2L2EA 4DIRA 2P70A 1LVCD 2IS9A 3FWCA 5I2LA 2PMYA 1PVBA 2ZRTA 3CR2A 4P5OE 4OV2A 2WCBA 3SJSA 3SS5A 3PLFB 5FI6A 4C0KA 3GK1A 1J7QA 3D0YA 2WCMA 4YI9A 1C3ZA 5DICA 1DJWA 2KBIA 2NZ0A 3I5GB 1AUIB 3KHEA 3LCPC 2ZNDA 3I5IB 1MXEA 1K9KA 3H4SE 3PSRA 1C7VA 1T14A 5FI7A 1C7WA 1G33A 1TNQA 2F2OA 2L51A 4M2OA 1L2OB 1WDCB 1U5IB 1WY9A 2FJUB 1AJ4A 3TS5B 3WHUB 1BLQA 2LANA 4XJKA 4HREE 3N7HA 1OSAA 3OBVA 3FIAA 1R6PA 1AP4A 1OOJA 3VRPA 5GQQC 1ZACA 1F4OA 1KFXL 2JU0A 2QPTA 1A4PA 5HLVA 5KTYA 4YI8A 2JNXA 1XFRA 1YR5A 1H8BA 2K7DA 2KHNA 3L4LA 3IQQA 3ICBA 4HSZA 2ZRSA 2K7CA 1S6IA 2HPSA 1B47A 2R2IA 1K96A 5PALA 2WCEA 3D10A 3SG5A 5K89A 2HETA 3HCMA 3FE6A 2KAYA 3DVMA 1W7IB 1Y1XA 3DXLA 4BY4A 1BR4B 1RTP1 2GGZA 3I5FC 3JVTB 1IRJA 4A4BA 2ZN8A 3DF0B 1M46A 1N65A 5DKRA 2O5GA 2LCPA 4IL1A 2QEVA 4PALA 3PFVA 3RLZA 4GAOA 1P28A 1XK4C 3A8RA 3M0WA 1AK8A 2KQ6A 3I5HC 3BQ3A 3O6BA 1S36A 3DYEA 3EKJA 1NSHA 1LXFC 2MLEC 4HRHA 1K90D 3PN7C 2MAZA 1XFUO 4MRXA 1OMVA 2ZNEA 2JOJA 1KQVA 1Y1AA 2BKHB 1DF0B 5JOLA 1BU3A 1NP8A 1NX3A 1OOGA 2CCMA 2KAXA 3B7AA 3KEVA 4N5XA 1JF0A 2AMIA 1ZUZA 4WQ3A 1JFKA 3BUOB 1NX0A 4C0LA 1EH2A 1QASA 3AKBA 1AJ5A 4ETOA 1XA5A 2KLDA 3TZ1A 1XFYO 1XFZO 3BJHA 1C3YA 1LINA 3GK2A 5D7FA 1DVIA 3D77A 2BCBA 4OR9B 1BOCA 1TNPA 2WCLA 4PE1A 1JWDA 2BE4A 1SSEB 5HLOA 2MLFC 3WNXB 1LA0A 4AQIA 1CFCA 2LUCA 4MBEA 3SS3A 2GV5A 3NSKA 1EG3A 1S6CA 3CZ2A 3BFAA 4M2PA 1SCVA 4WQ2A 1CFFA 4F7FA 1YX8A 1CLBA 3SIAA 3JTDC 1QXPA 3LLEA 1YX7A 3ZNIA 1KCYA 1S5GZ 1TIZA 5B8IB 2COLB 1A03A 3CTNA 4NQGA 1DEKA 1XFVO 2JULA 1OOFA 1IJ5A 2JT8A 3WHTB 1K8UA 3QRXA 1CB1A 5F6TA 1UHNA 4MLWA 3BUMB 1DTLA 4USLA 1ALWA 3VROA 2M0RA 2F3YA 4PE7A 1CM4A 2K8MB 1UUSA 2BAPA 1GJYA 4FTGA 4KYNA 3EKHA 1PSBA 2H2KA 1XO5A 1S5GY 1ZMZA 1QVIY 3SG7A 3NXAA 1QS7A 1UURA 5D3OA 2LHIA 1A29A 2WNDA 4ORCB 1B7TZ 3SG3A 1SNLA 3DVEA 1D1OA 1Q80A 5HL1A 3C1VA 2VRGA 2JZIA 1W7JB 1CNPA 1SK6D 1GGWA 1KK8C 2ISDA 1BR1B 3FE8A 1IKUA 1LKJA 3KPXA 5HKZA 1Y6WA 3EK7A 3SG2A 3IVTA 1V1GA 1WLMA 1EXRA 2I18A 2KFHA 2H61A 2WCFA 1B7TY 3IF7A 3K1EA 2BNXA 3UO9A 2LHLA 4E68A 2GTEA 1EJ3A 1WRZA 2BBNA 2F8PA 2KI4C 1SR6B 3I5FB 1R2UA 2MHHA 4MVFA 3NHTA 1KQMC 3E3RA 2M7LA 4INWA 1CMFA 1DC1A 1JSAA 2QEBA 1IQ3A 5AANA 1SL9A 3OX6A 1V1FA 2BCXA 2LMTA 1XVJA 2WC6A 2Y1NA 3EK8A 3FS7A 4ZCVA 4C0JA 3FE9A 1UHKA 3I5HB 3EK4A 1TNXA 1QIWA 2OPOA 1VRKA 2MJWB 2JXCA 1TCFA 5CPVA 3ZWHA 3A4UB 3CZTX 2E30A 1XFWO 3DF0A 3S0EA 1IG5A 1GQMA 4GFTA 2OTGC 2KGRA 3R1OA 2M3WA 1Y0VH 3S0DA 2CBLA 2WORA 2HQWA 3CZ1A 2F2PA 2WCJA 2LMUA 2JTTA 2CXJA 1QIVA 1ZOTB 3D0YB 2L4IA 2GGMA 4U8DA 1RJVA 3R1VA 1TUJA 2EC6C 3BOWB 1B9AA 2OS8B 2K7OA 5DKQA 1C07A 1WRLA 1SCMC 2Q4UA 1IWQA 1SYMA 2HF5A 2JWWA 1EL4A 3S0AA 1WLZA 4I5NB 3B6XA 2K60A 3WXAA 4XJKB 4D1EA 1BODA 1KWOC 1SRAA 1GGZA 1TOPA 1CFDA 1MWNA 1UHHA 5FI2A 1DGUA 4CPVA 1B8CA 1B8RA 1YUUA 3NHIA 4ZCUA 3DVKA 1CDMA 1OZOA 3DD4A 1IQ5A 1J55A 3S0BA 2L2CA 2K61A 3JTDB 2H8VA 3VRRA 4JQ0D 2BL0C 2QACA 4JKTA 1CKKA 4I5JA 3TS5C 4N1GA 4XYNA 2H61C 1SPYA 1J1DA 3PALA 2KAVA 2ZKMX 1JFJA 4FQTA 1M39A 4CFQA 1A75B 2V53A 1QWVA 5I2QA 2G2BA 1IJ6A 2LVJA 2LV7A 2LE9B 4ORBB 5D69A 1OMDA 2BKIB 3B88A 2L98A 3BUWB 4YGEB 1S1EA 2TN4A 3TDUA 2PRUA 1OOIX 4YRUA 3BUXB 1NCYA 3PM8A 1UWOA 3BFHA 1TUZA 3PATA 1HT9A 1N2DA 4OZDA 1DJIA 1XYDA 2BBMA 2LMVA 2LVIA 2QDIA 1ALVA 2CNPA 3SG6A 2JTZA 2A4JA 1CTRA 3OX5A 2FCEA 1ORGA 3IQOA 3NSOA 1KK8B 2JT0A 4PHJA 5AXIA 1Z4HA 3UNWA 1CDNA 2FOTA 4P2YB 2JRFA 2WC5A 5TNCA 2CTNA 3TDIA 1RK9A 1M45A 5CSNA 1B1GA 3D74A 1DJXA 1YUTA 2M49B 2WCHA 4GBAA 4N1FA 3TUYC 3SIBA 2M29A 3AAKA 4PDZA 1OZSA 1B8LA 1YURA 3D73A 1DMOA 4MZJA 4GUKA 4Q04A 2ZN9A 2AAOA 2KI4B 2EHBA 1QX7A 1F8HA 3CWGA 1OE9B 4PE0A 1KQMB 1J7RA 4JWQA 1QV0A 4YBHB 3OB1B 2NXQA 5ER5A 4QJ4B 1JF2A 1DELA 1TCOB 3O2PA 1TTXA 3DY9A 5FYXA 2QEHA 3SS4A 1UP5A 3OGNA 2KI6D 1MF8B 1FI5A 4TNCA 1SL8A 3HX4A 1TNWA 5IBWA 2JPTA 1BG1A 2JC2A 1DQEA 1JUOA 1PRWA 2PQLA 1KFUL 1F4QA 3CZ0A 5AFPA 4YGDB 1U5IA 3LK0A 1CM1A
chains in the Genus database with same CATH topology
2OTGB 1QV1A 2LUXA 1J1EA 3VRQA 4AOMA 2P6BB 1FPWA 4I5KA 4QJ3B 1QLKA 2LLTA 2MBXA 1F70A 3AAJA 2NCOA 4GGNA 3SG4A 2BCAA 3BUNB 4GGFA 2KQYA 2PALA 2PASA 2I7AA 1SCMB 1NUBA 1NYAA 2EGDA 2WC8A 1NCXA 1NPQA 1QX5B 3K21A 1MUXA 2WOSA 4CLNA 2SCPA 4PHMA 1NX2A 1NIWA 1AHRA 2LLSA 4WRIA 3OB2B 4NDBA 1F71A 3GK4X 1KWOB 3RM1A 2KBMA 1F54A 3PN7B 1L7ZA 2KFFA 2KNEA 1YVHA 3BOWA 1UHIA 3BXKA 2I2RE 2JXLA 2F3ZA 3EVRA 1H4BA 2KYFA 1BT6A 1FW4A 4BY5A 1DGVA 2BL0B 1IGVA 1RROA 2HQ8A 2JT3A 1MR8A 1HQVA 4M2QA 3VGOA 2M1UA 4R1EA 1ZFSA 1TRFA 1XFXO 1YRTB 3BYAA 4HRGA 4YGBB 5ER4X 4L9MA 1DF0A 2M7NA 4FQOA 4MN0A 1DJZA 2L4HA 3CR4X 1YRUB 1CLLA 1CLMA 1OQPA 2BECA 4PHKA 5AEQA 2M9GA 4DRWA 1QATA 2LP3A 4PCWA 2G9BA 4OKHA 2Y1MA 1FI6A 1G4YR 3F45A 3KF9A 3EVVA 1NCZA 3I5GC 2L0PA 2K7BA 1F55A 1A75A 1PK0D 3I5IC 1CDPA 1PVAA 4PHNA 4QJ5B 1SR6C 5CSFA 2FCDA 2K2AA 4MZKA 1M31A 1K9PA 1L2OC 1WDCC 1DJGA 2M97A 4ICBA 2KGBC 2L50A 1OMRA 1RFJA 1CDLA 2JQ6A 2Y5IA 1J7OA 2NLNA 3MSEB 1AVSA 1SL7A 4MEWA 1PULA 1WRKA 3TUYB 2L5XB 4GPLB 1TN4A 3CR5X 1SBJA 2PVBA 4GGFC 3KO0A 1J7PA 1CFPA 2KDHA 3OP0A 3LL8B 1FF1A 1KFUS 1MXLC 1E8AA 5BPJA 1B4CA 1NX1A 4YGCB 1S3PA 1X02A 5KSZA 1G8IA 1JC2A 4F0ZB 1UHJA 2I94A 3GOFA 1MQ1A 2AUCA 2NCPA 5J3XA 5DKNA 4AQJA 1JBAA 2F33A 1QX2A 3JVTC 2E6WA 3OHMB 2JNFA 1FBVA 2KOTA 3FWBA 4GNKB 1SY9A 1KSOA 4DS7A 5I8NA 1DJHA 2OS8C 5HKWA 1PSRA 4OVNF 2Y4QA 1K95A 1SKTA 2DOQA 2K2FA 4OCIA 2LVKA 3TDZA 3NSLA 1BJFA 4DCKA 1RWYA 3LK1A 1DT7B 3CGAA 2KFGA 1EG4A 2KI6C 2CT9A 1LA3A 1YTZC 2B1UA 2LC5A 2LVVA 1CMGA 1KK7Z 5I2OA 1ODBA 4DUQA 5AERA 1SW8A 2D8NA 2M8UA 4JPZB 2BE6A 3VRNA 1DJYA 2LLUA 3CS1A 1QVIZ 3CLNA 2KSPA 1Y1UA 2MRDA 4NDCA 1NWDA 5G08A 2LM5A 1S26D 3DVJA 1A2XA 2LP2A 2K0JA 1IH0A 3NSIA 1S6JA 4PE4A 4YGAA 1KFXS 1KK7Y 4MSPA 1YUSA 2Q91A 2M1KB 2LAPA 5HKYA 2PSRA 4A4CA 5JJGA 2ZFDA 3O4YA 4ORAB 1N0YA 1BF5A 2LNKA 5CSJA 3AKAA 4CIDA 2SASA 1K2HA 2KYCA 4MRYA 2O60A 1K93D 1XK4A 3O78A 4I5LB 4NDDA 1YVLA 1K9UA 1RECA 1QJTA 4UPGA 1SMGA 1M63B 1KSMA 1BMOA 2MA2A 3EVUA 2RGIA 1PALA 5CSIA 1MHOA 1QLSA 1K94A 1QTXA 2EC6B 5HYDA 4CFRA 4MZLA 2L2EA 4DIRA 1LVCD 2IS9A 3FWCA 5I2LA 2PMYA 1PVBA 2ZRTA 3CR2A 4P5OE 4OV2A 2WCBA 3SJSA 4C0KA 3PLFB 3GK1A 1J7QA 3D0YA 4YI9A 1DJWA 2KBIA 2NZ0A 3I5GB 1AUIB 3KHEA 3LCPC 2ZNDA 3I5IB 1MXEA 1K9KA 3H4SE 3PSRA 1C7VA 1C7WA 1G33A 1TNQA 2F2OA 2L51A 4M2OA 1L2OB 1WDCB 1U5IB 1WY9A 2FJUB 1AJ4A 3TS5B 3WHUB 1BLQA 2LANA 4XJKA 4HREE 1OSAA 1AP4A 3FIAA 1R6PA 1OOJA 3VRPA 5GQQC 1ZACA 1F4OA 1KFXL 2JU0A 2QPTA 1A4PA 5HLVA 5KTYA 4YI8A 2JNXA 1YR5A 1H8BA 2K7DA 2KHNA 3IQQA 3ICBA 4HSZA 2ZRSA 2K7CA 1S6IA 2HPSA 1B47A 2R2IA 1K96A 5PALA 2WCEA 3D10A 3SG5A 5K89A 2HETA 3HCMA 2KAYA 3DVMA 1W7IB 1Y1XA 4BY4A 1BR4B 1RTP1 2GGZA 3I5FC 3JVTB 1IRJA 4A4BA 2ZN8A 3DF0B 1M46A 1N65A 5DKRA 2O5GA 2LCPA 4IL1A 4PALA 3PFVA 3RLZA 4GAOA 3A8RA 1XK4C 3M0WA 1AK8A 2KQ6A 3I5HC 3BQ3A 3O6BA 1S36A 3EKJA 1NSHA 1LXFC 2MLEC 4HRHA 1K90D 3PN7C 2MAZA 1XFUO 4MRXA 1OMVA 2ZNEA 2JOJA 1KQVA 1Y1AA 2BKHB 1DF0B 5JOLA 1BU3A 1NP8A 1NX3A 2CCMA 2KAXA 3KEVA 4N5XA 5KU1A 1JF0A 2AMIA 1ZUZA 4WQ3A 1JFKA 3BUOB 1NX0A 4C0LA 1EH2A 1QASA 3AKBA 1AJ5A 4ETOA 1XA5A 3TZ1A 1XFYO 1XFZO 1LINA 3GK2A 5D7FA 1DVIA 2BCBA 4OR9B 1BOCA 1TNPA 4PE1A 1JWDA 2BE4A 5HLOA 2MLFC 3WNXB 1LA0A 4AQIA 1CFCA 2LUCA 4MBEA 2GV5A 3NSKA 1EG3A 1S6CA 4M2PA 1SCVA 4WQ2A 1CFFA 1YX8A 1CLBA 3SIAA 3JTDC 1QXPA 3LLEA 1YX7A 3ZNIA 1S5GZ 1TIZA 5B8IB 2COLB 1A03A 3CTNA 4NQGA 1XFVO 2JULA 1IJ5A 2JT8A 3WHTB 1K8UA 3QRXA 1CB1A 5F6TA 1UHNA 4MLWA 3BUMB 1DTLA 4USLA 1ALWA 3VROA 2M0RA 2F3YA 4PE7A 1CM4A 2K8MB 1UUSA 1GJYA 4FTGA 3EKHA 1PSBA 2H2KA 1XO5A 1S5GY 1ZMZA 1QVIY 3SG7A 3NXAA 1QS7A 1UURA 2LHIA 1A29A 2WNDA 4ORCB 1B7TZ 3SG3A 1SNLA 3DVEA 1D1OA 1Q80A 3C1VA 2VRGA 2JZIA 1W7JB 1CNPA 1SK6D 1GGWA 1KK8C 2ISDA 1BR1B 1IKUA 1LKJA 3KPXA 5HKZA 1Y6WA 3EK7A 3SG2A 1V1GA 1WLMA 1EXRA 2I18A 2KFHA 2H61A 2WCFA 1B7TY 3IF7A 2LHLA 4E68A 1EJ3A 1WRZA 2BBNA 2F8PA 2KI4C 1SR6B 3I5FB 1R2UA 2MHHA 4MVFA 1KQMC 3E3RA 2M7LA 1CMFA 1JSAA 1IQ3A 5AANA 1SL9A 3OX6A 1V1FA 2BCXA 2LMTA 1XVJA 3EK8A 2Y1NA 3FS7A 4ZCVA 4C0JA 1UHKA 3I5HB 3EK4A 1TNXA 1QIWA 2OPOA 1VRKA 2MJWB 2JXCA 1TCFA 5CPVA 3ZWHA 3A4UB 3CZTX 2E30A 1XFWO 3DF0A 1IG5A 1GQMA 4GFTA 2OTGC 2KGRA 2M3WA 1Y0VH 2CBLA 2WORA 2HQWA 2F2PA 2LMUA 2JTTA 2CXJA 1QIVA 1ZOTB 3D0YB 2L4IA 2GGMA 4U8DA 1RJVA 3BOWB 2EC6C 1B9AA 2OS8B 2K7OA 5DKQA 1C07A 1WRLA 1SCMC 2Q4UA 1IWQA 1SYMA 2HF5A 2JWWA 1EL4A 1WLZA 4I5NB 3WXAA 4XJKB 4D1EA 1BODA 1KWOC 1SRAA 1GGZA 1TOPA 1CFDA 1MWNA 1UHHA 1DGUA 4CPVA 1B8CA 1B8RA 1YUUA 4ZCUA 3DVKA 1CDMA 1OZOA 3DD4A 1IQ5A 1J55A 2K61A 3JTDB 3VRRA 4JQ0D 2BL0C 2QACA 1CKKA 4I5JA 3TS5C 4N1GA 4XYNA 2H61C 1SPYA 1J1DA 3PALA 2KAVA 2ZKMX 1JFJA 1M39A 4CFQA 1A75B 2V53A 5I2QA 2G2BA 1IJ6A 2LVJA 2LV7A 2LE9B 4ORBB 5D69A 1OMDA 2BKIB 4YGEB 2L98A 3BUWB 3TDUA 1S1EA 2TN4A 1FI5A 2PRUA 4YRUA 3BUXB 1NCYA 3PM8A 1UWOA 3PATA 1HT9A 1N2DA 1DJIA 1XYDA 2BBMA 2LMVA 2LVIA 1ALVA 2CNPA 3SG6A 2JTZA 2A4JA 1CTRA 3OX5A 2FCEA 3IQOA 3NSOA 4PHJA 1KK8B 2JT0A 5AXIA 1CDNA 1KCYA 2FOTA 4P2YB 2JRFA 5TNCA 2CTNA 3TDIA 1RK9A 1M45A 5CSNA 1B1GA 1DJXA 1YUTA 2M49B 4N1FA 4GBAA 3TUYC 3SIBA 2M29A 3AAKA 4PDZA 1OZSA 1B8LA 1YURA 1DMOA 4MZJA 4GUKA 4Q04A 2ZN9A 2AAOA 2KI4B 2EHBA 1QX7A 1F8HA 3CWGA 1OE9B 4PE0A 1KQMB 1J7RA 4JWQA 1QV0A 4YBHB 3OB1B 2NXQA 5ER5A 4QJ4B 1JF2A 1TCOB 3O2PA 1TTXA 5FYXA 1UP5A 2KI6D 1MF8B 4TNCA 1SL8A 3HX4A 1TNWA 5IBWA 2JPTA 1BG1A 2JC2A 1JUOA 1PRWA 1KFUL 1F4QA 5AFPA 4YGDB 1U5IA 3LK0A 1CM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTG B;  1QV1 A;  2LUX A;  1J1E A;  3VRQ A;  4AOM A;  2P6B B;  1FPW A;  4I5K A;  4QJ3 B;  1QLK A;  2LLT A;  2MBX A;  1F70 A;  3AAJ A;  2NCO A;  4GGN A;  3SG4 A;  2BCA A;  3BUN B;  4GGF A;  2KQY A;  2PAL A;  2PAS A;  2I7A A;  1SCM B;  1NUB A;  1NYA A;  2EGD A;  2WC8 A;  1NCX A;  1NPQ A;  1QX5 B;  3K21 A;  1MUX A;  2WOS A;  4CLN A;  2SCP A;  4PHM A;  1NX2 A;  1NIW A;  1AHR A;  2LLS A;  4WRI A;  3OB2 B;  4NDB A;  1F71 A;  3GK4 X;  1KWO B;  3RM1 A;  2KBM A;  1F54 A;  3PN7 B;  1L7Z A;  2KFF A;  2KNE A;  1YVH A;  3BOW A;  1UHI A;  3BXK A;  2I2R E;  2JXL A;  2F3Z A;  3EVR A;  1H4B A;  2KYF A;  1BT6 A;  1FW4 A;  4BY5 A;  1DGV A;  2BL0 B;  1IGV A;  1RRO A;  2HQ8 A;  2JT3 A;  1MR8 A;  1HQV A;  4M2Q A;  3VGO A;  2M1U A;  4R1E A;  1ZFS A;  1TRF A;  1XFX O;  1YRT B;  3BYA A;  4HRG A;  4YGB B;  5ER4 X;  4L9M A;  1DF0 A;  2M7N A;  4FQO A;  4MN0 A;  1DJZ A;  2L4H A;  3CR4 X;  1YRU B;  1CLL A;  1CLM A;  1OQP A;  2BEC A;  4PHK A;  5AEQ A;  2M9G A;  4DRW A;  1QAT A;  2LP3 A;  4PCW A;  2G9B A;  4OKH A;  2Y1M A;  1FI6 A;  1G4Y R;  3F45 A;  3KF9 A;  3EVV A;  1NCZ A;  3I5G C;  2L0P A;  2K7B A;  1F55 A;  1A75 A;  1PK0 D;  3I5I C;  1CDP A;  1PVA A;  4PHN A;  4QJ5 B;  1SR6 C;  5CSF A;  2FCD A;  2K2A A;  4MZK A;  1M31 A;  1K9P A;  1L2O C;  1WDC C;  1DJG A;  2M97 A;  4ICB A;  2KGB C;  2L50 A;  1OMR A;  1RFJ A;  1CDL A;  2JQ6 A;  2Y5I A;  1J7O A;  2NLN A;  3MSE B;  1AVS A;  1SL7 A;  4MEW A;  1PUL A;  1WRK A;  3TUY B;  2L5X B;  4GPL B;  1TN4 A;  3CR5 X;  1SBJ A;  2PVB A;  4GGF C;  3KO0 A;  1J7P A;  1CFP A;  2KDH A;  3OP0 A;  3LL8 B;  1FF1 A;  1KFU S;  1MXL C;  1E8A A;  5BPJ A;  1B4C A;  1NX1 A;  4YGC B;  1S3P A;  1X02 A;  5KSZ A;  1G8I A;  1JC2 A;  4F0Z B;  1UHJ A;  2I94 A;  3GOF A;  1MQ1 A;  2AUC A;  2NCP A;  5J3X A;  5DKN A;  4AQJ A;  1JBA A;  2F33 A;  1QX2 A;  3JVT C;  2E6W A;  3OHM B;  2JNF A;  1FBV A;  2KOT A;  3FWB A;  4GNK B;  1SY9 A;  1KSO A;  4DS7 A;  5I8N A;  1DJH A;  2OS8 C;  5HKW A;  1PSR A;  4OVN F;  2Y4Q A;  1K95 A;  1SKT A;  2DOQ A;  2K2F A;  4OCI A;  2LVK A;  3TDZ A;  3NSL A;  1BJF A;  4DCK A;  1RWY A;  3LK1 A;  1DT7 B;  3CGA A;  2KFG A;  1EG4 A;  2KI6 C;  2CT9 A;  1LA3 A;  1YTZ C;  2B1U A;  2LC5 A;  2LVV A;  1CMG A;  1KK7 Z;  5I2O A;  1ODB A;  4DUQ A;  5AER A;  1SW8 A;  2D8N A;  2M8U A;  4JPZ B;  2BE6 A;  3VRN A;  1DJY A;  2LLU A;  3CS1 A;  1QVI Z;  3CLN A;  2KSP A;  1Y1U A;  2MRD A;  4NDC A;  1NWD A;  5G08 A;  2LM5 A;  1S26 D;  3DVJ A;  1A2X A;  2LP2 A;  2K0J A;  1IH0 A;  3NSI A;  1S6J A;  4PE4 A;  4YGA A;  1KFX S;  1KK7 Y;  4MSP A;  1YUS A;  2Q91 A;  2M1K B;  2LAP A;  5HKY A;  2PSR A;  4A4C A;  5JJG A;  2ZFD A;  3O4Y A;  4ORA B;  1N0Y A;  1BF5 A;  2LNK A;  5CSJ A;  3AKA A;  4CID A;  2SAS A;  1K2H A;  2KYC A;  4MRY A;  2O60 A;  1K93 D;  1XK4 A;  3O78 A;  4I5L B;  4NDD A;  1YVL A;  1K9U A;  1REC A;  1QJT A;  4UPG A;  1SMG A;  1M63 B;  1KSM A;  1BMO A;  2MA2 A;  3EVU A;  2RGI A;  1PAL A;  5CSI A;  1MHO A;  1QLS A;  1K94 A;  1QTX A;  2EC6 B;  5HYD A;  4CFR A;  4MZL A;  2L2E A;  4DIR A;  1LVC D;  2IS9 A;  3FWC A;  5I2L A;  2PMY A;  1PVB A;  2ZRT A;  3CR2 A;  4P5O E;  4OV2 A;  2WCB A;  3SJS A;  4C0K A;  3PLF B;  3GK1 A;  1J7Q A;  3D0Y A;  4YI9 A;  1DJW A;  2KBI A;  2NZ0 A;  3I5G B;  1AUI B;  3KHE A;  3LCP C;  2ZND A;  3I5I B;  1MXE A;  1K9K A;  3H4S E;  3PSR A;  1C7V A;  1C7W A;  1G33 A;  1TNQ A;  2F2O A;  2L51 A;  4M2O A;  1L2O B;  1WDC B;  1U5I B;  1WY9 A;  2FJU B;  1AJ4 A;  3TS5 B;  3WHU B;  1BLQ A;  2LAN A;  4XJK A;  4HRE E;  1OSA A;  1AP4 A;  3FIA A;  1R6P A;  1OOJ A;  3VRP A;  5GQQ C;  1ZAC A;  1F4O A;  1KFX L;  2JU0 A;  2QPT A;  1A4P A;  5HLV A;  5KTY A;  4YI8 A;  2JNX A;  1YR5 A;  1H8B A;  2K7D A;  2KHN A;  3IQQ A;  3ICB A;  4HSZ A;  2ZRS A;  2K7C A;  1S6I A;  2HPS A;  1B47 A;  2R2I A;  1K96 A;  5PAL A;  2WCE A;  3D10 A;  3SG5 A;  5K89 A;  2HET A;  3HCM A;  2KAY A;  3DVM A;  1W7I B;  1Y1X A;  4BY4 A;  1BR4 B;  1RTP 1;  2GGZ A;  3I5F C;  3JVT B;  1IRJ A;  4A4B A;  2ZN8 A;  3DF0 B;  1M46 A;  1N65 A;  5DKR A;  2O5G A;  2LCP A;  4IL1 A;  4PAL A;  3PFV A;  3RLZ A;  4GAO A;  3A8R A;  1XK4 C;  3M0W A;  1AK8 A;  2KQ6 A;  3I5H C;  3BQ3 A;  3O6B A;  1S36 A;  3EKJ A;  1NSH A;  1LXF C;  2MLE C;  4HRH A;  1K90 D;  3PN7 C;  2MAZ A;  1XFU O;  4MRX A;  1OMV A;  2ZNE A;  2JOJ A;  1KQV A;  1Y1A A;  2BKH B;  1DF0 B;  5JOL A;  1BU3 A;  1NP8 A;  1NX3 A;  2CCM A;  2KAX A;  3KEV A;  4N5X A;  5KU1 A;  1JF0 A;  2AMI A;  1ZUZ A;  4WQ3 A;  1JFK A;  3BUO B;  1NX0 A;  4C0L A;  1EH2 A;  1QAS A;  3AKB A;  1AJ5 A;  4ETO A;  1XA5 A;  3TZ1 A;  1XFY O;  1XFZ O;  1LIN A;  3GK2 A;  5D7F A;  1DVI A;  2BCB A;  4OR9 B;  1BOC A;  1TNP A;  4PE1 A;  1JWD A;  2BE4 A;  5HLO A;  2MLF C;  3WNX B;  1LA0 A;  4AQI A;  1CFC A;  2LUC A;  4MBE A;  2GV5 A;  3NSK A;  1EG3 A;  1S6C A;  4M2P A;  1SCV A;  4WQ2 A;  1CFF A;  1YX8 A;  1CLB A;  3SIA A;  3JTD C;  1QXP A;  3LLE A;  1YX7 A;  3ZNI A;  1S5G Z;  1TIZ A;  5B8I B;  2COL B;  1A03 A;  3CTN A;  4NQG A;  1XFV O;  2JUL A;  1IJ5 A;  2JT8 A;  3WHT B;  1K8U A;  3QRX A;  1CB1 A;  5F6T A;  1UHN A;  4MLW A;  3BUM B;  1DTL A;  4USL A;  1ALW A;  3VRO A;  2M0R A;  2F3Y A;  4PE7 A;  1CM4 A;  2K8M B;  1UUS A;  1GJY A;  4FTG A;  3EKH A;  1PSB A;  2H2K A;  1XO5 A;  1S5G Y;  1ZMZ A;  1QVI Y;  3SG7 A;  3NXA A;  1QS7 A;  1UUR A;  2LHI A;  1A29 A;  2WND A;  4ORC B;  1B7T Z;  3SG3 A;  1SNL A;  3DVE A;  1D1O A;  1Q80 A;  3C1V A;  2VRG A;  2JZI A;  1W7J B;  1CNP A;  1SK6 D;  1GGW A;  1KK8 C;  2ISD A;  1BR1 B;  1IKU A;  1LKJ A;  3KPX A;  5HKZ A;  1Y6W A;  3EK7 A;  3SG2 A;  1V1G A;  1WLM A;  1EXR A;  2I18 A;  2KFH A;  2H61 A;  2WCF A;  1B7T Y;  3IF7 A;  2LHL A;  4E68 A;  1EJ3 A;  1WRZ A;  2BBN A;  2F8P A;  2KI4 C;  1SR6 B;  3I5F B;  1R2U A;  2MHH A;  4MVF A;  1KQM C;  3E3R A;  2M7L A;  1CMF A;  1JSA A;  1IQ3 A;  5AAN A;  1SL9 A;  3OX6 A;  1V1F A;  2BCX A;  2LMT A;  1XVJ A;  3EK8 A;  2Y1N A;  3FS7 A;  4ZCV A;  4C0J A;  1UHK A;  3I5H B;  3EK4 A;  1TNX A;  1QIW A;  2OPO A;  1VRK A;  2MJW B;  2JXC A;  1TCF A;  5CPV A;  3ZWH A;  3A4U B;  3CZT X;  2E30 A;  1XFW O;  3DF0 A;  1IG5 A;  1GQM A;  4GFT A;  2OTG C;  2KGR A;  2M3W A;  1Y0V H;  2CBL A;  2WOR A;  2HQW A;  2F2P A;  2LMU A;  2JTT A;  2CXJ A;  1QIV A;  1ZOT B;  3D0Y B;  2L4I A;  2GGM A;  4U8D A;  1RJV A;  3BOW B;  2EC6 C;  1B9A A;  2OS8 B;  2K7O A;  5DKQ A;  1C07 A;  1WRL A;  1SCM C;  2Q4U A;  1IWQ A;  1SYM A;  2HF5 A;  2JWW A;  1EL4 A;  1WLZ A;  4I5N B;  3WXA A;  4XJK B;  4D1E A;  1BOD A;  1KWO C;  1SRA A;  1GGZ A;  1TOP A;  1CFD A;  1MWN A;  1UHH A;  1DGU A;  4CPV A;  1B8C A;  1B8R A;  1YUU A;  4ZCU A;  3DVK A;  1CDM A;  1OZO A;  3DD4 A;  1IQ5 A;  1J55 A;  2K61 A;  3JTD B;  3VRR A;  4JQ0 D;  2BL0 C;  2QAC A;  1CKK A;  4I5J A;  3TS5 C;  4N1G A;  4XYN A;  2H61 C;  1SPY A;  1J1D A;  3PAL A;  2KAV A;  2ZKM X;  1JFJ A;  1M39 A;  4CFQ A;  1A75 B;  2V53 A;  5I2Q A;  2G2B A;  1IJ6 A;  2LVJ A;  2LV7 A;  2LE9 B;  4ORB B;  5D69 A;  1OMD A;  2BKI B;  4YGE B;  2L98 A;  3BUW B;  3TDU A;  1S1E A;  2TN4 A;  1FI5 A;  2PRU A;  4YRU A;  3BUX B;  1NCY A;  3PM8 A;  1UWO A;  3PAT A;  1HT9 A;  1N2D A;  1DJI A;  1XYD A;  2BBM A;  2LMV A;  2LVI A;  1ALV A;  2CNP A;  3SG6 A;  2JTZ A;  2A4J A;  1CTR A;  3OX5 A;  2FCE A;  3IQO A;  3NSO A;  4PHJ A;  1KK8 B;  2JT0 A;  5AXI A;  1CDN A;  1KCY A;  2FOT A;  4P2Y B;  2JRF A;  5TNC A;  2CTN A;  3TDI A;  1RK9 A;  1M45 A;  5CSN A;  1B1G A;  1DJX A;  1YUT A;  2M49 B;  4N1F A;  4GBA A;  3TUY C;  3SIB A;  2M29 A;  3AAK A;  4PDZ A;  1OZS A;  1B8L A;  1YUR A;  1DMO A;  4MZJ A;  4GUK A;  4Q04 A;  2ZN9 A;  2AAO A;  2KI4 B;  2EHB A;  1QX7 A;  1F8H A;  3CWG A;  1OE9 B;  4PE0 A;  1KQM B;  1J7R A;  4JWQ A;  1QV0 A;  4YBH B;  3OB1 B;  2NXQ A;  5ER5 A;  4QJ4 B;  1JF2 A;  1TCO B;  3O2P A;  1TTX A;  5FYX A;  1UP5 A;  2KI6 D;  1MF8 B;  4TNC A;  1SL8 A;  3HX4 A;  1TNW A;  5IBW A;  2JPT A;  1BG1 A;  2JC2 A;  1JUO A;  1PRW A;  1KFU L;  1F4Q A;  5AFP A;  4YGD B;  1U5I A;  3LK0 A;  1CM1 A; 
#chains in the Genus database with same CATH topology
 2OTG B;  1QV1 A;  3CYZ A;  1TWO A;  2LUX A;  1J1E A;  3VRQ A;  4AOM A;  2P6B B;  1FPW A;  4I5K A;  4QJ3 B;  4PT1 A;  1QLK A;  2LLT A;  2MBX A;  2QEO A;  1F70 A;  3AAJ A;  2NCO A;  4GGN A;  3SG4 A;  2BCA A;  3BUN B;  4GGF A;  3DZT A;  2KQY A;  2PAL A;  2PAS A;  2I7A A;  1SCM B;  1NUB A;  1NYA A;  2EGD A;  2WC8 A;  1NCX A;  1NPQ A;  1QX5 B;  3K21 A;  1MUX A;  2WOS A;  4CLN A;  2SCP A;  3L4A A;  4PHM A;  1NX2 A;  1NIW A;  1AHR A;  2LLS A;  3R72 A;  3OB2 B;  4NDB A;  4WRI A;  1F71 A;  3V2L A;  3GK4 X;  1KWO B;  3RM1 A;  2KBM A;  1F54 A;  3PN7 B;  1L7Z A;  3VB1 A;  2KFF A;  2KNE A;  1YVH A;  3BOW A;  1UHI A;  3BXK A;  2I2R E;  2JXL A;  3O4X A;  2F3Z A;  3EVR A;  1OOH A;  1H4B A;  3D76 A;  2KYF A;  1BT6 A;  4IJ7 A;  1FW4 A;  4BY5 A;  5KU1 A;  3Q8I A;  1DGV A;  2BL0 B;  1IGV A;  1RRO A;  2HQ8 A;  2JT3 A;  1MR8 A;  1HQV A;  4M2Q A;  3VGO A;  2M1U A;  4R1E A;  1ZFS A;  1TRF A;  1XFX O;  1YRT B;  3BYA A;  4HRG A;  4YGB B;  4JD9 A;  5ER4 X;  4L9M A;  1DF0 A;  2M7N A;  1LS8 A;  4FQO A;  4MN0 A;  2ERB A;  1DJZ A;  2L4H A;  3CR4 X;  1YRU B;  1CLL A;  1CLM A;  1OQP A;  2BEC A;  4PHK A;  5AEQ A;  2M9G A;  4DRW A;  1QAT A;  2LP3 A;  4PCW A;  2G9B A;  3S0G A;  4OKH A;  2Y1M A;  1FI6 A;  1G4Y R;  2PYQ A;  3F45 A;  3KF9 A;  3EVV A;  1NCZ A;  3I5G C;  2L0P A;  2K7B A;  1F55 A;  1A75 A;  1PK0 D;  3EG5 B;  1CDP A;  1PVA A;  2L5Y A;  3I5I C;  4PHN A;  4QJ5 B;  1SR6 C;  5CSF A;  3S0F A;  3B87 A;  2FCD A;  3CAB A;  2K2A A;  4MZK A;  1M31 A;  1K9P A;  1L2O C;  1WDC C;  3QME A;  1DJG A;  2M97 A;  4ICB A;  2KGB C;  2L50 A;  1OMR A;  1RFJ A;  1CDL A;  2JQ6 A;  2Y5I A;  1J7O A;  2NLN A;  3MSE B;  1AVS A;  1SL7 A;  2FJY A;  4MEW A;  1PUL A;  1WRK A;  3TUY B;  2L5X B;  4GPL B;  1TN4 A;  3CR5 X;  1SBJ A;  2PVB A;  3CDN A;  3PM2 A;  4GGF C;  3KO0 A;  1J7P A;  1CFP A;  2KDH A;  3OP0 A;  3B86 A;  3LL8 B;  1FF1 A;  1KFU S;  1MXL C;  1E8A A;  5BPJ A;  3R1P A;  1B4C A;  3L47 A;  1NX1 A;  4YGC B;  1S3P A;  1X02 A;  1IIO A;  5KSZ A;  1G8I A;  1JC2 A;  5EL2 A;  4F0Z B;  1UHJ A;  2I94 A;  3GOF A;  1MQ1 A;  2AUC A;  2NCP A;  5J3X A;  5DKN A;  4AQJ A;  1JBA A;  2F33 A;  1QX2 A;  3JVT C;  2E6W A;  3OHM B;  2JNF A;  1FBV A;  2KOT A;  3FWB A;  4GNK B;  1SY9 A;  1KSO A;  4DS7 A;  5I8N A;  1DJH A;  2OS8 C;  5HKW A;  1PSR A;  3D78 A;  2Y4Q A;  4OVN F;  1K95 A;  1SKT A;  2DOQ A;  2K2F A;  4OCI A;  2LVK A;  3TDZ A;  3NSL A;  1BJF A;  4DCK A;  1Z2C B;  1RWY A;  3LK1 A;  1DT7 B;  3CGA A;  2KFG A;  1EG4 A;  2KI6 C;  2CT9 A;  1LA3 A;  1YTZ C;  2B1U A;  4INX A;  2LC5 A;  2LVV A;  1CMG A;  1KK7 Z;  5I2O A;  1ODB A;  2YGU A;  4DUQ A;  3RZS A;  5AER A;  2KPH A;  1SW8 A;  2D8N A;  2M8U A;  4JPZ B;  2BE6 A;  2JPO A;  3VRN A;  1DJY A;  2LLU A;  3CS1 A;  1OW4 A;  1QVI Z;  3CLN A;  2KSP A;  1Y1U A;  2MRD A;  4NDC A;  1NWD A;  3NGV A;  2LM5 A;  1S26 D;  2KLE A;  1A2X A;  2LP2 A;  2K0J A;  3DVJ A;  5G08 A;  1IH0 A;  3NSI A;  1S6J A;  4PE4 A;  4YGA A;  1KFX S;  1KK7 Y;  4MSP A;  1YUS A;  2Q91 A;  1W9Z A;  2M1K B;  2LAP A;  5HKY A;  2PSR A;  4A4C A;  5JJG A;  2ZFD A;  3O4Y A;  4ORA B;  1N0Y A;  1BF5 A;  2LNK A;  5CSJ A;  3AKA A;  4CID A;  2SAS A;  1K2H A;  2KYC A;  4MRY A;  2O60 A;  1K93 D;  1XK4 A;  3BFB A;  3O78 A;  4I5L B;  4NDD A;  1YVL A;  1K9U A;  1REC A;  1QJT A;  3PJI A;  1SMG A;  4UPG A;  1M63 B;  2P71 A;  1KSM A;  1BMO A;  3D75 A;  2MA2 A;  3EVU A;  1GM0 A;  2RGI A;  1PAL A;  5I94 A;  5CSI A;  1MHO A;  1QLS A;  1K94 A;  1QTX A;  2EC6 B;  5HYD A;  4CFR A;  4MZL A;  2WCK A;  2L2E A;  4DIR A;  2P70 A;  1LVC D;  2IS9 A;  3FWC A;  5I2L A;  2PMY A;  1PVB A;  2ZRT A;  3CR2 A;  4P5O E;  4OV2 A;  2WCB A;  3SJS A;  3SS5 A;  3PLF B;  5FI6 A;  4C0K A;  3GK1 A;  1J7Q A;  3D0Y A;  2WCM A;  4YI9 A;  1C3Z A;  5DIC A;  1DJW A;  2KBI A;  2NZ0 A;  3I5G B;  1AUI B;  3KHE A;  3LCP C;  2ZND A;  3I5I B;  1MXE A;  1K9K A;  3H4S E;  3PSR A;  1C7V A;  1T14 A;  5FI7 A;  1C7W A;  1G33 A;  1TNQ A;  2F2O A;  2L51 A;  4M2O A;  1L2O B;  1WDC B;  1U5I B;  1WY9 A;  2FJU B;  1AJ4 A;  3TS5 B;  3WHU B;  1BLQ A;  2LAN A;  4XJK A;  4HRE E;  3N7H A;  1OSA A;  3OBV A;  3FIA A;  1R6P A;  1AP4 A;  1OOJ A;  3VRP A;  5GQQ C;  1ZAC A;  1F4O A;  1KFX L;  2JU0 A;  2QPT A;  1A4P A;  5HLV A;  5KTY A;  4YI8 A;  2JNX A;  1XFR A;  1YR5 A;  1H8B A;  2K7D A;  2KHN A;  3L4L A;  3IQQ A;  3ICB A;  4HSZ A;  2ZRS A;  2K7C A;  1S6I A;  2HPS A;  1B47 A;  2R2I A;  1K96 A;  5PAL A;  2WCE A;  3D10 A;  3SG5 A;  5K89 A;  2HET A;  3HCM A;  3FE6 A;  2KAY A;  3DVM A;  1W7I B;  1Y1X A;  3DXL A;  4BY4 A;  1BR4 B;  1RTP 1;  2GGZ A;  3I5F C;  3JVT B;  1IRJ A;  4A4B A;  2ZN8 A;  3DF0 B;  1M46 A;  1N65 A;  5DKR A;  2O5G A;  2LCP A;  4IL1 A;  2QEV A;  4PAL A;  3PFV A;  3RLZ A;  4GAO A;  1P28 A;  1XK4 C;  3A8R A;  3M0W A;  1AK8 A;  2KQ6 A;  3I5H C;  3BQ3 A;  3O6B A;  1S36 A;  3DYE A;  3EKJ A;  1NSH A;  1LXF C;  2MLE C;  4HRH A;  1K90 D;  3PN7 C;  2MAZ A;  1XFU O;  4MRX A;  1OMV A;  2ZNE A;  2JOJ A;  1KQV A;  1Y1A A;  2BKH B;  1DF0 B;  5JOL A;  1BU3 A;  1NP8 A;  1NX3 A;  1OOG A;  2CCM A;  2KAX A;  3B7A A;  3KEV A;  4N5X A;  1JF0 A;  2AMI A;  1ZUZ A;  4WQ3 A;  1JFK A;  3BUO B;  1NX0 A;  4C0L A;  1EH2 A;  1QAS A;  3AKB A;  1AJ5 A;  4ETO A;  1XA5 A;  2KLD A;  3TZ1 A;  1XFY O;  1XFZ O;  3BJH A;  1C3Y A;  1LIN A;  3GK2 A;  5D7F A;  1DVI A;  3D77 A;  2BCB A;  4OR9 B;  1BOC A;  1TNP A;  2WCL A;  4PE1 A;  1JWD A;  2BE4 A;  1SSE B;  5HLO A;  2MLF C;  3WNX B;  1LA0 A;  4AQI A;  1CFC A;  2LUC A;  4MBE A;  3SS3 A;  2GV5 A;  3NSK A;  1EG3 A;  1S6C A;  3CZ2 A;  3BFA A;  4M2P A;  1SCV A;  4WQ2 A;  1CFF A;  4F7F A;  1YX8 A;  1CLB A;  3SIA A;  3JTD C;  1QXP A;  3LLE A;  1YX7 A;  3ZNI A;  1KCY A;  1S5G Z;  1TIZ A;  5B8I B;  2COL B;  1A03 A;  3CTN A;  4NQG A;  1DEK A;  1XFV O;  2JUL A;  1OOF A;  1IJ5 A;  2JT8 A;  3WHT B;  1K8U A;  3QRX A;  1CB1 A;  5F6T A;  1UHN A;  4MLW A;  3BUM B;  1DTL A;  4USL A;  1ALW A;  3VRO A;  2M0R A;  2F3Y A;  4PE7 A;  1CM4 A;  2K8M B;  1UUS A;  2BAP A;  1GJY A;  4FTG A;  4KYN A;  3EKH A;  1PSB A;  2H2K A;  1XO5 A;  1S5G Y;  1ZMZ A;  1QVI Y;  3SG7 A;  3NXA A;  1QS7 A;  1UUR A;  5D3O A;  2LHI A;  1A29 A;  2WND A;  4ORC B;  1B7T Z;  3SG3 A;  1SNL A;  3DVE A;  1D1O A;  1Q80 A;  5HL1 A;  3C1V A;  2VRG A;  2JZI A;  1W7J B;  1CNP A;  1SK6 D;  1GGW A;  1KK8 C;  2ISD A;  1BR1 B;  3FE8 A;  1IKU A;  1LKJ A;  3KPX A;  5HKZ A;  1Y6W A;  3EK7 A;  3SG2 A;  3IVT A;  1V1G A;  1WLM A;  1EXR A;  2I18 A;  2KFH A;  2H61 A;  2WCF A;  1B7T Y;  3IF7 A;  3K1E A;  2BNX A;  3UO9 A;  2LHL A;  4E68 A;  2GTE A;  1EJ3 A;  1WRZ A;  2BBN A;  2F8P A;  2KI4 C;  1SR6 B;  3I5F B;  1R2U A;  2MHH A;  4MVF A;  3NHT A;  1KQM C;  3E3R A;  2M7L A;  4INW A;  1CMF A;  1DC1 A;  1JSA A;  2QEB A;  1IQ3 A;  5AAN A;  1SL9 A;  3OX6 A;  1V1F A;  2BCX A;  2LMT A;  1XVJ A;  2WC6 A;  2Y1N A;  3EK8 A;  3FS7 A;  4ZCV A;  4C0J A;  3FE9 A;  1UHK A;  3I5H B;  3EK4 A;  1TNX A;  1QIW A;  2OPO A;  1VRK A;  2MJW B;  2JXC A;  1TCF A;  5CPV A;  3ZWH A;  3A4U B;  3CZT X;  2E30 A;  1XFW O;  3DF0 A;  3S0E A;  1IG5 A;  1GQM A;  4GFT A;  2OTG C;  2KGR A;  3R1O A;  2M3W A;  1Y0V H;  3S0D A;  2CBL A;  2WOR A;  2HQW A;  3CZ1 A;  2F2P A;  2WCJ A;  2LMU A;  2JTT A;  2CXJ A;  1QIV A;  1ZOT B;  3D0Y B;  2L4I A;  2GGM A;  4U8D A;  1RJV A;  3R1V A;  1TUJ A;  2EC6 C;  3BOW B;  1B9A A;  2OS8 B;  2K7O A;  5DKQ A;  1C07 A;  1WRL A;  1SCM C;  2Q4U A;  1IWQ A;  1SYM A;  2HF5 A;  2JWW A;  1EL4 A;  3S0A A;  1WLZ A;  4I5N B;  3B6X A;  2K60 A;  3WXA A;  4XJK B;  4D1E A;  1BOD A;  1KWO C;  1SRA A;  1GGZ A;  1TOP A;  1CFD A;  1MWN A;  1UHH A;  5FI2 A;  1DGU A;  4CPV A;  1B8C A;  1B8R A;  1YUU A;  3NHI A;  4ZCU A;  3DVK A;  1CDM A;  1OZO A;  3DD4 A;  1IQ5 A;  1J55 A;  3S0B A;  2L2C A;  2K61 A;  3JTD B;  2H8V A;  3VRR A;  4JQ0 D;  2BL0 C;  2QAC A;  4JKT A;  1CKK A;  4I5J A;  3TS5 C;  4N1G A;  4XYN A;  2H61 C;  1SPY A;  1J1D A;  3PAL A;  2KAV A;  2ZKM X;  1JFJ A;  4FQT A;  1M39 A;  4CFQ A;  1A75 B;  2V53 A;  1QWV A;  5I2Q A;  2G2B A;  1IJ6 A;  2LVJ A;  2LV7 A;  2LE9 B;  4ORB B;  5D69 A;  1OMD A;  2BKI B;  3B88 A;  2L98 A;  3BUW B;  4YGE B;  1S1E A;  2TN4 A;  3TDU A;  2PRU A;  1OOI X;  4YRU A;  3BUX B;  1NCY A;  3PM8 A;  1UWO A;  3BFH A;  1TUZ A;  3PAT A;  1HT9 A;  1N2D A;  4OZD A;  1DJI A;  1XYD A;  2BBM A;  2LMV A;  2LVI A;  2QDI A;  1ALV A;  2CNP A;  3SG6 A;  2JTZ A;  2A4J A;  1CTR A;  3OX5 A;  2FCE A;  1ORG A;  3IQO A;  3NSO A;  1KK8 B;  2JT0 A;  4PHJ A;  5AXI A;  1Z4H A;  3UNW A;  1CDN A;  2FOT A;  4P2Y B;  2JRF A;  2WC5 A;  5TNC A;  2CTN A;  3TDI A;  1RK9 A;  1M45 A;  5CSN A;  1B1G A;  3D74 A;  1DJX A;  1YUT A;  2M49 B;  2WCH A;  4GBA A;  4N1F A;  3TUY C;  3SIB A;  2M29 A;  3AAK A;  4PDZ A;  1OZS A;  1B8L A;  1YUR A;  3D73 A;  1DMO A;  4MZJ A;  4GUK A;  4Q04 A;  2ZN9 A;  2AAO A;  2KI4 B;  2EHB A;  1QX7 A;  1F8H A;  3CWG A;  1OE9 B;  4PE0 A;  1KQM B;  1J7R A;  4JWQ A;  1QV0 A;  4YBH B;  3OB1 B;  2NXQ A;  5ER5 A;  4QJ4 B;  1JF2 A;  1DEL A;  1TCO B;  3O2P A;  1TTX A;  3DY9 A;  5FYX A;  2QEH A;  3SS4 A;  1UP5 A;  3OGN A;  2KI6 D;  1MF8 B;  1FI5 A;  4TNC A;  1SL8 A;  3HX4 A;  1TNW A;  5IBW A;  2JPT A;  1BG1 A;  2JC2 A;  1DQE A;  1JUO A;  1PRW A;  2PQL A;  1KFU L;  1F4Q A;  3CZ0 A;  5AFP A;  4YGD B;  1U5I A;  3LK0 A;  1CM1 A; 
#chains in the Genus database with same CATH homology
 2OTG B;  1QV1 A;  2LUX A;  1J1E A;  3VRQ A;  4AOM A;  2P6B B;  1FPW A;  4I5K A;  4QJ3 B;  1QLK A;  2LLT A;  2MBX A;  1F70 A;  3AAJ A;  2NCO A;  4GGN A;  3SG4 A;  2BCA A;  3BUN B;  4GGF A;  2KQY A;  2PAL A;  2PAS A;  2I7A A;  1SCM B;  1NUB A;  1NYA A;  2EGD A;  2WC8 A;  1NCX A;  1NPQ A;  1QX5 B;  3K21 A;  1MUX A;  2WOS A;  4CLN A;  2SCP A;  4PHM A;  1NX2 A;  1NIW A;  1AHR A;  2LLS A;  4WRI A;  3OB2 B;  4NDB A;  1F71 A;  3GK4 X;  1KWO B;  3RM1 A;  2KBM A;  1F54 A;  3PN7 B;  1L7Z A;  2KFF A;  2KNE A;  1YVH A;  3BOW A;  1UHI A;  3BXK A;  2I2R E;  2JXL A;  2F3Z A;  3EVR A;  1H4B A;  2KYF A;  1BT6 A;  1FW4 A;  4BY5 A;  1DGV A;  2BL0 B;  1IGV A;  1RRO A;  2HQ8 A;  2JT3 A;  1MR8 A;  1HQV A;  4M2Q A;  3VGO A;  2M1U A;  4R1E A;  1ZFS A;  1TRF A;  1XFX O;  1YRT B;  3BYA A;  4HRG A;  4YGB B;  5ER4 X;  4L9M A;  1DF0 A;  2M7N A;  4FQO A;  4MN0 A;  1DJZ A;  2L4H A;  3CR4 X;  1YRU B;  1CLL A;  1CLM A;  1OQP A;  2BEC A;  4PHK A;  5AEQ A;  2M9G A;  4DRW A;  1QAT A;  2LP3 A;  4PCW A;  2G9B A;  4OKH A;  2Y1M A;  1FI6 A;  1G4Y R;  3F45 A;  3KF9 A;  3EVV A;  1NCZ A;  3I5G C;  2L0P A;  2K7B A;  1F55 A;  1A75 A;  1PK0 D;  3I5I C;  1CDP A;  1PVA A;  4PHN A;  4QJ5 B;  1SR6 C;  5CSF A;  2FCD A;  2K2A A;  4MZK A;  1M31 A;  1K9P A;  1L2O C;  1WDC C;  1DJG A;  2M97 A;  4ICB A;  2KGB C;  2L50 A;  1OMR A;  1RFJ A;  1CDL A;  2JQ6 A;  2Y5I A;  1J7O A;  2NLN A;  3MSE B;  1AVS A;  1SL7 A;  4MEW A;  1PUL A;  1WRK A;  3TUY B;  2L5X B;  4GPL B;  1TN4 A;  3CR5 X;  1SBJ A;  2PVB A;  4GGF C;  3KO0 A;  1J7P A;  1CFP A;  2KDH A;  3OP0 A;  3LL8 B;  1FF1 A;  1KFU S;  1MXL C;  1E8A A;  5BPJ A;  1B4C A;  1NX1 A;  4YGC B;  1S3P A;  1X02 A;  5KSZ A;  1G8I A;  1JC2 A;  4F0Z B;  1UHJ A;  2I94 A;  3GOF A;  1MQ1 A;  2AUC A;  2NCP A;  5J3X A;  5DKN A;  4AQJ A;  1JBA A;  2F33 A;  1QX2 A;  3JVT C;  2E6W A;  3OHM B;  2JNF A;  1FBV A;  2KOT A;  3FWB A;  4GNK B;  1SY9 A;  1KSO A;  4DS7 A;  5I8N A;  1DJH A;  2OS8 C;  5HKW A;  1PSR A;  4OVN F;  2Y4Q A;  1K95 A;  1SKT A;  2DOQ A;  2K2F A;  4OCI A;  2LVK A;  3TDZ A;  3NSL A;  1BJF A;  4DCK A;  1RWY A;  3LK1 A;  1DT7 B;  3CGA A;  2KFG A;  1EG4 A;  2KI6 C;  2CT9 A;  1LA3 A;  1YTZ C;  2B1U A;  2LC5 A;  2LVV A;  1CMG A;  1KK7 Z;  5I2O A;  1ODB A;  4DUQ A;  5AER A;  1SW8 A;  2D8N A;  2M8U A;  4JPZ B;  2BE6 A;  3VRN A;  1DJY A;  2LLU A;  3CS1 A;  1QVI Z;  3CLN A;  2KSP A;  1Y1U A;  2MRD A;  4NDC A;  1NWD A;  5G08 A;  2LM5 A;  1S26 D;  3DVJ A;  1A2X A;  2LP2 A;  2K0J A;  1IH0 A;  3NSI A;  1S6J A;  4PE4 A;  4YGA A;  1KFX S;  1KK7 Y;  4MSP A;  1YUS A;  2Q91 A;  2M1K B;  2LAP A;  5HKY A;  2PSR A;  4A4C A;  5JJG A;  2ZFD A;  3O4Y A;  4ORA B;  1N0Y A;  1BF5 A;  2LNK A;  5CSJ A;  3AKA A;  4CID A;  2SAS A;  1K2H A;  2KYC A;  4MRY A;  2O60 A;  1K93 D;  1XK4 A;  3O78 A;  4I5L B;  4NDD A;  1YVL A;  1K9U A;  1REC A;  1QJT A;  4UPG A;  1SMG A;  1M63 B;  1KSM A;  1BMO A;  2MA2 A;  3EVU A;  2RGI A;  1PAL A;  5CSI A;  1MHO A;  1QLS A;  1K94 A;  1QTX A;  2EC6 B;  5HYD A;  4CFR A;  4MZL A;  2L2E A;  4DIR A;  1LVC D;  2IS9 A;  3FWC A;  5I2L A;  2PMY A;  1PVB A;  2ZRT A;  3CR2 A;  4P5O E;  4OV2 A;  2WCB A;  3SJS A;  4C0K A;  3PLF B;  3GK1 A;  1J7Q A;  3D0Y A;  4YI9 A;  1DJW A;  2KBI A;  2NZ0 A;  3I5G B;  1AUI B;  3KHE A;  3LCP C;  2ZND A;  3I5I B;  1MXE A;  1K9K A;  3H4S E;  3PSR A;  1C7V A;  1C7W A;  1G33 A;  1TNQ A;  2F2O A;  2L51 A;  4M2O A;  1L2O B;  1WDC B;  1U5I B;  1WY9 A;  2FJU B;  1AJ4 A;  3TS5 B;  3WHU B;  1BLQ A;  2LAN A;  4XJK A;  4HRE E;  1OSA A;  1AP4 A;  3FIA A;  1R6P A;  1OOJ A;  3VRP A;  5GQQ C;  1ZAC A;  1F4O A;  1KFX L;  2JU0 A;  2QPT A;  1A4P A;  5HLV A;  5KTY A;  4YI8 A;  2JNX A;  1YR5 A;  1H8B A;  2K7D A;  2KHN A;  3IQQ A;  3ICB A;  4HSZ A;  2ZRS A;  2K7C A;  1S6I A;  2HPS A;  1B47 A;  2R2I A;  1K96 A;  5PAL A;  2WCE A;  3D10 A;  3SG5 A;  5K89 A;  2HET A;  3HCM A;  2KAY A;  3DVM A;  1W7I B;  1Y1X A;  4BY4 A;  1BR4 B;  1RTP 1;  2GGZ A;  3I5F C;  3JVT B;  1IRJ A;  4A4B A;  2ZN8 A;  3DF0 B;  1M46 A;  1N65 A;  5DKR A;  2O5G A;  2LCP A;  4IL1 A;  4PAL A;  3PFV A;  3RLZ A;  4GAO A;  3A8R A;  1XK4 C;  3M0W A;  1AK8 A;  2KQ6 A;  3I5H C;  3BQ3 A;  3O6B A;  1S36 A;  3EKJ A;  1NSH A;  1LXF C;  2MLE C;  4HRH A;  1K90 D;  3PN7 C;  2MAZ A;  1XFU O;  4MRX A;  1OMV A;  2ZNE A;  2JOJ A;  1KQV A;  1Y1A A;  2BKH B;  1DF0 B;  5JOL A;  1BU3 A;  1NP8 A;  1NX3 A;  2CCM A;  2KAX A;  3KEV A;  4N5X A;  5KU1 A;  1JF0 A;  2AMI A;  1ZUZ A;  4WQ3 A;  1JFK A;  3BUO B;  1NX0 A;  4C0L A;  1EH2 A;  1QAS A;  3AKB A;  1AJ5 A;  4ETO A;  1XA5 A;  3TZ1 A;  1XFY O;  1XFZ O;  1LIN A;  3GK2 A;  5D7F A;  1DVI A;  2BCB A;  4OR9 B;  1BOC A;  1TNP A;  4PE1 A;  1JWD A;  2BE4 A;  5HLO A;  2MLF C;  3WNX B;  1LA0 A;  4AQI A;  1CFC A;  2LUC A;  4MBE A;  2GV5 A;  3NSK A;  1EG3 A;  1S6C A;  4M2P A;  1SCV A;  4WQ2 A;  1CFF A;  1YX8 A;  1CLB A;  3SIA A;  3JTD C;  1QXP A;  3LLE A;  1YX7 A;  3ZNI A;  1S5G Z;  1TIZ A;  5B8I B;  2COL B;  1A03 A;  3CTN A;  4NQG A;  1XFV O;  2JUL A;  1IJ5 A;  2JT8 A;  3WHT B;  1K8U A;  3QRX A;  1CB1 A;  5F6T A;  1UHN A;  4MLW A;  3BUM B;  1DTL A;  4USL A;  1ALW A;  3VRO A;  2M0R A;  2F3Y A;  4PE7 A;  1CM4 A;  2K8M B;  1UUS A;  1GJY A;  4FTG A;  3EKH A;  1PSB A;  2H2K A;  1XO5 A;  1S5G Y;  1ZMZ A;  1QVI Y;  3SG7 A;  3NXA A;  1QS7 A;  1UUR A;  2LHI A;  1A29 A;  2WND A;  4ORC B;  1B7T Z;  3SG3 A;  1SNL A;  3DVE A;  1D1O A;  1Q80 A;  3C1V A;  2VRG A;  2JZI A;  1W7J B;  1CNP A;  1SK6 D;  1GGW A;  1KK8 C;  2ISD A;  1BR1 B;  1IKU A;  1LKJ A;  3KPX A;  5HKZ A;  1Y6W A;  3EK7 A;  3SG2 A;  1V1G A;  1WLM A;  1EXR A;  2I18 A;  2KFH A;  2H61 A;  2WCF A;  1B7T Y;  3IF7 A;  2LHL A;  4E68 A;  1EJ3 A;  1WRZ A;  2BBN A;  2F8P A;  2KI4 C;  1SR6 B;  3I5F B;  1R2U A;  2MHH A;  4MVF A;  1KQM C;  3E3R A;  2M7L A;  1CMF A;  1JSA A;  1IQ3 A;  5AAN A;  1SL9 A;  3OX6 A;  1V1F A;  2BCX A;  2LMT A;  1XVJ A;  3EK8 A;  2Y1N A;  3FS7 A;  4ZCV A;  4C0J A;  1UHK A;  3I5H B;  3EK4 A;  1TNX A;  1QIW A;  2OPO A;  1VRK A;  2MJW B;  2JXC A;  1TCF A;  5CPV A;  3ZWH A;  3A4U B;  3CZT X;  2E30 A;  1XFW O;  3DF0 A;  1IG5 A;  1GQM A;  4GFT A;  2OTG C;  2KGR A;  2M3W A;  1Y0V H;  2CBL A;  2WOR A;  2HQW A;  2F2P A;  2LMU A;  2JTT A;  2CXJ A;  1QIV A;  1ZOT B;  3D0Y B;  2L4I A;  2GGM A;  4U8D A;  1RJV A;  3BOW B;  2EC6 C;  1B9A A;  2OS8 B;  2K7O A;  5DKQ A;  1C07 A;  1WRL A;  1SCM C;  2Q4U A;  1IWQ A;  1SYM A;  2HF5 A;  2JWW A;  1EL4 A;  1WLZ A;  4I5N B;  3WXA A;  4XJK B;  4D1E A;  1BOD A;  1KWO C;  1SRA A;  1GGZ A;  1TOP A;  1CFD A;  1MWN A;  1UHH A;  1DGU A;  4CPV A;  1B8C A;  1B8R A;  1YUU A;  4ZCU A;  3DVK A;  1CDM A;  1OZO A;  3DD4 A;  1IQ5 A;  1J55 A;  2K61 A;  3JTD B;  3VRR A;  4JQ0 D;  2BL0 C;  2QAC A;  1CKK A;  4I5J A;  3TS5 C;  4N1G A;  4XYN A;  2H61 C;  1SPY A;  1J1D A;  3PAL A;  2KAV A;  2ZKM X;  1JFJ A;  1M39 A;  4CFQ A;  1A75 B;  2V53 A;  5I2Q A;  2G2B A;  1IJ6 A;  2LVJ A;  2LV7 A;  2LE9 B;  4ORB B;  5D69 A;  1OMD A;  2BKI B;  4YGE B;  2L98 A;  3BUW B;  3TDU A;  1S1E A;  2TN4 A;  1FI5 A;  2PRU A;  4YRU A;  3BUX B;  1NCY A;  3PM8 A;  1UWO A;  3PAT A;  1HT9 A;  1N2D A;  1DJI A;  1XYD A;  2BBM A;  2LMV A;  2LVI A;  1ALV A;  2CNP A;  3SG6 A;  2JTZ A;  2A4J A;  1CTR A;  3OX5 A;  2FCE A;  3IQO A;  3NSO A;  4PHJ A;  1KK8 B;  2JT0 A;  5AXI A;  1CDN A;  1KCY A;  2FOT A;  4P2Y B;  2JRF A;  5TNC A;  2CTN A;  3TDI A;  1RK9 A;  1M45 A;  5CSN A;  1B1G A;  1DJX A;  1YUT A;  2M49 B;  4N1F A;  4GBA A;  3TUY C;  3SIB A;  2M29 A;  3AAK A;  4PDZ A;  1OZS A;  1B8L A;  1YUR A;  1DMO A;  4MZJ A;  4GUK A;  4Q04 A;  2ZN9 A;  2AAO A;  2KI4 B;  2EHB A;  1QX7 A;  1F8H A;  3CWG A;  1OE9 B;  4PE0 A;  1KQM B;  1J7R A;  4JWQ A;  1QV0 A;  4YBH B;  3OB1 B;  2NXQ A;  5ER5 A;  4QJ4 B;  1JF2 A;  1TCO B;  3O2P A;  1TTX A;  5FYX A;  1UP5 A;  2KI6 D;  1MF8 B;  4TNC A;  1SL8 A;  3HX4 A;  1TNW A;  5IBW A;  2JPT A;  1BG1 A;  2JC2 A;  1JUO A;  1PRW A;  1KFU L;  1F4Q A;  5AFP A;  4YGD B;  1U5I A;  3LK0 A;  1CM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...