1IIOA

Nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
GSHMKMGVKEDIRGQIIGALAGADFPINSPEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein MTH865
publication title NMR-based structure of the conserved protein MTH865 from the archaeon Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07747 MTH865 MTH865-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.80 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 MTH865-like 1iioA00
1IIOA
chains in the Genus database with same CATH superfamily
1TNQA 1C7VA 1KWOB 1IKUA 5I2LA 2A4JA 1U5IB 3SS3A 1F54A 2MLEC 1DEKA 4YBHB 2K2AA 4YGDB 4C0JA 2Y1NA 3S0AA 5FYXA 1LINA 4NDDA 2K7DA 1Y0VH 2F3ZA 3D0YA 2KAXA 1UHHA 3PN7C 4I5JA 4ORBB 1MQ1A 3IQOA 2KI6C 5HKWA 2BE4A 3DVKA 5GQQC 3NXAA 1TCFA 1S5GY 1W7IB 1SBJA 1MHOA 1A29A 1OOGA 2V53A 1QV0A 1UHKA 3EK4A 3HX4A 4PCWA 1DJYA 1QX2A 2H8VA 4A4CA 3DF0B 3EVRA 1AHRA 4IL1A 4UPGA 1G4YR 4YGEB 3PLFB 4N1FA 5CSIA 3SG3A 1SL9A 1F4QA 2AUCA 1Z4HA 3BJHA 1DJZA 2L4HA 1YUTA 4MZLA 3SS4A 5HKYA 1XYDA 1YR5A 2H2KA 2K7CA 2WCMA 2WORA 3AAJA 1SR6C 3Q8IA 4P5OE 1LXFC 4JQ0D 1MUXA 1OMVA 1Y6WA 3FE6A 2KFFA 1DQEA 3EKHA 2ZNDA 4JWQA 1YTZC 2VRGA 2BKIB 1KQMC 3GK1A 1RJVA 1ZMZA 2MJWB 4YGCB 1PULA 2BCAA 1YRUB 2HQ8A 1WRLA 1KFXS 2JTZA 2EC6B 1LA3A 1MXLC 2I94A 2JU0A 2QPTA 1AP4A 1LA0A 3CYZA 1SCMB 1ZOTB 1QIVA 1K93D 1SL7A 1ZACA 5AXIA 2K60A 4E68A 1JC2A 4F7FA 1F70A 2E6WA 3PFVA 1CM1A 1SRAA 1T14A 1QX5B 4N1GA 1NX3A 4R1EA 3VRPA 2F2OA 5EL2A 1OMDA 4YI8A 2L5XB 2M8UA 3S0FA 3SJSA 1BU3A 2BL0C 1K95A 2K7OA 3EK8A 4MEWA 2L4IA 2CBLA 1UURA 1AK8A 1SPYA 3BOWB 4OV2A 3FIAA 1ALWA 1OOHA 2Q91A 3L4AA 2BCBA 4FQTA 2H61C 1AUIB 1NCZA 1RROA 1PSBA 2LVVA 2ZFDA 4DCKA 1XFYO 2CT9A 3ICBA 1L2OC 2KPHA 2E30A 2O60A 5KU1A 2BCXA 2WOSA 3RLZA 4YGAA 3JTDB 3SG4A 1N2DA 3SIAA 2KHNA 2CTNA 3FE9A 1R2UA 1KCYA 1DJWA 4WQ2A 1TNPA 2K61A 3EK7A 3QRXA 2B1UA 2QEHA 1QLSA 3BFBA 5G08A 1J55A 1GQMA 2FOTA 4I5KA 4NDBA 4AOMA 1H8BA 1AJ5A 1CM4A 1JUOA 2WCBA 2TN4A 4MRXA 4PE7A 1QV1A 2JT8A 2JC2A 1F55A 2ERBA 5BPJA 2WCFA 5IBWA 1CLMA 5PALA 2M29A 1BJFA 4C0LA 2KQYA 1A2XA 4OZDA 2KOTA 3PSRA 2LVJA 4PDZA 5FI6A 2HPSA 2LV7A 1QXPA 4PHNA 1NUBA 1CMGA 2JT0A 1MWNA 3R72A 4AQJA 4PHMA 1XFXO 1W9ZA 2WCKA 1NX2A 3L4LA 1M39A 5AANA 4CLNA 3TS5B 3S0DA 1V1FA 3A8RA 2O5GA 3PALA 1MXEA 4QJ3B 1J7RA 2LLSA 3KHEA 1KK7Y 3RZSA 5CSJA 2PALA 4GUKA 1CB1A 3EVVA 5AEQA 4PALA 5HKZA 2NCOA 1KQMB 1A03A 3NSOA 1XFVO 2IS9A 1KSOA 2SASA 2DOQA 2I18A 2BBMA 2M7NA 1RTP1 5HLVA 3VRRA 3BYAA 5CPVA 3EG5B 4MN0A 1FBVA 3R1OA 3O4YA 2G2BA 1RK9A 3CABA 3GK4X 5DICA 3DVEA 3IVTA 2KLEA 1DTLA 1DVIA 1R6PA 1XK4A 1BR1B 3JTDC 4XJKA 4USLA 3GOFA 4HREE 1IWQA 3L47A 2BL0B 1KSMA 1S6CA 3TUYC 2WCHA 3WXAA 1S26D 3K1EA 1KK7Z 1XFUO 1G33A 1M45A 1EG4A 4PE0A 1K9PA 1XFWO 1J7PA 1QIWA 1DJGA 3O2PA 3WHUB 5I8NA 1KFUL 1L2OB 2BBNA 1WLMA 1SNLA 2FJYA 3BUXB 2WC6A 1N65A 1K9KA 2KFGA 3CZ1A 2JXCA 3LK1A 1BR4B 1Y1UA 1HT9A 4N5XA 1Z2CB 5KSZA 1BLQA 1IG5A 2KSPA 4D1EA 1NCYA 2GTEA 1CFCA 2LLTA 3OBVA 1CDPA 1S36A 1SKTA 2AAOA 4HRGA 3NHTA 3I5HC 4PHJA 3NSIA 3VROA 3TDZA 5D3OA 1DELA 1PK0D 5J3XA 3TS5C 3D77A 2LANA 1JWDA 1QX7A 3KEVA 2OS8B 4M2QA 4PE1A 1RECA 1AVSA 2AMIA 2KI4C 3BUWB 1S5GZ 3B6XA 4I5NB 1FI6A 1JF2A 3BUMB 4FTGA 3D0YB 3NHIA 3B86A 2KYFA 1YVHA 3UO9A 2KFHA 3IQQA 2FJUB 2LC5A 3DZTA 5K89A 3LL8B 2MHHA 1IQ3A 4DUQA 3BXKA 1NPQA 1CDNA 3CWGA 2ZRTA 1DF0A 1MR8A 1M46A 2LE9B 3S0BA 1B4CA 1UWOA 1YUUA 3N7HA 2JOJA 2LHLA 3GK2A 3V2LA 1J7OA 1F8HA 1Q80A 3SG7A 2GGZA 3TDIA 1QTXA 1SY9A 2MBXA 1FPWA 2F3YA 1SL8A 3VB1A 3M0WA 1OW4A 2LLUA 2KLDA 1B1GA 1ZFSA 4MZJA 3I5IC 3VGOA 4ETOA 1EJ3A 1OOFA 2PRUA 5I94A 1YX7A 2JRFA 3OB1B 4I5LB 5B8IB 1SK6D 5CSNA 1YURA 3TUYB 1BMOA 2M3WA 2BAPA 4CPVA 1TTXA 3LCPC 4CFRA 4KYNA 1C3ZA 1QVIY 1VRKA 1W7JB 2KYCA 2D8NA 2KGBC 2KI6D 4INWA 1ZUZA 4MRYA 1BOCA 5FI2A 3ZNIA 1EXRA 4GAOA 1A75A 1DGVA 1CDMA 2RGIA 2P71A 4MZKA 3WHTB 3SG2A 4YRUA 1YRTB 2NLNA 1NWDA 2OS8C 2M1UA 2P70A 3BUNB 2WCEA 3PM8A 1TUZA 5KTYA 1PALA 1HQVA 1BODA 1IJ5A 1CNPA 2K7BA 1OQPA 2FCDA 3I5HB 2PSRA 3JVTC 1NCXA 4OCIA 4QJ5B 2PASA 1QWVA 1K8UA 1WDCC 2JPOA 2ZRSA 3TDUA 4IJ7A 1EG3A 3OHMB 4DIRA 4DRWA 3CZTX 2HQWA 1CLLA 1QVIZ 4F0ZB 3EVUA 2HETA 1GGZA 3UNWA 2KI4B 2M97A 2Y5IA 4L9MA 1B8LA 2BE6A 2L51A 1PVBA 1CFPA 1U5IA 2Y1MA 2QEVA 1WY9A 2NCPA 1CMFA 2PVBA 3BUOB 3BFAA 2LP3A 2K8MB 3CDNA 2PQLA 4CFQA 3DXLA 1ODBA 2JT3A 5F6TA 1F71A 2WC8A 2G9BA 1UHJA 1JFKA 4ORAB 1DGUA 2H61A 1GJYA 1J1DA 2L98A 5I2QA 1BT6A 2LMTA 2L2CA 1KFXL 2LUCA 3LK0A 5ER5A 3EKJA 4PHKA 2PMYA 1EL4A 3DF0A 2BKHB 3O6BA 2L0PA 3CR5X 5D69A 4GGFA 1OSAA 2L5YA 4ORCB 1XFZO 5DKNA 1TRFA 1E8AA 2I2RE 1M63B 2K0JA 1Y1AA 2KAVA 2MLFC 1K2HA 2OTGB 2Y4QA 1OE9B 1IJ6A 4P2YB 3I5IB 4FQOA 4BY5A 1CFDA 2HF5A 3OX5A 1QJTA 1DJXA 5AERA 3HCMA 4U8DA 2M1KB 1OZSA 3CS1A 3DD4A 2Q4UA 1P28A 1EH2A 2KBIA 1JBAA 3A4UB 4DS7A 1UHIA 2P6BB 2JQ6A 1MF8B 1V1GA 3O78A 4WQ3A 1TIZA 3BFHA 3FWBA 1SSEB 3R1PA 2QDIA 2LUXA 5HLOA 1K94A 2L50A 3CTNA 3KO0A 4WRIA 5AFPA 2LCPA 2PYQA 4NQGA 3DY9A 2JPTA 2M9GA 4XJKB 1CDLA 5ER4X 5JOLA 2KAYA 4C0KA 4MLWA 4TNCA 3SG6A 5HYDA 2I7AA 2ZKMX 4HRHA 4PE4A 4YI9A 1M31A 5DKRA 2QACA 3JVTB 4Q04A 1CTRA 1WDCB 3BQ3A 2CCMA 4NDCA 4MSPA 3BOWA 2LVKA 3S0EA 1IH0A 1WLZA 2WCLA 3D74A 4GGNA 2SCPA 3KPXA 1A4PA 1UHNA 1XVJA 1RWYA 2LM5A 2KBMA 4XYNA 1UP5A 1KK8C 1NYAA 3I5GC 1SCVA 2R2IA 3S0GA 1UUSA 2BNXA 1KQVA 4ZCVA 1TWOA 1YVLA 1DT7B 3CLNA 1LS8A 4BY4A 1NX0A 1DJHA 1QATA 3C1VA 3OGNA 2ZNEA 2KGRA 2LHIA 3DYEA 1IQ5A 4CIDA 2OTGC 2LAPA 1C07A 2KNEA 2JTTA 3I5FC 2F8PA 3FS7A 3SG5A 1S6JA 2COLB 4INXA 1F4OA 1PRWA 3FWCA 1FI5A 1KWOC 2EHBA 1OMRA 1LKJA 1JFJA 1ORGA 2ZN9A 3CGAA 1DMOA 4M2PA 2WNDA 1B8RA 2LMUA 1SW8A 2L2EA 4GBAA 1KFUS 1TUJA 4GNKB 2JXLA 4M2OA 1X02A 1SYMA 1DC1A 1NSHA 3DVMA 1NP8A 1OOIX 3VRNA 4GFTA 1SMGA 2LNKA 3D10A 3NSLA 2KDHA 1DF0B 2JULA 1IIOA 5HL1A 1GGWA 1XK4C 1S6IA 5DKQA 1PSRA 1WRZA 1B7TY 1XA5A 3MSEB 1YUSA 1NIWA 4JKTA 2K2FA 4GGFC 1XO5A 2LMVA 1Y1XA 3PN7B 3OP0A 1TCOB 3QMEA 2QEOA 1K96A 3OB2B 2WC5A 3B7AA 1C3YA 1H4BA 4JD9A 2ISDA 4ICBA 3ZWHA 1GM0A 2LP2A 1IGVA 3H4SE 1ALVA 3PM2A 1K90D 3IF7A 4AQIA 2LVIA 3AKBA 2M7LA 3F45A 1B9AA 1NX1A 1J1EA 2CNPA 2F2PA 3CR4X 3B87A 3KF9A 2M49B 2EGDA 3O4XA 3PATA 4JPZB 1FW4A 3SIBA 5JJGA 3R1VA 3E3RA 3WNXB 1B47A 1N0YA 1YX8A 2F33A 4GPLB 1G8IA 1B7TZ 1XFRA 2JNXA 2BECA 1B8CA 1QLKA 2OPOA 2QEBA 1FF1A 3DVJA 3PJIA 1TNXA 3B88A 3OX6A 1A75B 1J7QA 2KQ6A 1LVCD 1CFFA 2MA2A 2JZIA 2CXJA 2EC6C 2FCEA 3AKAA 3AAKA 4OKHA 2JNFA 3LLEA 3NSKA 1BG1A 3CZ2A 1JSAA 4QJ4B 1SR6B 2MAZA 1SCMC 1WRKA 2YGUA 1C7WA 3CR2A 1CKKA 4MBEA 1L7ZA 5D7FA 3TZ1A 1KK8B 1AJ4A 1RFJA 4MVFA 1QS7A 2JWWA 3D76A 3I5GB 3VRQA 3CZ0A 1PVAA 1TN4A 2MRDA 2NXQA 1JF0A 4A4BA 5I2OA 1S3PA 3K21A 1OZOA 1IRJA 2M0RA 1S1EA 2WCJA 3SS5A 2NZ0A 3NGVA 1BF5A 4OVNF 4ZCUA 1CLBA 1QASA 1TOPA 3D78A 2GV5A 2GGMA 4YGBB 1K9UA 3D75A 4HSZA 4OR9B 4PT1A 5TNCA 3RM1A 3I5FB 1OOJA 1DJIA 1TNWA 2ZN8A 5FI7A 1D1OA 5CSFA 3FE8A 3D73A
chains in the Genus database with same CATH topology
1IIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIO A; 
#chains in the Genus database with same CATH topology
 1TNQ A;  1C7V A;  1KWO B;  1IKU A;  5I2L A;  2A4J A;  1U5I B;  3SS3 A;  1F54 A;  2MLE C;  1DEK A;  4YBH B;  2K2A A;  4YGD B;  4C0J A;  2Y1N A;  3S0A A;  5FYX A;  1LIN A;  4NDD A;  2K7D A;  1Y0V H;  2F3Z A;  3D0Y A;  2KAX A;  1UHH A;  3PN7 C;  4I5J A;  4ORB B;  1MQ1 A;  3IQO A;  2KI6 C;  5HKW A;  2BE4 A;  3DVK A;  5GQQ C;  3NXA A;  1TCF A;  1S5G Y;  1W7I B;  1SBJ A;  1MHO A;  1A29 A;  1OOG A;  2V53 A;  1QV0 A;  1UHK A;  3EK4 A;  3HX4 A;  4PCW A;  1DJY A;  1QX2 A;  2H8V A;  4A4C A;  3DF0 B;  3EVR A;  1AHR A;  4IL1 A;  4UPG A;  1G4Y R;  4YGE B;  3PLF B;  4N1F A;  5CSI A;  3SG3 A;  1SL9 A;  1F4Q A;  2AUC A;  1Z4H A;  3BJH A;  1DJZ A;  2L4H A;  1YUT A;  4MZL A;  3SS4 A;  5HKY A;  1XYD A;  1YR5 A;  2H2K A;  2K7C A;  2WCM A;  2WOR A;  3AAJ A;  1SR6 C;  3Q8I A;  4P5O E;  1LXF C;  4JQ0 D;  1MUX A;  1OMV A;  1Y6W A;  3FE6 A;  2KFF A;  1DQE A;  3EKH A;  2ZND A;  4JWQ A;  1YTZ C;  2VRG A;  2BKI B;  1KQM C;  3GK1 A;  1RJV A;  1ZMZ A;  2MJW B;  4YGC B;  1PUL A;  2BCA A;  1YRU B;  2HQ8 A;  1WRL A;  1KFX S;  2JTZ A;  2EC6 B;  1LA3 A;  1MXL C;  2I94 A;  2JU0 A;  2QPT A;  1AP4 A;  1LA0 A;  3CYZ A;  1SCM B;  1ZOT B;  1QIV A;  1K93 D;  1SL7 A;  1ZAC A;  5AXI A;  2K60 A;  4E68 A;  1JC2 A;  4F7F A;  1F70 A;  2E6W A;  3PFV A;  1CM1 A;  1SRA A;  1T14 A;  1QX5 B;  4N1G A;  1NX3 A;  4R1E A;  3VRP A;  2F2O A;  5EL2 A;  1OMD A;  4YI8 A;  2L5X B;  2M8U A;  3S0F A;  3SJS A;  1BU3 A;  2BL0 C;  1K95 A;  2K7O A;  3EK8 A;  4MEW A;  2L4I A;  2CBL A;  1UUR A;  1AK8 A;  1SPY A;  3BOW B;  4OV2 A;  3FIA A;  1ALW A;  1OOH A;  2Q91 A;  3L4A A;  2BCB A;  4FQT A;  2H61 C;  1AUI B;  1NCZ A;  1RRO A;  1PSB A;  2LVV A;  2ZFD A;  4DCK A;  1XFY O;  2CT9 A;  3ICB A;  1L2O C;  2KPH A;  2E30 A;  2O60 A;  5KU1 A;  2BCX A;  2WOS A;  3RLZ A;  4YGA A;  3JTD B;  3SG4 A;  1N2D A;  3SIA A;  2KHN A;  2CTN A;  3FE9 A;  1R2U A;  1KCY A;  1DJW A;  4WQ2 A;  1TNP A;  2K61 A;  3EK7 A;  3QRX A;  2B1U A;  2QEH A;  1QLS A;  3BFB A;  5G08 A;  1J55 A;  1GQM A;  2FOT A;  4I5K A;  4NDB A;  4AOM A;  1H8B A;  1AJ5 A;  1CM4 A;  1JUO A;  2WCB A;  2TN4 A;  4MRX A;  4PE7 A;  1QV1 A;  2JT8 A;  2JC2 A;  1F55 A;  2ERB A;  5BPJ A;  2WCF A;  5IBW A;  1CLM A;  5PAL A;  2M29 A;  1BJF A;  4C0L A;  2KQY A;  1A2X A;  4OZD A;  2KOT A;  3PSR A;  2LVJ A;  4PDZ A;  5FI6 A;  2HPS A;  2LV7 A;  1QXP A;  4PHN A;  1NUB A;  1CMG A;  2JT0 A;  1MWN A;  3R72 A;  4AQJ A;  4PHM A;  1XFX O;  1W9Z A;  2WCK A;  1NX2 A;  3L4L A;  1M39 A;  5AAN A;  4CLN A;  3TS5 B;  3S0D A;  1V1F A;  3A8R A;  2O5G A;  3PAL A;  1MXE A;  4QJ3 B;  1J7R A;  2LLS A;  3KHE A;  1KK7 Y;  3RZS A;  5CSJ A;  2PAL A;  4GUK A;  1CB1 A;  3EVV A;  5AEQ A;  4PAL A;  5HKZ A;  2NCO A;  1KQM B;  1A03 A;  3NSO A;  1XFV O;  2IS9 A;  1KSO A;  2SAS A;  2DOQ A;  2I18 A;  2BBM A;  2M7N A;  1RTP 1;  5HLV A;  3VRR A;  3BYA A;  5CPV A;  3EG5 B;  4MN0 A;  1FBV A;  3R1O A;  3O4Y A;  2G2B A;  1RK9 A;  3CAB A;  3GK4 X;  5DIC A;  3DVE A;  3IVT A;  2KLE A;  1DTL A;  1DVI A;  1R6P A;  1XK4 A;  1BR1 B;  3JTD C;  4XJK A;  4USL A;  3GOF A;  4HRE E;  1IWQ A;  3L47 A;  2BL0 B;  1KSM A;  1S6C A;  3TUY C;  2WCH A;  3WXA A;  1S26 D;  3K1E A;  1KK7 Z;  1XFU O;  1G33 A;  1M45 A;  1EG4 A;  4PE0 A;  1K9P A;  1XFW O;  1J7P A;  1QIW A;  1DJG A;  3O2P A;  3WHU B;  5I8N A;  1KFU L;  1L2O B;  2BBN A;  1WLM A;  1SNL A;  2FJY A;  3BUX B;  2WC6 A;  1N65 A;  1K9K A;  2KFG A;  3CZ1 A;  2JXC A;  3LK1 A;  1BR4 B;  1Y1U A;  1HT9 A;  4N5X A;  1Z2C B;  5KSZ A;  1BLQ A;  1IG5 A;  2KSP A;  4D1E A;  1NCY A;  2GTE A;  1CFC A;  2LLT A;  3OBV A;  1CDP A;  1S36 A;  1SKT A;  2AAO A;  4HRG A;  3NHT A;  3I5H C;  4PHJ A;  3NSI A;  3VRO A;  3TDZ A;  5D3O A;  1DEL A;  1PK0 D;  5J3X A;  3TS5 C;  3D77 A;  2LAN A;  1JWD A;  1QX7 A;  3KEV A;  2OS8 B;  4M2Q A;  4PE1 A;  1REC A;  1AVS A;  2AMI A;  2KI4 C;  3BUW B;  1S5G Z;  3B6X A;  4I5N B;  1FI6 A;  1JF2 A;  3BUM B;  4FTG A;  3D0Y B;  3NHI A;  3B86 A;  2KYF A;  1YVH A;  3UO9 A;  2KFH A;  3IQQ A;  2FJU B;  2LC5 A;  3DZT A;  5K89 A;  3LL8 B;  2MHH A;  1IQ3 A;  4DUQ A;  3BXK A;  1NPQ A;  1CDN A;  3CWG A;  2ZRT A;  1DF0 A;  1MR8 A;  1M46 A;  2LE9 B;  3S0B A;  1B4C A;  1UWO A;  1YUU A;  3N7H A;  2JOJ A;  2LHL A;  3GK2 A;  3V2L A;  1J7O A;  1F8H A;  1Q80 A;  3SG7 A;  2GGZ A;  3TDI A;  1QTX A;  1SY9 A;  2MBX A;  1FPW A;  2F3Y A;  1SL8 A;  3VB1 A;  3M0W A;  1OW4 A;  2LLU A;  2KLD A;  1B1G A;  1ZFS A;  4MZJ A;  3I5I C;  3VGO A;  4ETO A;  1EJ3 A;  1OOF A;  2PRU A;  5I94 A;  1YX7 A;  2JRF A;  3OB1 B;  4I5L B;  5B8I B;  1SK6 D;  5CSN A;  1YUR A;  3TUY B;  1BMO A;  2M3W A;  2BAP A;  4CPV A;  1TTX A;  3LCP C;  4CFR A;  4KYN A;  1C3Z A;  1QVI Y;  1VRK A;  1W7J B;  2KYC A;  2D8N A;  2KGB C;  2KI6 D;  4INW A;  1ZUZ A;  4MRY A;  1BOC A;  5FI2 A;  3ZNI A;  1EXR A;  4GAO A;  1A75 A;  1DGV A;  1CDM A;  2RGI A;  2P71 A;  4MZK A;  3WHT B;  3SG2 A;  4YRU A;  1YRT B;  2NLN A;  1NWD A;  2OS8 C;  2M1U A;  2P70 A;  3BUN B;  2WCE A;  3PM8 A;  1TUZ A;  5KTY A;  1PAL A;  1HQV A;  1BOD A;  1IJ5 A;  1CNP A;  2K7B A;  1OQP A;  2FCD A;  3I5H B;  2PSR A;  3JVT C;  1NCX A;  4OCI A;  4QJ5 B;  2PAS A;  1QWV A;  1K8U A;  1WDC C;  2JPO A;  2ZRS A;  3TDU A;  4IJ7 A;  1EG3 A;  3OHM B;  4DIR A;  4DRW A;  3CZT X;  2HQW A;  1CLL A;  1QVI Z;  4F0Z B;  3EVU A;  2HET A;  1GGZ A;  3UNW A;  2KI4 B;  2M97 A;  2Y5I A;  4L9M A;  1B8L A;  2BE6 A;  2L51 A;  1PVB A;  1CFP A;  1U5I A;  2Y1M A;  2QEV A;  1WY9 A;  2NCP A;  1CMF A;  2PVB A;  3BUO B;  3BFA A;  2LP3 A;  2K8M B;  3CDN A;  2PQL A;  4CFQ A;  3DXL A;  1ODB A;  2JT3 A;  5F6T A;  1F71 A;  2WC8 A;  2G9B A;  1UHJ A;  1JFK A;  4ORA B;  1DGU A;  2H61 A;  1GJY A;  1J1D A;  2L98 A;  5I2Q A;  1BT6 A;  2LMT A;  2L2C A;  1KFX L;  2LUC A;  3LK0 A;  5ER5 A;  3EKJ A;  4PHK A;  2PMY A;  1EL4 A;  3DF0 A;  2BKH B;  3O6B A;  2L0P A;  3CR5 X;  5D69 A;  4GGF A;  1OSA A;  2L5Y A;  4ORC B;  1XFZ O;  5DKN A;  1TRF A;  1E8A A;  2I2R E;  1M63 B;  2K0J A;  1Y1A A;  2KAV A;  2MLF C;  1K2H A;  2OTG B;  2Y4Q A;  1OE9 B;  1IJ6 A;  4P2Y B;  3I5I B;  4FQO A;  4BY5 A;  1CFD A;  2HF5 A;  3OX5 A;  1QJT A;  1DJX A;  5AER A;  3HCM A;  4U8D A;  2M1K B;  1OZS A;  3CS1 A;  3DD4 A;  2Q4U A;  1P28 A;  1EH2 A;  2KBI A;  1JBA A;  3A4U B;  4DS7 A;  1UHI A;  2P6B B;  2JQ6 A;  1MF8 B;  1V1G A;  3O78 A;  4WQ3 A;  1TIZ A;  3BFH A;  3FWB A;  1SSE B;  3R1P A;  2QDI A;  2LUX A;  5HLO A;  1K94 A;  2L50 A;  3CTN A;  3KO0 A;  4WRI A;  5AFP A;  2LCP A;  2PYQ A;  4NQG A;  3DY9 A;  2JPT A;  2M9G A;  4XJK B;  1CDL A;  5ER4 X;  5JOL A;  2KAY A;  4C0K A;  4MLW A;  4TNC A;  3SG6 A;  5HYD A;  2I7A A;  2ZKM X;  4HRH A;  4PE4 A;  4YI9 A;  1M31 A;  5DKR A;  2QAC A;  3JVT B;  4Q04 A;  1CTR A;  1WDC B;  3BQ3 A;  2CCM A;  4NDC A;  4MSP A;  3BOW A;  2LVK A;  3S0E A;  1IH0 A;  1WLZ A;  2WCL A;  3D74 A;  4GGN A;  2SCP A;  3KPX A;  1A4P A;  1UHN A;  1XVJ A;  1RWY A;  2LM5 A;  2KBM A;  4XYN A;  1UP5 A;  1KK8 C;  1NYA A;  3I5G C;  1SCV A;  2R2I A;  3S0G A;  1UUS A;  2BNX A;  1KQV A;  4ZCV A;  1TWO A;  1YVL A;  1DT7 B;  3CLN A;  1LS8 A;  4BY4 A;  1NX0 A;  1DJH A;  1QAT A;  3C1V A;  3OGN A;  2ZNE A;  2KGR A;  2LHI A;  3DYE A;  1IQ5 A;  4CID A;  2OTG C;  2LAP A;  1C07 A;  2KNE A;  2JTT A;  3I5F C;  2F8P A;  3FS7 A;  3SG5 A;  1S6J A;  2COL B;  4INX A;  1F4O A;  1PRW A;  3FWC A;  1FI5 A;  1KWO C;  2EHB A;  1OMR A;  1LKJ A;  1JFJ A;  1ORG A;  2ZN9 A;  3CGA A;  1DMO A;  4M2P A;  2WND A;  1B8R A;  2LMU A;  1SW8 A;  2L2E A;  4GBA A;  1KFU S;  1TUJ A;  4GNK B;  2JXL A;  4M2O A;  1X02 A;  1SYM A;  1DC1 A;  1NSH A;  3DVM A;  1NP8 A;  1OOI X;  3VRN A;  4GFT A;  1SMG A;  2LNK A;  3D10 A;  3NSL A;  2KDH A;  1DF0 B;  2JUL A;  1IIO A;  5HL1 A;  1GGW A;  1XK4 C;  1S6I A;  5DKQ A;  1PSR A;  1WRZ A;  1B7T Y;  1XA5 A;  3MSE B;  1YUS A;  1NIW A;  4JKT A;  2K2F A;  4GGF C;  1XO5 A;  2LMV A;  1Y1X A;  3PN7 B;  3OP0 A;  1TCO B;  3QME A;  2QEO A;  1K96 A;  3OB2 B;  2WC5 A;  3B7A A;  1C3Y A;  1H4B A;  4JD9 A;  2ISD A;  4ICB A;  3ZWH A;  1GM0 A;  2LP2 A;  1IGV A;  3H4S E;  1ALV A;  3PM2 A;  1K90 D;  3IF7 A;  4AQI A;  2LVI A;  3AKB A;  2M7L A;  3F45 A;  1B9A A;  1NX1 A;  1J1E A;  2CNP A;  2F2P A;  3CR4 X;  3B87 A;  3KF9 A;  2M49 B;  2EGD A;  3O4X A;  3PAT A;  4JPZ B;  1FW4 A;  3SIB A;  5JJG A;  3R1V A;  3E3R A;  3WNX B;  1B47 A;  1N0Y A;  1YX8 A;  2F33 A;  4GPL B;  1G8I A;  1B7T Z;  1XFR A;  2JNX A;  2BEC A;  1B8C A;  1QLK A;  2OPO A;  2QEB A;  1FF1 A;  3DVJ A;  3PJI A;  1TNX A;  3B88 A;  3OX6 A;  1A75 B;  1J7Q A;  2KQ6 A;  1LVC D;  1CFF A;  2MA2 A;  2JZI A;  2CXJ A;  2EC6 C;  2FCE A;  3AKA A;  3AAK A;  4OKH A;  2JNF A;  3LLE A;  3NSK A;  1BG1 A;  3CZ2 A;  1JSA A;  4QJ4 B;  1SR6 B;  2MAZ A;  1SCM C;  1WRK A;  2YGU A;  1C7W A;  3CR2 A;  1CKK A;  4MBE A;  1L7Z A;  5D7F A;  3TZ1 A;  1KK8 B;  1AJ4 A;  1RFJ A;  4MVF A;  1QS7 A;  2JWW A;  3D76 A;  3I5G B;  3VRQ A;  3CZ0 A;  1PVA A;  1TN4 A;  2MRD A;  2NXQ A;  1JF0 A;  4A4B A;  5I2O A;  1S3P A;  3K21 A;  1OZO A;  1IRJ A;  2M0R A;  1S1E A;  2WCJ A;  3SS5 A;  2NZ0 A;  3NGV A;  1BF5 A;  4OVN F;  4ZCU A;  1CLB A;  1QAS A;  1TOP A;  3D78 A;  2GV5 A;  2GGM A;  4YGB B;  1K9U A;  3D75 A;  4HSZ A;  4OR9 B;  4PT1 A;  5TNC A;  3RM1 A;  3I5F B;  1OOJ A;  1DJI A;  1TNW A;  2ZN8 A;  5FI7 A;  1D1O A;  5CSF A;  3FE8 A;  3D73 A; 
#chains in the Genus database with same CATH homology
 1IIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...