1IQ3A

Solution structure of the eps15 homology domain of a human pob1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
GSLQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords RALBP1-INTERACTING PROTEIN (PARTNER OF RALBP1)
publication title Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1).
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2001-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1iq3A00
1J7PA 1BT6A 3CGAA 3CS1A 2FOTA 1KSOA 1NX2A 1JF0A 2EC6B 3I5GB 3WHTB 2GV5A 2KFGA 1TNPA 2O5GA 4E68A 2Q91A 3DF0A 3TDUA 1QV0A 4PHMA 1W7JB 2LUXA 1QX5B 4NDDA 1M39A 3TUYB 1NPQA 3DF0B 3RM1A 4DIRA 4QJ5B 2JXCA 3SG3A 1H8BA 4YGAA 1DVIA 1DJXA 2LE9B 1RJVA 1UHKA 3HCMA 5DKQA 1A29A 1CLMA 2KSPA 3VRRA 1K90D 4YGBB 2KAVA 1J7OA 1K9PA 2KAYA 4PE7A 3EVUA 1JUOA 2MHHA 2ZNDA 4N1GA 4CPVA 1K93D 3BYAA 4YI8A 4A4BA 1CNPA 2ZN8A 4GGFC 1RTP1 2K7CA 4A4CA 2V53A 3WXAA 1G8IA 2QPTA 4PHJA 2K7BA 4I5KA 1J55A 1LVCD 3A8RA 1JFKA 3I5FB 3VROA 1YRTB 1CFFA 4ORBB 2HF5A 1UHHA 1V1FA 3FIAA 2QACA 3K21A 1JWDA 1MHOA 2NXQA 4GUKA 3SJSA 1OZOA 3LK0A 2LCPA 2KAXA 4L9MA 2KQ6A 2M1UA 5ER5A 4QJ3B 2I94A 1XO5A 1MF8B 1AUIB 1SPYA 2JTTA 1MUXA 3EVRA 1SR6C 2MJWB 1M31A 1KFXL 2L51A 1A2XA 1MR8A 1TNQA 4MBEA 4JPZB 2I7AA 2PMYA 1J7RA 1WDCC 5GQQC 1OMDA 1J1EA 1QX2A 1ZFSA 5DKNA 2LP2A 3PM8A 2OS8C 1PVBA 2HPSA 3GK1A 1UURA 1IQ3A 5AERA 2D8NA 3C1VA 1PULA 2LLUA 2LVKA 3SIAA 3TZ1A 1CDLA 1S1EA 1WRLA 4GBAA 1SCMC 4MLWA 2L4HA 1KSMA 2H2KA 1AJ4A 1KWOC 1YX8A 2JT8A 1L7ZA 2A4JA 3DD4A 3KHEA 2CXJA 2K7DA 3PLFB 1KCYA 1XFWO 1NX3A 2VRGA 3SIBA 1OQPA 4PDZA 4M2QA 2ZRTA 2H61C 1DJWA 1ZOTB 2LMTA 2E30A 3LCPC 1EH2A 1ALWA 2M0RA 5ER4X 1F4QA 1S6IA 1YVLA 3IQQA 3OB2B 3PALA 1TCFA 2JZIA 5HYDA 1ODBA 1DJHA 1AK8A 1QJTA 3EK4A 2FCDA 1XK4A 1OMVA 3I5HC 3KO0A 1XA5A 1FF1A 1QLKA 3DVMA 1AP4A 1K95A 1SK6D 1XFUO 2KFFA 2ZN9A 4CFRA 2IS9A 4BY4A 1IH0A 1UP5A 1KFXS 1XFZO 2BL0C 2OTGC 2WOSA 1Y1XA 1OMRA 1PSRA 2EHBA 1S5GZ 4DS7A 1QV1A 1B8RA 1X02A 1S5GY 5J3XA 1WRKA 1Y6WA 2KI6D 1GGZA 2JQ6A 1MXLC 1QX7A 1EXRA 3LLEA 3HX4A 1SY9A 2BBNA 4JQ0D 2M97A 2JWWA 1UHIA 5BPJA 5JJGA 3WHUB 4M2PA 1LKJA 4C0LA 1CDMA 5CSIA 2KGRA 1XYDA 1J7QA 1NCXA 2M49B 3AKBA 3LL8B 2M7LA 2JTZA 1DMOA 1JBAA 4OVNF 1GQMA 1CFPA 2JC2A 1R2UA 4GPLB 2EC6C 2KFHA 4XYNA 2BKIB 3ICBA 2WORA 1XFYO 1SL9A 4TNCA 1IJ5A 4MEWA 2OPOA 5HKZA 3TUYC 1RROA 2K0JA 3MSEB 2CCMA 4ZCVA 3GK2A 3WNXB 1D1OA 1FPWA 1S3PA 3PN7C 1SYMA 2L2EA 1RECA 2LVVA 1R6PA 1OOJA 1UUSA 4OCIA 4MRYA 3IF7A 2Y1NA 3JTDB 3NSIA 1JSAA 1XFVO 1NX1A 1KQMB 2AAOA 4ETOA 3EKHA 1SNLA 3CLNA 1BJFA 1B8CA 3I5IC 3TS5B 3I5FC 1B4CA 2LVIA 2MLEC 4YI9A 1C07A 3SG5A 1CM1A 1JF2A 1PSBA 3JVTB 4OV2A 1NIWA 1Y0VH 3FWCA 4PCWA 1IGVA 2M8UA 1LXFC 2JU0A 4Q04A 2I18A 2LMVA 1SMGA 1HQVA 1VRKA 1F55A 2BECA 4N1FA 3GOFA 2COLB 3TDIA 1CMGA 1KFUL 3CR2A 2RGIA 4AOMA 3VRNA 4R1EA 1IKUA 1B9AA 2JXLA 2L5XB 2NCPA 3EK8A 2CNPA 1Y1AA 1G33A 4FTGA 3O4YA 4GGFA 2BKHB 1MWNA 2F8PA 4PHNA 1TN4A 1AVSA 2CT9A 3ZWHA 2LANA 3OB1B 3E3RA 1HT9A 1DGVA 3CR4X 3CTNA 5DKRA 5K89A 2LHLA 4WQ2A 4XJKA 1B1GA 4GNKB 2WNDA 2Y1MA 2O60A 2P6BB 1OSAA 1YRUB 3EKJA 4ZCUA 4MZKA 1BU3A 1BR4B 3NSOA 4XJKB 3AAKA 1M45A 2FJUB 1FI6A 1NSHA 1SL7A 1ZUZA 3VRQA 2K8MB 3EVVA 4UPGA 1B47A 1QTXA 1S6JA 1QS7A 4CFQA 3M0WA 2E6WA 3BUNB 2L98A 1G4YR 2LAPA 5FYXA 5AANA 2LNKA 3VGOA 1FI5A 1IRJA 1B7TZ 2JT3A 1FW4A 3PSRA 1S6CA 1B7TY 1RWYA 1NX0A 1RFJA 1K9KA 1SKTA 3QRXA 4DRWA 3PATA 2ZNEA 2OS8B 1K9UA 1IQ5A 2LMUA 1YVHA 1TOPA 4USLA 3SG4A 1C7WA 2F2PA 2DOQA 3BUOB 1KK8C 5CSNA 5AXIA 4CIDA 2JT0A 1OZSA 2CBLA 2JRFA 2KNEA 2Y5IA 1SCMB 2LVJA 4HRHA 2Q4UA 4ORCB 3DVKA 2H61A 1NWDA 2LUCA 2MAZA 2KI6C 2K61A 1IJ6A 2LM5A 1Y1UA 1TRFA 2WCFA 1K2HA 2F3ZA 1L2OC 5HKWA 1MXEA 2KI4B 4PHKA 1GGWA 5CSJA 1UHJA 2WCBA 5I8NA 5B8IB 2AMIA 1FBVA 2KDHA 1YUSA 2ZKMX 2BE6A 1NCYA 1TTXA 2GGMA 3O78A 3ZNIA 1DJIA 3I5GC 1YTZC 2M1KB 4PE0A 2KYFA 2G2BA 2F33A 1W7IB 1DJYA 1DTLA 1CFDA 2LC5A 1QLSA 3TDZA 2MLFC 1SBJA 3KF9A 2JNXA 4C0KA 4D1EA 1QASA 3CR5X 1NCZA 3VRPA 1IG5A 1WY9A 4DCKA 2BBMA 2MA2A 4PE1A 1YR5A 4GAOA 1DF0A 1QATA 3JTDC 2GGZA 5CSFA 5HKYA 1SRAA 3KPXA 5KSZA 1PVAA 3RLZA 3IQOA 4OKHA 1K8UA 3NXAA 5TNCA 1DF0B 1A75A 1CM4A 2EGDA 4C0JA 3A4UB 2KGBC 1UWOA 3OP0A 2R2IA 1S36A 1A75B 2I2RE 2WCEA 5HLOA 1YUTA 4I5JA 1EJ3A 4OR9B 3EK7A 3O2PA 1BLQA 3JVTC 1F70A 2NLNA 1J1DA 1QIVA 5AFPA 5I2OA 4MZJA 4MZLA 5CPVA 2ISDA 1A03A 1MQ1A 2LHIA 4F0ZB 4AQIA 5HLVA 4YGCB 3SG7A 4I5LB 2CTNA 1CLBA 2PSRA 4YBHB 1E8AA 1M63B 3DVEA 1NP8A 3NSLA 1S26D 2K2AA 3H4SE 4QJ4B 1V1GA 4P5OE 3LK1A 4DUQA 1BG1A 3PN7B 1AJ5A 4PE4A 2BE4A 1KQVA 4MRXA 2L0PA 4NDCA 1K96A 3OX6A 4GGNA 2BCAA 4FQOA 1Q80A 1PALA 3BQ3A 4HRGA 3SG6A 2K2FA 1H4BA 1SW8A 5D69A 1F8HA 2M9GA 2TN4A 1DT7B 1DJZA 1BF5A 1CFCA 2K7OA 2G9BA 2JNFA 1A4PA 1B8LA 2PVBA 4U8DA 1CMFA 3BXKA 3I5IB 1EG3A 4IL1A 1TNXA 1CKKA 2PASA 5PALA 1F71A 1SCVA 5F6TA 2LP3A 1BOCA 1OE9B 3NSKA 4YRUA 1CTRA 2KBIA 5I2LA 4HREE 1WLMA 1RK9A 4MVFA 2BCXA 2BCBA 3CWGA 2LV7A 1F54A 2KHNA 2HQ8A 3BUXB 2AUCA 3BUWB 2PRUA 1BODA 1BR1B 1TCOB 1N65A 1KFUS 3GK4X 1XK4C 2LLTA 2NCOA 2KYCA 1TNWA 3BOWA 1PK0D 2MBXA 1TIZA 1LINA 1SR6B 2F3YA 2F2OA 1UHNA 3BOWB 1EL4A 2MRDA 2PALA 1WDCB 4YGDB 1AHRA 2SASA 1WRZA 3O6BA 1JFJA 1GJYA 3FWBA 4BY5A 4CLNA 4NQGA 2ZRSA 4JWQA 1WLZA 2HQWA 3SG2A 2M7NA 1NUBA 5I2QA 5KTYA 4MSPA 1DJGA 2L50A 1CB1A 1JC2A 3DVJA 1SL8A 4I5NB 4M2OA 4PALA 1KWOB 1QVIZ 2JOJA 1ZACA 1K94A 1KK7Z 1QVIY 2KI4C 4WRIA 1KK7Y 5KU1A 1LA0A 3OHMB 1CDNA 3AKAA 2M3WA 2Y4QA 5AEQA 2FCEA 4YGEB 1IWQA 1YUUA 3F45A 4AQJA 1BMOA 1YX7A 2NZ0A 2ZFDA 1QIWA 3AAJA 2L4IA 3CZTX 1ZMZA 5G08A 1QXPA 5IBWA 3PFVA 3I5HB 2HETA 4NDBA 2KQYA 4N5XA 2LLSA 3D10A 1CLLA 3KEVA 2KBMA 3D0YA 2B1UA 5JOLA 2BL0B 2OTGB 2KOTA 1LA3A 1U5IA 4ICBA 1XFXO 3D0YB 1KK8B 5D7FA 2SCPA 4GFTA 1N0YA 1PRWA 2JPTA 1NYAA 1EG4A 1U5IB 4MN0A 4P2YB 4ORAB 1C7VA 2WC8A 1YURA 1KQMC 2M29A 3BUMB 2JULA 4HSZA 1CDPA 1F4OA 1DGUA 3FS7A 1L2OB 3OX5A 1XVJA 4WQ3A 1ALVA 3TS5C 1N2DA 1M46A
chains in the Genus database with same CATH superfamily
1J7PA 1BT6A 3CGAA 3CS1A 3R72A 2FOTA 4KYNA 1KSOA 1NX2A 1JF0A 2EC6B 3I5GB 5FI6A 3WHTB 2GV5A 2KFGA 1TNPA 2O5GA 3Q8IA 4E68A 2Q91A 3DF0A 1TUJA 3S0GA 1QV0A 3TDUA 4PHMA 1W7JB 2LUXA 1QX5B 2YGUA 4NDDA 1M39A 3TUYB 1NPQA 3DF0B 3QMEA 3RM1A 4DIRA 4QJ5B 2JXCA 3SG3A 1H8BA 3BJHA 4YGAA 3R1OA 1DVIA 1DJXA 2LE9B 1RJVA 1UHKA 3HCMA 5I94A 5DKQA 1A29A 1CLMA 3CZ1A 2KSPA 4FQTA 3VRRA 1K90D 4YGBB 2KAVA 1J7OA 1TWOA 1K9PA 3PM2A 2KAYA 4PE7A 3EVUA 1JUOA 2MHHA 3NHIA 2ZNDA 3B7AA 4N1GA 4CPVA 1K93D 3BYAA 4YI8A 4A4BA 1CNPA 2ZN8A 4GGFC 1RTP1 2K7CA 4A4CA 2V53A 3CZ0A 3WXAA 1G8IA 2QPTA 4PHJA 2QEOA 2K7BA 4I5KA 1J55A 1LVCD 3A8RA 1JFKA 1TUZA 3I5FB 3VROA 1YRTB 2KPHA 4ORBB 1CFFA 3CYZA 4PT1A 2HF5A 1UHHA 1V1FA 3FIAA 1OOGA 2QACA 3K21A 1JWDA 1MHOA 1ORGA 2NXQA 4GUKA 2H8VA 3SJSA 1OZOA 3LK0A 2LCPA 2KAXA 4L9MA 2KQ6A 2M1UA 5ER5A 4QJ3B 5HL1A 2I94A 1XO5A 2WCKA 1MF8B 1AUIB 1SPYA 2JTTA 1MUXA 3EVRA 1SR6C 2MJWB 3OBVA 1M31A 1KFXL 2L51A 1A2XA 1MR8A 1TNQA 4MBEA 4JPZB 2I7AA 2PMYA 1J7RA 1WDCC 5GQQC 1OMDA 1T14A 1J1EA 1DELA 1QX2A 1ZFSA 5DKNA 2LP2A 3PM8A 2OS8C 1PVBA 2HPSA 3GK1A 1UURA 3IVTA 1IQ3A 5AERA 2D8NA 3L4LA 3C1VA 1PULA 2LLUA 2LVKA 3SIAA 3TZ1A 1CDLA 1S1EA 1WRLA 2PQLA 1SCMC 4GBAA 2L4HA 1KSMA 2H2KA 1AJ4A 1KWOC 1YX8A 2JT8A 1L7ZA 2A4JA 3DD4A 3KHEA 2CXJA 2K7DA 3PLFB 1KCYA 1DC1A 1XFWO 1NX3A 2VRGA 3SIBA 1OQPA 4PDZA 4M2QA 2ZRTA 2H61C 1DJWA 1ZOTB 2LMTA 3D74A 2E30A 3LCPC 1EH2A 1ALWA 2M0RA 5ER4X 1F4QA 1S6IA 1OOFA 1YVLA 3IQQA 3OB2B 3PALA 1TCFA 2JZIA 5HYDA 1ODBA 1DJHA 1AK8A 1QJTA 3EK4A 3FE8A 2FCDA 1XK4A 1OMVA 3I5HC 3CDNA 1XA5A 3KO0A 1FF1A 1QLKA 3DVMA 1AP4A 1K95A 1SK6D 1XFUO 2KFFA 2ZN9A 4CFRA 2IS9A 2WCLA 4BY4A 1IH0A 1UP5A 1KFXS 1XFZO 2BL0C 2OTGC 2WOSA 4IJ7A 1Y1XA 1OMRA 1PSRA 2EHBA 1S5GZ 3DXLA 4DS7A 1QV1A 1B8RA 1X02A 1S5GY 2KLDA 5J3XA 1WRKA 1Y6WA 2KI6D 1GGZA 2JQ6A 2PYQA 1MXLC 1QX7A 1EXRA 3LLEA 2WCJA 3HX4A 1SY9A 2BBNA 4JQ0D 2M97A 2JWWA 3S0DA 1UHIA 5BPJA 5JJGA 3WHUB 4M2PA 1LKJA 4C0LA 1CDMA 5CSIA 2KGRA 1QWVA 1XYDA 1J7QA 1NCXA 2M49B 3AKBA 3LL8B 2M7LA 2JTZA 1DMOA 1JBAA 4OVNF 1GQMA 1CFPA 2JC2A 1Z4HA 1R2UA 4GPLB 2EC6C 2KFHA 4XYNA 2BKIB 3ICBA 2WORA 3L4AA 1XFYO 1SL9A 4TNCA 1IJ5A 4MEWA 2OPOA 5HKZA 3TUYC 1RROA 1Z2CB 2K0JA 3MSEB 2CCMA 4ZCVA 3GK2A 3WNXB 3S0FA 1D1OA 1FPWA 1S3PA 2WC6A 3PN7C 1XFRA 1SYMA 2L2EA 3DZTA 1RECA 2LVVA 1R6PA 3D76A 1OOJA 1UUSA 4OCIA 4MRYA 3IF7A 2QEBA 2Y1NA 3JTDB 3NSIA 1JSAA 1XFVO 1NX1A 3NGVA 1KQMB 2AAOA 4ETOA 3EKHA 1SNLA 3CLNA 3L47A 1BJFA 5EL2A 3SS3A 3EG5B 1B8CA 3I5IC 3TS5B 3BFAA 3I5FC 1B4CA 2LVIA 2MLEC 4YI9A 1C07A 3SG5A 1CM1A 1JF2A 1PSBA 3JVTB 2WCHA 4OV2A 1NIWA 1Y0VH 3FWCA 4PCWA 1IGVA 2M8UA 1LXFC 2JU0A 4Q04A 2I18A 2LMVA 1SMGA 1HQVA 1VRKA 1F55A 2BECA 3BFHA 4N1FA 3GOFA 2COLB 3K1EA 3TDIA 1CMGA 1KFUL 3CABA 3CR2A 2RGIA 4AOMA 3VRNA 4R1EA 1IKUA 1B9AA 1OOIX 2JXLA 2L5XB 2NCPA 3EK8A 2CNPA 1Y1AA 1G33A 4FTGA 3O4YA 4GGFA 2BKHB 4INWA 1MWNA 2F8PA 4PHNA 1TN4A 1AVSA 2CT9A 3ZWHA 2LANA 2BAPA 2BNXA 3OB1B 3E3RA 3RZSA 1HT9A 1DGVA 3CR4X 3CTNA 5DKRA 5K89A 2LHLA 4WQ2A 1W9ZA 4XJKA 1B1GA 4GNKB 2WNDA 2Y1MA 2O60A 4MLWA 3SS5A 2P6BB 1OSAA 1YRUB 2L5YA 3EKJA 4ZCUA 4MZKA 1BU3A 1BR4B 5FI7A 3NSOA 4XJKB 3AAKA 3S0AA 1M45A 2FJUB 1FI6A 1NSHA 1SL7A 1ZUZA 3VRQA 2K8MB 3EVVA 4UPGA 1B47A 1QTXA 1S6JA 1QS7A 4CFQA 3M0WA 2E6WA 3BUNB 2L98A 1G4YR 2LAPA 5FYXA 5AANA 2LNKA 3VGOA 1FI5A 1IRJA 1B7TZ 2JT3A 1FW4A 2KLEA 3B6XA 1S6CA 3PSRA 1B7TY 3R1VA 1RWYA 1NX0A 1RFJA 1K9KA 1SKTA 3B87A 3QRXA 4DRWA 3PATA 2ZNEA 2OS8B 1K9UA 3D78A 1IQ5A 2LMUA 1YVHA 1TOPA 4USLA 3SG4A 1C7WA 2F2PA 2DOQA 3BUOB 1KK8C 5CSNA 5AXIA 4CIDA 2JT0A 4JKTA 1OZSA 2CBLA 2JRFA 2KNEA 2Y5IA 1SCMB 2LVJA 4HRHA 2Q4UA 4ORCB 3DVKA 2H61A 1NWDA 2LUCA 2MAZA 2KI6C 3PJIA 2K61A 1IJ6A 2LM5A 1Y1UA 1TRFA 2WCFA 1K2HA 2F3ZA 1L2OC 5HKWA 3OGNA 1MXEA 1P28A 2KI4B 4PHKA 3N7HA 1GGWA 5CSJA 1UHJA 2WCBA 5I8NA 1C3YA 5B8IB 2L2CA 2AMIA 1FBVA 2KDHA 1YUSA 2ZKMX 2BE6A 1NCYA 1TTXA 2GGMA 3O78A 3ZNIA 1DJIA 3I5GC 1YTZC 2M1KB 3O4XA 4F7FA 4PE0A 2KYFA 2G2BA 2F33A 1W7IB 3BFBA 1DJYA 1DTLA 1CFDA 2LC5A 1QLSA 3TDZA 2MLFC 1SBJA 3KF9A 2JNXA 4C0KA 4D1EA 1QASA 3CR5X 1NCZA 3VRPA 1IG5A 1IIOA 1WY9A 4DCKA 2BBMA 2MA2A 4PE1A 1YR5A 1OOHA 3D73A 4GAOA 3V2LA 1DF0A 1QATA 3JTDC 2GGZA 5CSFA 5HKYA 1SRAA 3KPXA 5KSZA 1PVAA 3RLZA 3IQOA 3B88A 4OKHA 1K8UA 3NXAA 5TNCA 1DF0B 1A75A 1CM4A 2WCMA 2EGDA 4C0JA 3A4UB 2KGBC 1UWOA 3OP0A 2R2IA 1S36A 1A75B 2I2RE 2WCEA 5HLOA 1YUTA 4I5JA 1EJ3A 4OR9B 3EK7A 3O2PA 5FI2A 3JVTC 1BLQA 3R1PA 2NLNA 1F70A 1J1DA 1QIVA 5AFPA 5I2OA 4MZJA 4MZLA 5CPVA 2ISDA 1A03A 1MQ1A 2QDIA 2LHIA 4F0ZB 4AQIA 5HLVA 4YGCB 3SG7A 1OW4A 2CTNA 4I5LB 1CLBA 4OZDA 2PSRA 4YBHB 1E8AA 1M63B 2P70A 1NP8A 3DVEA 1S26D 2K2AA 3H4SE 3NSLA 1V1GA 4INXA 4P5OE 4QJ4B 3LK1A 4DUQA 3DYEA 3PN7B 1AJ5A 4PE4A 1BG1A 2BE4A 1KQVA 4JD9A 4MRXA 2L0PA 4NDCA 1K96A 3OX6A 4GGNA 2BCAA 4FQOA 1Q80A 1PALA 3BQ3A 4HRGA 3SG6A 2K2FA 1H4BA 1SW8A 5D69A 1F8HA 2FJYA 2M9GA 2TN4A 1DT7B 1DJZA 1BF5A 1CFCA 1C3ZA 2K7OA 2G9BA 2JNFA 1A4PA 1B8LA 2PVBA 2JPOA 4U8DA 1GM0A 2QEVA 1CMFA 3BXKA 3I5IB 1EG3A 4IL1A 1TNXA 1CKKA 2PASA 5PALA 1LS8A 3S0EA 3CZ2A 1F71A 1SCVA 5F6TA 2LP3A 3FE9A 1BOCA 1OE9B 3NSKA 5DICA 4YRUA 1CTRA 2KBIA 5I2LA 4HREE 1WLMA 1RK9A 3DY9A 4MVFA 2BCXA 2BCBA 3CWGA 2LV7A 1F54A 2KHNA 2HQ8A 3BUXB 2AUCA 3BUWB 2PRUA 1BODA 1BR1B 1TCOB 1N65A 3B86A 1KFUS 3GK4X 1XK4C 2LLTA 2NCOA 2KYCA 1TNWA 3BOWA 1PK0D 2MBXA 1TIZA 3D75A 1LINA 1SR6B 2F3YA 3FE6A 2K60A 3D77A 2F2OA 1SSEB 1UHNA 2QEHA 3BOWB 1EL4A 2MRDA 2PALA 1WDCB 4YGDB 1AHRA 2SASA 1WRZA 3O6BA 1JFJA 1GJYA 3FWBA 4BY5A 2P71A 4CLNA 4NQGA 2ZRSA 4JWQA 1WLZA 2HQWA 3SG2A 3SS4A 2ERBA 1NUBA 2M7NA 5I2QA 5KTYA 4MSPA 1DJGA 2L50A 1CB1A 1JC2A 3DVJA 1SL8A 4I5NB 4M2OA 4PALA 3S0BA 1KWOB 1QVIZ 2JOJA 1ZACA 1K94A 1KK7Z 1QVIY 2KI4C 4WRIA 1KK7Y 5KU1A 1LA0A 2GTEA 5D3OA 3OHMB 1CDNA 3AKAA 2M3WA 2Y4QA 5AEQA 2FCEA 4YGEB 1IWQA 1YUUA 3F45A 4AQJA 1BMOA 1YX7A 2NZ0A 2ZFDA 1QIWA 3AAJA 2L4IA 3CZTX 1ZMZA 5G08A 1QXPA 5IBWA 3NHTA 3I5HB 3PFVA 2HETA 4NDBA 2KQYA 4N5XA 2LLSA 3D10A 1CLLA 3KEVA 2KBMA 3D0YA 2B1UA 5JOLA 2BL0B 2OTGB 2KOTA 1LA3A 1U5IA 4ICBA 1XFXO 3D0YB 1KK8B 5D7FA 2SCPA 4GFTA 1N0YA 1PRWA 2JPTA 1NYAA 1EG4A 1U5IB 4MN0A 4P2YB 4ORAB 1C7VA 2WC8A 1YURA 3VB1A 1KQMC 2M29A 3BUMB 2JULA 4HSZA 2WC5A 1DEKA 1CDPA 1DQEA 1F4OA 1DGUA 3FS7A 1L2OB 3OX5A 1XVJA 4WQ3A 1ALVA 3TS5C 3UO9A 1N2DA 3UNWA 1M46A
chains in the Genus database with same CATH topology
1J7PA 1BT6A 3CGAA 3CS1A 2FOTA 1KSOA 1NX2A 1JF0A 2EC6B 3I5GB 3WHTB 2GV5A 2KFGA 1TNPA 2O5GA 4E68A 2Q91A 3DF0A 3TDUA 1QV0A 4PHMA 1W7JB 2LUXA 1QX5B 4NDDA 1M39A 3TUYB 1NPQA 3DF0B 3RM1A 4DIRA 4QJ5B 2JXCA 3SG3A 1H8BA 4YGAA 1DVIA 1DJXA 2LE9B 1RJVA 1UHKA 3HCMA 5DKQA 1A29A 1CLMA 2KSPA 3VRRA 1K90D 4YGBB 2KAVA 1J7OA 1K9PA 2KAYA 4PE7A 3EVUA 1JUOA 2MHHA 2ZNDA 4N1GA 4CPVA 1K93D 3BYAA 4YI8A 4A4BA 1CNPA 2ZN8A 4GGFC 1RTP1 2K7CA 4A4CA 2V53A 3WXAA 1G8IA 2QPTA 4PHJA 2K7BA 4I5KA 1J55A 1LVCD 3A8RA 1JFKA 3I5FB 3VROA 1YRTB 1CFFA 4ORBB 2HF5A 1UHHA 1V1FA 3FIAA 2QACA 3K21A 1JWDA 1MHOA 2NXQA 4GUKA 3SJSA 1OZOA 3LK0A 2LCPA 2KAXA 4L9MA 2KQ6A 2M1UA 5ER5A 4QJ3B 2I94A 1XO5A 1MF8B 1AUIB 1SPYA 2JTTA 1MUXA 3EVRA 1SR6C 2MJWB 1M31A 1KFXL 2L51A 1A2XA 1MR8A 1TNQA 4MBEA 4JPZB 2I7AA 2PMYA 1J7RA 1WDCC 5GQQC 1OMDA 1J1EA 1QX2A 1ZFSA 5DKNA 2LP2A 3PM8A 2OS8C 1PVBA 2HPSA 3GK1A 1UURA 1IQ3A 5AERA 2D8NA 3C1VA 1PULA 2LLUA 2LVKA 3SIAA 3TZ1A 1CDLA 1S1EA 1WRLA 4GBAA 1SCMC 4MLWA 2L4HA 1KSMA 2H2KA 1AJ4A 1KWOC 1YX8A 2JT8A 1L7ZA 2A4JA 3DD4A 3KHEA 2CXJA 2K7DA 3PLFB 1KCYA 1XFWO 1NX3A 2VRGA 3SIBA 1OQPA 4PDZA 4M2QA 2ZRTA 2H61C 1DJWA 1ZOTB 2LMTA 2E30A 3LCPC 1EH2A 1ALWA 2M0RA 5ER4X 1F4QA 1S6IA 1YVLA 3IQQA 3OB2B 3PALA 1TCFA 2JZIA 5HYDA 1ODBA 1DJHA 1AK8A 1QJTA 3EK4A 2FCDA 1XK4A 1OMVA 3I5HC 3KO0A 1XA5A 1FF1A 1QLKA 3DVMA 1AP4A 1K95A 1SK6D 1XFUO 2KFFA 2ZN9A 4CFRA 2IS9A 4BY4A 1IH0A 1UP5A 1KFXS 1XFZO 2BL0C 2OTGC 2WOSA 1Y1XA 1OMRA 1PSRA 2EHBA 1S5GZ 4DS7A 1QV1A 1B8RA 1X02A 1S5GY 5J3XA 1WRKA 1Y6WA 2KI6D 1GGZA 2JQ6A 1MXLC 1QX7A 1EXRA 3LLEA 3HX4A 1SY9A 2BBNA 4JQ0D 2M97A 2JWWA 1UHIA 5BPJA 5JJGA 3WHUB 4M2PA 1LKJA 4C0LA 1CDMA 5CSIA 2KGRA 1XYDA 1J7QA 1NCXA 2M49B 3AKBA 3LL8B 2M7LA 2JTZA 1DMOA 1JBAA 4OVNF 1GQMA 1CFPA 2JC2A 1R2UA 4GPLB 2EC6C 2KFHA 4XYNA 2BKIB 3ICBA 2WORA 1XFYO 1SL9A 4TNCA 1IJ5A 4MEWA 2OPOA 5HKZA 3TUYC 1RROA 2K0JA 3MSEB 2CCMA 4ZCVA 3GK2A 3WNXB 1D1OA 1FPWA 1S3PA 3PN7C 1SYMA 2L2EA 1RECA 2LVVA 1R6PA 1OOJA 1UUSA 4OCIA 4MRYA 3IF7A 2Y1NA 3JTDB 3NSIA 1JSAA 1XFVO 1NX1A 1KQMB 2AAOA 4ETOA 3EKHA 1SNLA 3CLNA 1BJFA 1B8CA 3I5IC 3TS5B 3I5FC 1B4CA 2LVIA 2MLEC 4YI9A 1C07A 3SG5A 1CM1A 1JF2A 1PSBA 3JVTB 4OV2A 1NIWA 1Y0VH 3FWCA 4PCWA 1IGVA 2M8UA 1LXFC 2JU0A 4Q04A 2I18A 2LMVA 1SMGA 1HQVA 1VRKA 1F55A 2BECA 4N1FA 3GOFA 2COLB 3TDIA 1CMGA 1KFUL 3CR2A 2RGIA 4AOMA 3VRNA 4R1EA 1IKUA 1B9AA 2JXLA 2L5XB 2NCPA 3EK8A 2CNPA 1Y1AA 1G33A 4FTGA 3O4YA 4GGFA 2BKHB 1MWNA 2F8PA 4PHNA 1TN4A 1AVSA 2CT9A 3ZWHA 2LANA 3OB1B 3E3RA 1HT9A 1DGVA 3CR4X 3CTNA 5DKRA 5K89A 2LHLA 4WQ2A 4XJKA 1B1GA 4GNKB 2WNDA 2Y1MA 2O60A 2P6BB 1OSAA 1YRUB 3EKJA 4ZCUA 4MZKA 1BU3A 1BR4B 3NSOA 4XJKB 3AAKA 1M45A 2FJUB 1FI6A 1NSHA 1SL7A 1ZUZA 3VRQA 2K8MB 3EVVA 4UPGA 1B47A 1QTXA 1S6JA 1QS7A 4CFQA 3M0WA 2E6WA 3BUNB 2L98A 1G4YR 2LAPA 5FYXA 5AANA 2LNKA 3VGOA 1FI5A 1IRJA 1B7TZ 2JT3A 1FW4A 3PSRA 1S6CA 1B7TY 1RWYA 1NX0A 1RFJA 1K9KA 1SKTA 3QRXA 4DRWA 3PATA 2ZNEA 2OS8B 1K9UA 1IQ5A 2LMUA 1YVHA 1TOPA 4USLA 3SG4A 1C7WA 2F2PA 2DOQA 3BUOB 1KK8C 5CSNA 5AXIA 4CIDA 2JT0A 1OZSA 2CBLA 2JRFA 2KNEA 2Y5IA 1SCMB 2LVJA 4HRHA 2Q4UA 4ORCB 3DVKA 2H61A 1NWDA 2LUCA 2MAZA 2KI6C 2K61A 1IJ6A 2LM5A 1Y1UA 1TRFA 2WCFA 1K2HA 2F3ZA 1L2OC 5HKWA 1MXEA 2KI4B 4PHKA 1GGWA 5CSJA 1UHJA 2WCBA 5I8NA 5B8IB 2AMIA 1FBVA 2KDHA 1YUSA 2ZKMX 2BE6A 1NCYA 1TTXA 2GGMA 3O78A 3ZNIA 1DJIA 3I5GC 1YTZC 2M1KB 4PE0A 2KYFA 2G2BA 2F33A 1W7IB 1DJYA 1DTLA 1CFDA 2LC5A 1QLSA 3TDZA 2MLFC 1SBJA 3KF9A 2JNXA 4C0KA 4D1EA 1QASA 3CR5X 1NCZA 3VRPA 1IG5A 1WY9A 4DCKA 2BBMA 2MA2A 4PE1A 1YR5A 4GAOA 1DF0A 1QATA 3JTDC 2GGZA 5CSFA 5HKYA 1SRAA 3KPXA 5KSZA 1PVAA 3RLZA 3IQOA 4OKHA 1K8UA 3NXAA 5TNCA 1DF0B 1A75A 1CM4A 2EGDA 4C0JA 3A4UB 2KGBC 1UWOA 3OP0A 2R2IA 1S36A 1A75B 2I2RE 2WCEA 5HLOA 1YUTA 4I5JA 1EJ3A 4OR9B 3EK7A 3O2PA 1BLQA 3JVTC 1F70A 2NLNA 1J1DA 1QIVA 5AFPA 5I2OA 4MZJA 4MZLA 5CPVA 2ISDA 1A03A 1MQ1A 2LHIA 4F0ZB 4AQIA 5HLVA 4YGCB 3SG7A 4I5LB 2CTNA 1CLBA 2PSRA 4YBHB 1E8AA 1M63B 3DVEA 1NP8A 3NSLA 1S26D 2K2AA 3H4SE 4QJ4B 1V1GA 4P5OE 3LK1A 4DUQA 1BG1A 3PN7B 1AJ5A 4PE4A 2BE4A 1KQVA 4MRXA 2L0PA 4NDCA 1K96A 3OX6A 4GGNA 2BCAA 4FQOA 1Q80A 1PALA 3BQ3A 4HRGA 3SG6A 2K2FA 1H4BA 1SW8A 5D69A 1F8HA 2M9GA 2TN4A 1DT7B 1DJZA 1BF5A 1CFCA 2K7OA 2G9BA 2JNFA 1A4PA 1B8LA 2PVBA 4U8DA 1CMFA 3BXKA 3I5IB 1EG3A 4IL1A 1TNXA 1CKKA 2PASA 5PALA 1F71A 1SCVA 5F6TA 2LP3A 1BOCA 1OE9B 3NSKA 4YRUA 1CTRA 2KBIA 5I2LA 4HREE 1WLMA 1RK9A 4MVFA 2BCXA 2BCBA 3CWGA 2LV7A 1F54A 2KHNA 2HQ8A 3BUXB 2AUCA 3BUWB 2PRUA 1BODA 1BR1B 1TCOB 1N65A 1KFUS 3GK4X 1XK4C 2LLTA 2NCOA 2KYCA 1TNWA 3BOWA 1PK0D 2MBXA 1TIZA 1LINA 1SR6B 2F3YA 2F2OA 1UHNA 3BOWB 1EL4A 2MRDA 2PALA 1WDCB 4YGDB 1AHRA 2SASA 1WRZA 3O6BA 1JFJA 1GJYA 3FWBA 4BY5A 4CLNA 4NQGA 2ZRSA 4JWQA 1WLZA 2HQWA 3SG2A 2M7NA 1NUBA 5I2QA 5KTYA 4MSPA 1DJGA 2L50A 1CB1A 1JC2A 3DVJA 1SL8A 4I5NB 4M2OA 4PALA 1KWOB 1QVIZ 2JOJA 1ZACA 1K94A 1KK7Z 1QVIY 2KI4C 4WRIA 1KK7Y 5KU1A 1LA0A 3OHMB 1CDNA 3AKAA 2M3WA 2Y4QA 5AEQA 2FCEA 4YGEB 1IWQA 1YUUA 3F45A 4AQJA 1BMOA 1YX7A 2NZ0A 2ZFDA 1QIWA 3AAJA 2L4IA 3CZTX 1ZMZA 5G08A 1QXPA 5IBWA 3PFVA 3I5HB 2HETA 4NDBA 2KQYA 4N5XA 2LLSA 3D10A 1CLLA 3KEVA 2KBMA 3D0YA 2B1UA 5JOLA 2BL0B 2OTGB 2KOTA 1LA3A 1U5IA 4ICBA 1XFXO 3D0YB 1KK8B 5D7FA 2SCPA 4GFTA 1N0YA 1PRWA 2JPTA 1NYAA 1EG4A 1U5IB 4MN0A 4P2YB 4ORAB 1C7VA 2WC8A 1YURA 1KQMC 2M29A 3BUMB 2JULA 4HSZA 1CDPA 1F4OA 1DGUA 3FS7A 1L2OB 3OX5A 1XVJA 4WQ3A 1ALVA 3TS5C 1N2DA 1M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7P A;  1BT6 A;  3CGA A;  3CS1 A;  2FOT A;  1KSO A;  1NX2 A;  1JF0 A;  2EC6 B;  3I5G B;  3WHT B;  2GV5 A;  2KFG A;  1TNP A;  2O5G A;  4E68 A;  2Q91 A;  3DF0 A;  3TDU A;  1QV0 A;  4PHM A;  1W7J B;  2LUX A;  1QX5 B;  4NDD A;  1M39 A;  3TUY B;  1NPQ A;  3DF0 B;  3RM1 A;  4DIR A;  4QJ5 B;  2JXC A;  3SG3 A;  1H8B A;  4YGA A;  1DVI A;  1DJX A;  2LE9 B;  1RJV A;  1UHK A;  3HCM A;  5DKQ A;  1A29 A;  1CLM A;  2KSP A;  3VRR A;  1K90 D;  4YGB B;  2KAV A;  1J7O A;  1K9P A;  2KAY A;  4PE7 A;  3EVU A;  1JUO A;  2MHH A;  2ZND A;  4N1G A;  4CPV A;  1K93 D;  3BYA A;  4YI8 A;  4A4B A;  1CNP A;  2ZN8 A;  4GGF C;  1RTP 1;  2K7C A;  4A4C A;  2V53 A;  3WXA A;  1G8I A;  2QPT A;  4PHJ A;  2K7B A;  4I5K A;  1J55 A;  1LVC D;  3A8R A;  1JFK A;  3I5F B;  3VRO A;  1YRT B;  1CFF A;  4ORB B;  2HF5 A;  1UHH A;  1V1F A;  3FIA A;  2QAC A;  3K21 A;  1JWD A;  1MHO A;  2NXQ A;  4GUK A;  3SJS A;  1OZO A;  3LK0 A;  2LCP A;  2KAX A;  4L9M A;  2KQ6 A;  2M1U A;  5ER5 A;  4QJ3 B;  2I94 A;  1XO5 A;  1MF8 B;  1AUI B;  1SPY A;  2JTT A;  1MUX A;  3EVR A;  1SR6 C;  2MJW B;  1M31 A;  1KFX L;  2L51 A;  1A2X A;  1MR8 A;  1TNQ A;  4MBE A;  4JPZ B;  2I7A A;  2PMY A;  1J7R A;  1WDC C;  5GQQ C;  1OMD A;  1J1E A;  1QX2 A;  1ZFS A;  5DKN A;  2LP2 A;  3PM8 A;  2OS8 C;  1PVB A;  2HPS A;  3GK1 A;  1UUR A;  1IQ3 A;  5AER A;  2D8N A;  3C1V A;  1PUL A;  2LLU A;  2LVK A;  3SIA A;  3TZ1 A;  1CDL A;  1S1E A;  1WRL A;  4GBA A;  1SCM C;  4MLW A;  2L4H A;  1KSM A;  2H2K A;  1AJ4 A;  1KWO C;  1YX8 A;  2JT8 A;  1L7Z A;  2A4J A;  3DD4 A;  3KHE A;  2CXJ A;  2K7D A;  3PLF B;  1KCY A;  1XFW O;  1NX3 A;  2VRG A;  3SIB A;  1OQP A;  4PDZ A;  4M2Q A;  2ZRT A;  2H61 C;  1DJW A;  1ZOT B;  2LMT A;  2E30 A;  3LCP C;  1EH2 A;  1ALW A;  2M0R A;  5ER4 X;  1F4Q A;  1S6I A;  1YVL A;  3IQQ A;  3OB2 B;  3PAL A;  1TCF A;  2JZI A;  5HYD A;  1ODB A;  1DJH A;  1AK8 A;  1QJT A;  3EK4 A;  2FCD A;  1XK4 A;  1OMV A;  3I5H C;  3KO0 A;  1XA5 A;  1FF1 A;  1QLK A;  3DVM A;  1AP4 A;  1K95 A;  1SK6 D;  1XFU O;  2KFF A;  2ZN9 A;  4CFR A;  2IS9 A;  4BY4 A;  1IH0 A;  1UP5 A;  1KFX S;  1XFZ O;  2BL0 C;  2OTG C;  2WOS A;  1Y1X A;  1OMR A;  1PSR A;  2EHB A;  1S5G Z;  4DS7 A;  1QV1 A;  1B8R A;  1X02 A;  1S5G Y;  5J3X A;  1WRK A;  1Y6W A;  2KI6 D;  1GGZ A;  2JQ6 A;  1MXL C;  1QX7 A;  1EXR A;  3LLE A;  3HX4 A;  1SY9 A;  2BBN A;  4JQ0 D;  2M97 A;  2JWW A;  1UHI A;  5BPJ A;  5JJG A;  3WHU B;  4M2P A;  1LKJ A;  4C0L A;  1CDM A;  5CSI A;  2KGR A;  1XYD A;  1J7Q A;  1NCX A;  2M49 B;  3AKB A;  3LL8 B;  2M7L A;  2JTZ A;  1DMO A;  1JBA A;  4OVN F;  1GQM A;  1CFP A;  2JC2 A;  1R2U A;  4GPL B;  2EC6 C;  2KFH A;  4XYN A;  2BKI B;  3ICB A;  2WOR A;  1XFY O;  1SL9 A;  4TNC A;  1IJ5 A;  4MEW A;  2OPO A;  5HKZ A;  3TUY C;  1RRO A;  2K0J A;  3MSE B;  2CCM A;  4ZCV A;  3GK2 A;  3WNX B;  1D1O A;  1FPW A;  1S3P A;  3PN7 C;  1SYM A;  2L2E A;  1REC A;  2LVV A;  1R6P A;  1OOJ A;  1UUS A;  4OCI A;  4MRY A;  3IF7 A;  2Y1N A;  3JTD B;  3NSI A;  1JSA A;  1XFV O;  1NX1 A;  1KQM B;  2AAO A;  4ETO A;  3EKH A;  1SNL A;  3CLN A;  1BJF A;  1B8C A;  3I5I C;  3TS5 B;  3I5F C;  1B4C A;  2LVI A;  2MLE C;  4YI9 A;  1C07 A;  3SG5 A;  1CM1 A;  1JF2 A;  1PSB A;  3JVT B;  4OV2 A;  1NIW A;  1Y0V H;  3FWC A;  4PCW A;  1IGV A;  2M8U A;  1LXF C;  2JU0 A;  4Q04 A;  2I18 A;  2LMV A;  1SMG A;  1HQV A;  1VRK A;  1F55 A;  2BEC A;  4N1F A;  3GOF A;  2COL B;  3TDI A;  1CMG A;  1KFU L;  3CR2 A;  2RGI A;  4AOM A;  3VRN A;  4R1E A;  1IKU A;  1B9A A;  2JXL A;  2L5X B;  2NCP A;  3EK8 A;  2CNP A;  1Y1A A;  1G33 A;  4FTG A;  3O4Y A;  4GGF A;  2BKH B;  1MWN A;  2F8P A;  4PHN A;  1TN4 A;  1AVS A;  2CT9 A;  3ZWH A;  2LAN A;  3OB1 B;  3E3R A;  1HT9 A;  1DGV A;  3CR4 X;  3CTN A;  5DKR A;  5K89 A;  2LHL A;  4WQ2 A;  4XJK A;  1B1G A;  4GNK B;  2WND A;  2Y1M A;  2O60 A;  2P6B B;  1OSA A;  1YRU B;  3EKJ A;  4ZCU A;  4MZK A;  1BU3 A;  1BR4 B;  3NSO A;  4XJK B;  3AAK A;  1M45 A;  2FJU B;  1FI6 A;  1NSH A;  1SL7 A;  1ZUZ A;  3VRQ A;  2K8M B;  3EVV A;  4UPG A;  1B47 A;  1QTX A;  1S6J A;  1QS7 A;  4CFQ A;  3M0W A;  2E6W A;  3BUN B;  2L98 A;  1G4Y R;  2LAP A;  5FYX A;  5AAN A;  2LNK A;  3VGO A;  1FI5 A;  1IRJ A;  1B7T Z;  2JT3 A;  1FW4 A;  3PSR A;  1S6C A;  1B7T Y;  1RWY A;  1NX0 A;  1RFJ A;  1K9K A;  1SKT A;  3QRX A;  4DRW A;  3PAT A;  2ZNE A;  2OS8 B;  1K9U A;  1IQ5 A;  2LMU A;  1YVH A;  1TOP A;  4USL A;  3SG4 A;  1C7W A;  2F2P A;  2DOQ A;  3BUO B;  1KK8 C;  5CSN A;  5AXI A;  4CID A;  2JT0 A;  1OZS A;  2CBL A;  2JRF A;  2KNE A;  2Y5I A;  1SCM B;  2LVJ A;  4HRH A;  2Q4U A;  4ORC B;  3DVK A;  2H61 A;  1NWD A;  2LUC A;  2MAZ A;  2KI6 C;  2K61 A;  1IJ6 A;  2LM5 A;  1Y1U A;  1TRF A;  2WCF A;  1K2H A;  2F3Z A;  1L2O C;  5HKW A;  1MXE A;  2KI4 B;  4PHK A;  1GGW A;  5CSJ A;  1UHJ A;  2WCB A;  5I8N A;  5B8I B;  2AMI A;  1FBV A;  2KDH A;  1YUS A;  2ZKM X;  2BE6 A;  1NCY A;  1TTX A;  2GGM A;  3O78 A;  3ZNI A;  1DJI A;  3I5G C;  1YTZ C;  2M1K B;  4PE0 A;  2KYF A;  2G2B A;  2F33 A;  1W7I B;  1DJY A;  1DTL A;  1CFD A;  2LC5 A;  1QLS A;  3TDZ A;  2MLF C;  1SBJ A;  3KF9 A;  2JNX A;  4C0K A;  4D1E A;  1QAS A;  3CR5 X;  1NCZ A;  3VRP A;  1IG5 A;  1WY9 A;  4DCK A;  2BBM A;  2MA2 A;  4PE1 A;  1YR5 A;  4GAO A;  1DF0 A;  1QAT A;  3JTD C;  2GGZ A;  5CSF A;  5HKY A;  1SRA A;  3KPX A;  5KSZ A;  1PVA A;  3RLZ A;  3IQO A;  4OKH A;  1K8U A;  3NXA A;  5TNC A;  1DF0 B;  1A75 A;  1CM4 A;  2EGD A;  4C0J A;  3A4U B;  2KGB C;  1UWO A;  3OP0 A;  2R2I A;  1S36 A;  1A75 B;  2I2R E;  2WCE A;  5HLO A;  1YUT A;  4I5J A;  1EJ3 A;  4OR9 B;  3EK7 A;  3O2P A;  1BLQ A;  3JVT C;  1F70 A;  2NLN A;  1J1D A;  1QIV A;  5AFP A;  5I2O A;  4MZJ A;  4MZL A;  5CPV A;  2ISD A;  1A03 A;  1MQ1 A;  2LHI A;  4F0Z B;  4AQI A;  5HLV A;  4YGC B;  3SG7 A;  4I5L B;  2CTN A;  1CLB A;  2PSR A;  4YBH B;  1E8A A;  1M63 B;  3DVE A;  1NP8 A;  3NSL A;  1S26 D;  2K2A A;  3H4S E;  4QJ4 B;  1V1G A;  4P5O E;  3LK1 A;  4DUQ A;  1BG1 A;  3PN7 B;  1AJ5 A;  4PE4 A;  2BE4 A;  1KQV A;  4MRX A;  2L0P A;  4NDC A;  1K96 A;  3OX6 A;  4GGN A;  2BCA A;  4FQO A;  1Q80 A;  1PAL A;  3BQ3 A;  4HRG A;  3SG6 A;  2K2F A;  1H4B A;  1SW8 A;  5D69 A;  1F8H A;  2M9G A;  2TN4 A;  1DT7 B;  1DJZ A;  1BF5 A;  1CFC A;  2K7O A;  2G9B A;  2JNF A;  1A4P A;  1B8L A;  2PVB A;  4U8D A;  1CMF A;  3BXK A;  3I5I B;  1EG3 A;  4IL1 A;  1TNX A;  1CKK A;  2PAS A;  5PAL A;  1F71 A;  1SCV A;  5F6T A;  2LP3 A;  1BOC A;  1OE9 B;  3NSK A;  4YRU A;  1CTR A;  2KBI A;  5I2L A;  4HRE E;  1WLM A;  1RK9 A;  4MVF A;  2BCX A;  2BCB A;  3CWG A;  2LV7 A;  1F54 A;  2KHN A;  2HQ8 A;  3BUX B;  2AUC A;  3BUW B;  2PRU A;  1BOD A;  1BR1 B;  1TCO B;  1N65 A;  1KFU S;  3GK4 X;  1XK4 C;  2LLT A;  2NCO A;  2KYC A;  1TNW A;  3BOW A;  1PK0 D;  2MBX A;  1TIZ A;  1LIN A;  1SR6 B;  2F3Y A;  2F2O A;  1UHN A;  3BOW B;  1EL4 A;  2MRD A;  2PAL A;  1WDC B;  4YGD B;  1AHR A;  2SAS A;  1WRZ A;  3O6B A;  1JFJ A;  1GJY A;  3FWB A;  4BY5 A;  4CLN A;  4NQG A;  2ZRS A;  4JWQ A;  1WLZ A;  2HQW A;  3SG2 A;  2M7N A;  1NUB A;  5I2Q A;  5KTY A;  4MSP A;  1DJG A;  2L50 A;  1CB1 A;  1JC2 A;  3DVJ A;  1SL8 A;  4I5N B;  4M2O A;  4PAL A;  1KWO B;  1QVI Z;  2JOJ A;  1ZAC A;  1K94 A;  1KK7 Z;  1QVI Y;  2KI4 C;  4WRI A;  1KK7 Y;  5KU1 A;  1LA0 A;  3OHM B;  1CDN A;  3AKA A;  2M3W A;  2Y4Q A;  5AEQ A;  2FCE A;  4YGE B;  1IWQ A;  1YUU A;  3F45 A;  4AQJ A;  1BMO A;  1YX7 A;  2NZ0 A;  2ZFD A;  1QIW A;  3AAJ A;  2L4I A;  3CZT X;  1ZMZ A;  5G08 A;  1QXP A;  5IBW A;  3PFV A;  3I5H B;  2HET A;  4NDB A;  2KQY A;  4N5X A;  2LLS A;  3D10 A;  1CLL A;  3KEV A;  2KBM A;  3D0Y A;  2B1U A;  5JOL A;  2BL0 B;  2OTG B;  2KOT A;  1LA3 A;  1U5I A;  4ICB A;  1XFX O;  3D0Y B;  1KK8 B;  5D7F A;  2SCP A;  4GFT A;  1N0Y A;  1PRW A;  2JPT A;  1NYA A;  1EG4 A;  1U5I B;  4MN0 A;  4P2Y B;  4ORA B;  1C7V A;  2WC8 A;  1YUR A;  1KQM C;  2M29 A;  3BUM B;  2JUL A;  4HSZ A;  1CDP A;  1F4O A;  1DGU A;  3FS7 A;  1L2O B;  3OX5 A;  1XVJ A;  4WQ3 A;  1ALV A;  3TS5 C;  1N2D A;  1M46 A; 
#chains in the Genus database with same CATH topology
 1J7P A;  1BT6 A;  3CGA A;  3CS1 A;  3R72 A;  2FOT A;  4KYN A;  1KSO A;  1NX2 A;  1JF0 A;  2EC6 B;  3I5G B;  5FI6 A;  3WHT B;  2GV5 A;  2KFG A;  1TNP A;  2O5G A;  3Q8I A;  4E68 A;  2Q91 A;  3DF0 A;  1TUJ A;  3S0G A;  1QV0 A;  3TDU A;  4PHM A;  1W7J B;  2LUX A;  1QX5 B;  2YGU A;  4NDD A;  1M39 A;  3TUY B;  1NPQ A;  3DF0 B;  3QME A;  3RM1 A;  4DIR A;  4QJ5 B;  2JXC A;  3SG3 A;  1H8B A;  3BJH A;  4YGA A;  3R1O A;  1DVI A;  1DJX A;  2LE9 B;  1RJV A;  1UHK A;  3HCM A;  5I94 A;  5DKQ A;  1A29 A;  1CLM A;  3CZ1 A;  2KSP A;  4FQT A;  3VRR A;  1K90 D;  4YGB B;  2KAV A;  1J7O A;  1TWO A;  1K9P A;  3PM2 A;  2KAY A;  4PE7 A;  3EVU A;  1JUO A;  2MHH A;  3NHI A;  2ZND A;  3B7A A;  4N1G A;  4CPV A;  1K93 D;  3BYA A;  4YI8 A;  4A4B A;  1CNP A;  2ZN8 A;  4GGF C;  1RTP 1;  2K7C A;  4A4C A;  2V53 A;  3CZ0 A;  3WXA A;  1G8I A;  2QPT A;  4PHJ A;  2QEO A;  2K7B A;  4I5K A;  1J55 A;  1LVC D;  3A8R A;  1JFK A;  1TUZ A;  3I5F B;  3VRO A;  1YRT B;  2KPH A;  4ORB B;  1CFF A;  3CYZ A;  4PT1 A;  2HF5 A;  1UHH A;  1V1F A;  3FIA A;  1OOG A;  2QAC A;  3K21 A;  1JWD A;  1MHO A;  1ORG A;  2NXQ A;  4GUK A;  2H8V A;  3SJS A;  1OZO A;  3LK0 A;  2LCP A;  2KAX A;  4L9M A;  2KQ6 A;  2M1U A;  5ER5 A;  4QJ3 B;  5HL1 A;  2I94 A;  1XO5 A;  2WCK A;  1MF8 B;  1AUI B;  1SPY A;  2JTT A;  1MUX A;  3EVR A;  1SR6 C;  2MJW B;  3OBV A;  1M31 A;  1KFX L;  2L51 A;  1A2X A;  1MR8 A;  1TNQ A;  4MBE A;  4JPZ B;  2I7A A;  2PMY A;  1J7R A;  1WDC C;  5GQQ C;  1OMD A;  1T14 A;  1J1E A;  1DEL A;  1QX2 A;  1ZFS A;  5DKN A;  2LP2 A;  3PM8 A;  2OS8 C;  1PVB A;  2HPS A;  3GK1 A;  1UUR A;  3IVT A;  1IQ3 A;  5AER A;  2D8N A;  3L4L A;  3C1V A;  1PUL A;  2LLU A;  2LVK A;  3SIA A;  3TZ1 A;  1CDL A;  1S1E A;  1WRL A;  2PQL A;  1SCM C;  4GBA A;  2L4H A;  1KSM A;  2H2K A;  1AJ4 A;  1KWO C;  1YX8 A;  2JT8 A;  1L7Z A;  2A4J A;  3DD4 A;  3KHE A;  2CXJ A;  2K7D A;  3PLF B;  1KCY A;  1DC1 A;  1XFW O;  1NX3 A;  2VRG A;  3SIB A;  1OQP A;  4PDZ A;  4M2Q A;  2ZRT A;  2H61 C;  1DJW A;  1ZOT B;  2LMT A;  3D74 A;  2E30 A;  3LCP C;  1EH2 A;  1ALW A;  2M0R A;  5ER4 X;  1F4Q A;  1S6I A;  1OOF A;  1YVL A;  3IQQ A;  3OB2 B;  3PAL A;  1TCF A;  2JZI A;  5HYD A;  1ODB A;  1DJH A;  1AK8 A;  1QJT A;  3EK4 A;  3FE8 A;  2FCD A;  1XK4 A;  1OMV A;  3I5H C;  3CDN A;  1XA5 A;  3KO0 A;  1FF1 A;  1QLK A;  3DVM A;  1AP4 A;  1K95 A;  1SK6 D;  1XFU O;  2KFF A;  2ZN9 A;  4CFR A;  2IS9 A;  2WCL A;  4BY4 A;  1IH0 A;  1UP5 A;  1KFX S;  1XFZ O;  2BL0 C;  2OTG C;  2WOS A;  4IJ7 A;  1Y1X A;  1OMR A;  1PSR A;  2EHB A;  1S5G Z;  3DXL A;  4DS7 A;  1QV1 A;  1B8R A;  1X02 A;  1S5G Y;  2KLD A;  5J3X A;  1WRK A;  1Y6W A;  2KI6 D;  1GGZ A;  2JQ6 A;  2PYQ A;  1MXL C;  1QX7 A;  1EXR A;  3LLE A;  2WCJ A;  3HX4 A;  1SY9 A;  2BBN A;  4JQ0 D;  2M97 A;  2JWW A;  3S0D A;  1UHI A;  5BPJ A;  5JJG A;  3WHU B;  4M2P A;  1LKJ A;  4C0L A;  1CDM A;  5CSI A;  2KGR A;  1QWV A;  1XYD A;  1J7Q A;  1NCX A;  2M49 B;  3AKB A;  3LL8 B;  2M7L A;  2JTZ A;  1DMO A;  1JBA A;  4OVN F;  1GQM A;  1CFP A;  2JC2 A;  1Z4H A;  1R2U A;  4GPL B;  2EC6 C;  2KFH A;  4XYN A;  2BKI B;  3ICB A;  2WOR A;  3L4A A;  1XFY O;  1SL9 A;  4TNC A;  1IJ5 A;  4MEW A;  2OPO A;  5HKZ A;  3TUY C;  1RRO A;  1Z2C B;  2K0J A;  3MSE B;  2CCM A;  4ZCV A;  3GK2 A;  3WNX B;  3S0F A;  1D1O A;  1FPW A;  1S3P A;  2WC6 A;  3PN7 C;  1XFR A;  1SYM A;  2L2E A;  3DZT A;  1REC A;  2LVV A;  1R6P A;  3D76 A;  1OOJ A;  1UUS A;  4OCI A;  4MRY A;  3IF7 A;  2QEB A;  2Y1N A;  3JTD B;  3NSI A;  1JSA A;  1XFV O;  1NX1 A;  3NGV A;  1KQM B;  2AAO A;  4ETO A;  3EKH A;  1SNL A;  3CLN A;  3L47 A;  1BJF A;  5EL2 A;  3SS3 A;  3EG5 B;  1B8C A;  3I5I C;  3TS5 B;  3BFA A;  3I5F C;  1B4C A;  2LVI A;  2MLE C;  4YI9 A;  1C07 A;  3SG5 A;  1CM1 A;  1JF2 A;  1PSB A;  3JVT B;  2WCH A;  4OV2 A;  1NIW A;  1Y0V H;  3FWC A;  4PCW A;  1IGV A;  2M8U A;  1LXF C;  2JU0 A;  4Q04 A;  2I18 A;  2LMV A;  1SMG A;  1HQV A;  1VRK A;  1F55 A;  2BEC A;  3BFH A;  4N1F A;  3GOF A;  2COL B;  3K1E A;  3TDI A;  1CMG A;  1KFU L;  3CAB A;  3CR2 A;  2RGI A;  4AOM A;  3VRN A;  4R1E A;  1IKU A;  1B9A A;  1OOI X;  2JXL A;  2L5X B;  2NCP A;  3EK8 A;  2CNP A;  1Y1A A;  1G33 A;  4FTG A;  3O4Y A;  4GGF A;  2BKH B;  4INW A;  1MWN A;  2F8P A;  4PHN A;  1TN4 A;  1AVS A;  2CT9 A;  3ZWH A;  2LAN A;  2BAP A;  2BNX A;  3OB1 B;  3E3R A;  3RZS A;  1HT9 A;  1DGV A;  3CR4 X;  3CTN A;  5DKR A;  5K89 A;  2LHL A;  4WQ2 A;  1W9Z A;  4XJK A;  1B1G A;  4GNK B;  2WND A;  2Y1M A;  2O60 A;  4MLW A;  3SS5 A;  2P6B B;  1OSA A;  1YRU B;  2L5Y A;  3EKJ A;  4ZCU A;  4MZK A;  1BU3 A;  1BR4 B;  5FI7 A;  3NSO A;  4XJK B;  3AAK A;  3S0A A;  1M45 A;  2FJU B;  1FI6 A;  1NSH A;  1SL7 A;  1ZUZ A;  3VRQ A;  2K8M B;  3EVV A;  4UPG A;  1B47 A;  1QTX A;  1S6J A;  1QS7 A;  4CFQ A;  3M0W A;  2E6W A;  3BUN B;  2L98 A;  1G4Y R;  2LAP A;  5FYX A;  5AAN A;  2LNK A;  3VGO A;  1FI5 A;  1IRJ A;  1B7T Z;  2JT3 A;  1FW4 A;  2KLE A;  3B6X A;  1S6C A;  3PSR A;  1B7T Y;  3R1V A;  1RWY A;  1NX0 A;  1RFJ A;  1K9K A;  1SKT A;  3B87 A;  3QRX A;  4DRW A;  3PAT A;  2ZNE A;  2OS8 B;  1K9U A;  3D78 A;  1IQ5 A;  2LMU A;  1YVH A;  1TOP A;  4USL A;  3SG4 A;  1C7W A;  2F2P A;  2DOQ A;  3BUO B;  1KK8 C;  5CSN A;  5AXI A;  4CID A;  2JT0 A;  4JKT A;  1OZS A;  2CBL A;  2JRF A;  2KNE A;  2Y5I A;  1SCM B;  2LVJ A;  4HRH A;  2Q4U A;  4ORC B;  3DVK A;  2H61 A;  1NWD A;  2LUC A;  2MAZ A;  2KI6 C;  3PJI A;  2K61 A;  1IJ6 A;  2LM5 A;  1Y1U A;  1TRF A;  2WCF A;  1K2H A;  2F3Z A;  1L2O C;  5HKW A;  3OGN A;  1MXE A;  1P28 A;  2KI4 B;  4PHK A;  3N7H A;  1GGW A;  5CSJ A;  1UHJ A;  2WCB A;  5I8N A;  1C3Y A;  5B8I B;  2L2C A;  2AMI A;  1FBV A;  2KDH A;  1YUS A;  2ZKM X;  2BE6 A;  1NCY A;  1TTX A;  2GGM A;  3O78 A;  3ZNI A;  1DJI A;  3I5G C;  1YTZ C;  2M1K B;  3O4X A;  4F7F A;  4PE0 A;  2KYF A;  2G2B A;  2F33 A;  1W7I B;  3BFB A;  1DJY A;  1DTL A;  1CFD A;  2LC5 A;  1QLS A;  3TDZ A;  2MLF C;  1SBJ A;  3KF9 A;  2JNX A;  4C0K A;  4D1E A;  1QAS A;  3CR5 X;  1NCZ A;  3VRP A;  1IG5 A;  1IIO A;  1WY9 A;  4DCK A;  2BBM A;  2MA2 A;  4PE1 A;  1YR5 A;  1OOH A;  3D73 A;  4GAO A;  3V2L A;  1DF0 A;  1QAT A;  3JTD C;  2GGZ A;  5CSF A;  5HKY A;  1SRA A;  3KPX A;  5KSZ A;  1PVA A;  3RLZ A;  3IQO A;  3B88 A;  4OKH A;  1K8U A;  3NXA A;  5TNC A;  1DF0 B;  1A75 A;  1CM4 A;  2WCM A;  2EGD A;  4C0J A;  3A4U B;  2KGB C;  1UWO A;  3OP0 A;  2R2I A;  1S36 A;  1A75 B;  2I2R E;  2WCE A;  5HLO A;  1YUT A;  4I5J A;  1EJ3 A;  4OR9 B;  3EK7 A;  3O2P A;  5FI2 A;  3JVT C;  1BLQ A;  3R1P A;  2NLN A;  1F70 A;  1J1D A;  1QIV A;  5AFP A;  5I2O A;  4MZJ A;  4MZL A;  5CPV A;  2ISD A;  1A03 A;  1MQ1 A;  2QDI A;  2LHI A;  4F0Z B;  4AQI A;  5HLV A;  4YGC B;  3SG7 A;  1OW4 A;  2CTN A;  4I5L B;  1CLB A;  4OZD A;  2PSR A;  4YBH B;  1E8A A;  1M63 B;  2P70 A;  1NP8 A;  3DVE A;  1S26 D;  2K2A A;  3H4S E;  3NSL A;  1V1G A;  4INX A;  4P5O E;  4QJ4 B;  3LK1 A;  4DUQ A;  3DYE A;  3PN7 B;  1AJ5 A;  4PE4 A;  1BG1 A;  2BE4 A;  1KQV A;  4JD9 A;  4MRX A;  2L0P A;  4NDC A;  1K96 A;  3OX6 A;  4GGN A;  2BCA A;  4FQO A;  1Q80 A;  1PAL A;  3BQ3 A;  4HRG A;  3SG6 A;  2K2F A;  1H4B A;  1SW8 A;  5D69 A;  1F8H A;  2FJY A;  2M9G A;  2TN4 A;  1DT7 B;  1DJZ A;  1BF5 A;  1CFC A;  1C3Z A;  2K7O A;  2G9B A;  2JNF A;  1A4P A;  1B8L A;  2PVB A;  2JPO A;  4U8D A;  1GM0 A;  2QEV A;  1CMF A;  3BXK A;  3I5I B;  1EG3 A;  4IL1 A;  1TNX A;  1CKK A;  2PAS A;  5PAL A;  1LS8 A;  3S0E A;  3CZ2 A;  1F71 A;  1SCV A;  5F6T A;  2LP3 A;  3FE9 A;  1BOC A;  1OE9 B;  3NSK A;  5DIC A;  4YRU A;  1CTR A;  2KBI A;  5I2L A;  4HRE E;  1WLM A;  1RK9 A;  3DY9 A;  4MVF A;  2BCX A;  2BCB A;  3CWG A;  2LV7 A;  1F54 A;  2KHN A;  2HQ8 A;  3BUX B;  2AUC A;  3BUW B;  2PRU A;  1BOD A;  1BR1 B;  1TCO B;  1N65 A;  3B86 A;  1KFU S;  3GK4 X;  1XK4 C;  2LLT A;  2NCO A;  2KYC A;  1TNW A;  3BOW A;  1PK0 D;  2MBX A;  1TIZ A;  3D75 A;  1LIN A;  1SR6 B;  2F3Y A;  3FE6 A;  2K60 A;  3D77 A;  2F2O A;  1SSE B;  1UHN A;  2QEH A;  3BOW B;  1EL4 A;  2MRD A;  2PAL A;  1WDC B;  4YGD B;  1AHR A;  2SAS A;  1WRZ A;  3O6B A;  1JFJ A;  1GJY A;  3FWB A;  4BY5 A;  2P71 A;  4CLN A;  4NQG A;  2ZRS A;  4JWQ A;  1WLZ A;  2HQW A;  3SG2 A;  3SS4 A;  2ERB A;  1NUB A;  2M7N A;  5I2Q A;  5KTY A;  4MSP A;  1DJG A;  2L50 A;  1CB1 A;  1JC2 A;  3DVJ A;  1SL8 A;  4I5N B;  4M2O A;  4PAL A;  3S0B A;  1KWO B;  1QVI Z;  2JOJ A;  1ZAC A;  1K94 A;  1KK7 Z;  1QVI Y;  2KI4 C;  4WRI A;  1KK7 Y;  5KU1 A;  1LA0 A;  2GTE A;  5D3O A;  3OHM B;  1CDN A;  3AKA A;  2M3W A;  2Y4Q A;  5AEQ A;  2FCE A;  4YGE B;  1IWQ A;  1YUU A;  3F45 A;  4AQJ A;  1BMO A;  1YX7 A;  2NZ0 A;  2ZFD A;  1QIW A;  3AAJ A;  2L4I A;  3CZT X;  1ZMZ A;  5G08 A;  1QXP A;  5IBW A;  3NHT A;  3I5H B;  3PFV A;  2HET A;  4NDB A;  2KQY A;  4N5X A;  2LLS A;  3D10 A;  1CLL A;  3KEV A;  2KBM A;  3D0Y A;  2B1U A;  5JOL A;  2BL0 B;  2OTG B;  2KOT A;  1LA3 A;  1U5I A;  4ICB A;  1XFX O;  3D0Y B;  1KK8 B;  5D7F A;  2SCP A;  4GFT A;  1N0Y A;  1PRW A;  2JPT A;  1NYA A;  1EG4 A;  1U5I B;  4MN0 A;  4P2Y B;  4ORA B;  1C7V A;  2WC8 A;  1YUR A;  3VB1 A;  1KQM C;  2M29 A;  3BUM B;  2JUL A;  4HSZ A;  2WC5 A;  1DEK A;  1CDP A;  1DQE A;  1F4O A;  1DGU A;  3FS7 A;  1L2O B;  3OX5 A;  1XVJ A;  4WQ3 A;  1ALV A;  3TS5 C;  3UO9 A;  1N2D A;  3UNW A;  1M46 A; 
#chains in the Genus database with same CATH homology
 1J7P A;  1BT6 A;  3CGA A;  3CS1 A;  2FOT A;  1KSO A;  1NX2 A;  1JF0 A;  2EC6 B;  3I5G B;  3WHT B;  2GV5 A;  2KFG A;  1TNP A;  2O5G A;  4E68 A;  2Q91 A;  3DF0 A;  3TDU A;  1QV0 A;  4PHM A;  1W7J B;  2LUX A;  1QX5 B;  4NDD A;  1M39 A;  3TUY B;  1NPQ A;  3DF0 B;  3RM1 A;  4DIR A;  4QJ5 B;  2JXC A;  3SG3 A;  1H8B A;  4YGA A;  1DVI A;  1DJX A;  2LE9 B;  1RJV A;  1UHK A;  3HCM A;  5DKQ A;  1A29 A;  1CLM A;  2KSP A;  3VRR A;  1K90 D;  4YGB B;  2KAV A;  1J7O A;  1K9P A;  2KAY A;  4PE7 A;  3EVU A;  1JUO A;  2MHH A;  2ZND A;  4N1G A;  4CPV A;  1K93 D;  3BYA A;  4YI8 A;  4A4B A;  1CNP A;  2ZN8 A;  4GGF C;  1RTP 1;  2K7C A;  4A4C A;  2V53 A;  3WXA A;  1G8I A;  2QPT A;  4PHJ A;  2K7B A;  4I5K A;  1J55 A;  1LVC D;  3A8R A;  1JFK A;  3I5F B;  3VRO A;  1YRT B;  1CFF A;  4ORB B;  2HF5 A;  1UHH A;  1V1F A;  3FIA A;  2QAC A;  3K21 A;  1JWD A;  1MHO A;  2NXQ A;  4GUK A;  3SJS A;  1OZO A;  3LK0 A;  2LCP A;  2KAX A;  4L9M A;  2KQ6 A;  2M1U A;  5ER5 A;  4QJ3 B;  2I94 A;  1XO5 A;  1MF8 B;  1AUI B;  1SPY A;  2JTT A;  1MUX A;  3EVR A;  1SR6 C;  2MJW B;  1M31 A;  1KFX L;  2L51 A;  1A2X A;  1MR8 A;  1TNQ A;  4MBE A;  4JPZ B;  2I7A A;  2PMY A;  1J7R A;  1WDC C;  5GQQ C;  1OMD A;  1J1E A;  1QX2 A;  1ZFS A;  5DKN A;  2LP2 A;  3PM8 A;  2OS8 C;  1PVB A;  2HPS A;  3GK1 A;  1UUR A;  1IQ3 A;  5AER A;  2D8N A;  3C1V A;  1PUL A;  2LLU A;  2LVK A;  3SIA A;  3TZ1 A;  1CDL A;  1S1E A;  1WRL A;  4GBA A;  1SCM C;  4MLW A;  2L4H A;  1KSM A;  2H2K A;  1AJ4 A;  1KWO C;  1YX8 A;  2JT8 A;  1L7Z A;  2A4J A;  3DD4 A;  3KHE A;  2CXJ A;  2K7D A;  3PLF B;  1KCY A;  1XFW O;  1NX3 A;  2VRG A;  3SIB A;  1OQP A;  4PDZ A;  4M2Q A;  2ZRT A;  2H61 C;  1DJW A;  1ZOT B;  2LMT A;  2E30 A;  3LCP C;  1EH2 A;  1ALW A;  2M0R A;  5ER4 X;  1F4Q A;  1S6I A;  1YVL A;  3IQQ A;  3OB2 B;  3PAL A;  1TCF A;  2JZI A;  5HYD A;  1ODB A;  1DJH A;  1AK8 A;  1QJT A;  3EK4 A;  2FCD A;  1XK4 A;  1OMV A;  3I5H C;  3KO0 A;  1XA5 A;  1FF1 A;  1QLK A;  3DVM A;  1AP4 A;  1K95 A;  1SK6 D;  1XFU O;  2KFF A;  2ZN9 A;  4CFR A;  2IS9 A;  4BY4 A;  1IH0 A;  1UP5 A;  1KFX S;  1XFZ O;  2BL0 C;  2OTG C;  2WOS A;  1Y1X A;  1OMR A;  1PSR A;  2EHB A;  1S5G Z;  4DS7 A;  1QV1 A;  1B8R A;  1X02 A;  1S5G Y;  5J3X A;  1WRK A;  1Y6W A;  2KI6 D;  1GGZ A;  2JQ6 A;  1MXL C;  1QX7 A;  1EXR A;  3LLE A;  3HX4 A;  1SY9 A;  2BBN A;  4JQ0 D;  2M97 A;  2JWW A;  1UHI A;  5BPJ A;  5JJG A;  3WHU B;  4M2P A;  1LKJ A;  4C0L A;  1CDM A;  5CSI A;  2KGR A;  1XYD A;  1J7Q A;  1NCX A;  2M49 B;  3AKB A;  3LL8 B;  2M7L A;  2JTZ A;  1DMO A;  1JBA A;  4OVN F;  1GQM A;  1CFP A;  2JC2 A;  1R2U A;  4GPL B;  2EC6 C;  2KFH A;  4XYN A;  2BKI B;  3ICB A;  2WOR A;  1XFY O;  1SL9 A;  4TNC A;  1IJ5 A;  4MEW A;  2OPO A;  5HKZ A;  3TUY C;  1RRO A;  2K0J A;  3MSE B;  2CCM A;  4ZCV A;  3GK2 A;  3WNX B;  1D1O A;  1FPW A;  1S3P A;  3PN7 C;  1SYM A;  2L2E A;  1REC A;  2LVV A;  1R6P A;  1OOJ A;  1UUS A;  4OCI A;  4MRY A;  3IF7 A;  2Y1N A;  3JTD B;  3NSI A;  1JSA A;  1XFV O;  1NX1 A;  1KQM B;  2AAO A;  4ETO A;  3EKH A;  1SNL A;  3CLN A;  1BJF A;  1B8C A;  3I5I C;  3TS5 B;  3I5F C;  1B4C A;  2LVI A;  2MLE C;  4YI9 A;  1C07 A;  3SG5 A;  1CM1 A;  1JF2 A;  1PSB A;  3JVT B;  4OV2 A;  1NIW A;  1Y0V H;  3FWC A;  4PCW A;  1IGV A;  2M8U A;  1LXF C;  2JU0 A;  4Q04 A;  2I18 A;  2LMV A;  1SMG A;  1HQV A;  1VRK A;  1F55 A;  2BEC A;  4N1F A;  3GOF A;  2COL B;  3TDI A;  1CMG A;  1KFU L;  3CR2 A;  2RGI A;  4AOM A;  3VRN A;  4R1E A;  1IKU A;  1B9A A;  2JXL A;  2L5X B;  2NCP A;  3EK8 A;  2CNP A;  1Y1A A;  1G33 A;  4FTG A;  3O4Y A;  4GGF A;  2BKH B;  1MWN A;  2F8P A;  4PHN A;  1TN4 A;  1AVS A;  2CT9 A;  3ZWH A;  2LAN A;  3OB1 B;  3E3R A;  1HT9 A;  1DGV A;  3CR4 X;  3CTN A;  5DKR A;  5K89 A;  2LHL A;  4WQ2 A;  4XJK A;  1B1G A;  4GNK B;  2WND A;  2Y1M A;  2O60 A;  2P6B B;  1OSA A;  1YRU B;  3EKJ A;  4ZCU A;  4MZK A;  1BU3 A;  1BR4 B;  3NSO A;  4XJK B;  3AAK A;  1M45 A;  2FJU B;  1FI6 A;  1NSH A;  1SL7 A;  1ZUZ A;  3VRQ A;  2K8M B;  3EVV A;  4UPG A;  1B47 A;  1QTX A;  1S6J A;  1QS7 A;  4CFQ A;  3M0W A;  2E6W A;  3BUN B;  2L98 A;  1G4Y R;  2LAP A;  5FYX A;  5AAN A;  2LNK A;  3VGO A;  1FI5 A;  1IRJ A;  1B7T Z;  2JT3 A;  1FW4 A;  3PSR A;  1S6C A;  1B7T Y;  1RWY A;  1NX0 A;  1RFJ A;  1K9K A;  1SKT A;  3QRX A;  4DRW A;  3PAT A;  2ZNE A;  2OS8 B;  1K9U A;  1IQ5 A;  2LMU A;  1YVH A;  1TOP A;  4USL A;  3SG4 A;  1C7W A;  2F2P A;  2DOQ A;  3BUO B;  1KK8 C;  5CSN A;  5AXI A;  4CID A;  2JT0 A;  1OZS A;  2CBL A;  2JRF A;  2KNE A;  2Y5I A;  1SCM B;  2LVJ A;  4HRH A;  2Q4U A;  4ORC B;  3DVK A;  2H61 A;  1NWD A;  2LUC A;  2MAZ A;  2KI6 C;  2K61 A;  1IJ6 A;  2LM5 A;  1Y1U A;  1TRF A;  2WCF A;  1K2H A;  2F3Z A;  1L2O C;  5HKW A;  1MXE A;  2KI4 B;  4PHK A;  1GGW A;  5CSJ A;  1UHJ A;  2WCB A;  5I8N A;  5B8I B;  2AMI A;  1FBV A;  2KDH A;  1YUS A;  2ZKM X;  2BE6 A;  1NCY A;  1TTX A;  2GGM A;  3O78 A;  3ZNI A;  1DJI A;  3I5G C;  1YTZ C;  2M1K B;  4PE0 A;  2KYF A;  2G2B A;  2F33 A;  1W7I B;  1DJY A;  1DTL A;  1CFD A;  2LC5 A;  1QLS A;  3TDZ A;  2MLF C;  1SBJ A;  3KF9 A;  2JNX A;  4C0K A;  4D1E A;  1QAS A;  3CR5 X;  1NCZ A;  3VRP A;  1IG5 A;  1WY9 A;  4DCK A;  2BBM A;  2MA2 A;  4PE1 A;  1YR5 A;  4GAO A;  1DF0 A;  1QAT A;  3JTD C;  2GGZ A;  5CSF A;  5HKY A;  1SRA A;  3KPX A;  5KSZ A;  1PVA A;  3RLZ A;  3IQO A;  4OKH A;  1K8U A;  3NXA A;  5TNC A;  1DF0 B;  1A75 A;  1CM4 A;  2EGD A;  4C0J A;  3A4U B;  2KGB C;  1UWO A;  3OP0 A;  2R2I A;  1S36 A;  1A75 B;  2I2R E;  2WCE A;  5HLO A;  1YUT A;  4I5J A;  1EJ3 A;  4OR9 B;  3EK7 A;  3O2P A;  1BLQ A;  3JVT C;  1F70 A;  2NLN A;  1J1D A;  1QIV A;  5AFP A;  5I2O A;  4MZJ A;  4MZL A;  5CPV A;  2ISD A;  1A03 A;  1MQ1 A;  2LHI A;  4F0Z B;  4AQI A;  5HLV A;  4YGC B;  3SG7 A;  4I5L B;  2CTN A;  1CLB A;  2PSR A;  4YBH B;  1E8A A;  1M63 B;  3DVE A;  1NP8 A;  3NSL A;  1S26 D;  2K2A A;  3H4S E;  4QJ4 B;  1V1G A;  4P5O E;  3LK1 A;  4DUQ A;  1BG1 A;  3PN7 B;  1AJ5 A;  4PE4 A;  2BE4 A;  1KQV A;  4MRX A;  2L0P A;  4NDC A;  1K96 A;  3OX6 A;  4GGN A;  2BCA A;  4FQO A;  1Q80 A;  1PAL A;  3BQ3 A;  4HRG A;  3SG6 A;  2K2F A;  1H4B A;  1SW8 A;  5D69 A;  1F8H A;  2M9G A;  2TN4 A;  1DT7 B;  1DJZ A;  1BF5 A;  1CFC A;  2K7O A;  2G9B A;  2JNF A;  1A4P A;  1B8L A;  2PVB A;  4U8D A;  1CMF A;  3BXK A;  3I5I B;  1EG3 A;  4IL1 A;  1TNX A;  1CKK A;  2PAS A;  5PAL A;  1F71 A;  1SCV A;  5F6T A;  2LP3 A;  1BOC A;  1OE9 B;  3NSK A;  4YRU A;  1CTR A;  2KBI A;  5I2L A;  4HRE E;  1WLM A;  1RK9 A;  4MVF A;  2BCX A;  2BCB A;  3CWG A;  2LV7 A;  1F54 A;  2KHN A;  2HQ8 A;  3BUX B;  2AUC A;  3BUW B;  2PRU A;  1BOD A;  1BR1 B;  1TCO B;  1N65 A;  1KFU S;  3GK4 X;  1XK4 C;  2LLT A;  2NCO A;  2KYC A;  1TNW A;  3BOW A;  1PK0 D;  2MBX A;  1TIZ A;  1LIN A;  1SR6 B;  2F3Y A;  2F2O A;  1UHN A;  3BOW B;  1EL4 A;  2MRD A;  2PAL A;  1WDC B;  4YGD B;  1AHR A;  2SAS A;  1WRZ A;  3O6B A;  1JFJ A;  1GJY A;  3FWB A;  4BY5 A;  4CLN A;  4NQG A;  2ZRS A;  4JWQ A;  1WLZ A;  2HQW A;  3SG2 A;  2M7N A;  1NUB A;  5I2Q A;  5KTY A;  4MSP A;  1DJG A;  2L50 A;  1CB1 A;  1JC2 A;  3DVJ A;  1SL8 A;  4I5N B;  4M2O A;  4PAL A;  1KWO B;  1QVI Z;  2JOJ A;  1ZAC A;  1K94 A;  1KK7 Z;  1QVI Y;  2KI4 C;  4WRI A;  1KK7 Y;  5KU1 A;  1LA0 A;  3OHM B;  1CDN A;  3AKA A;  2M3W A;  2Y4Q A;  5AEQ A;  2FCE A;  4YGE B;  1IWQ A;  1YUU A;  3F45 A;  4AQJ A;  1BMO A;  1YX7 A;  2NZ0 A;  2ZFD A;  1QIW A;  3AAJ A;  2L4I A;  3CZT X;  1ZMZ A;  5G08 A;  1QXP A;  5IBW A;  3PFV A;  3I5H B;  2HET A;  4NDB A;  2KQY A;  4N5X A;  2LLS A;  3D10 A;  1CLL A;  3KEV A;  2KBM A;  3D0Y A;  2B1U A;  5JOL A;  2BL0 B;  2OTG B;  2KOT A;  1LA3 A;  1U5I A;  4ICB A;  1XFX O;  3D0Y B;  1KK8 B;  5D7F A;  2SCP A;  4GFT A;  1N0Y A;  1PRW A;  2JPT A;  1NYA A;  1EG4 A;  1U5I B;  4MN0 A;  4P2Y B;  4ORA B;  1C7V A;  2WC8 A;  1YUR A;  1KQM C;  2M29 A;  3BUM B;  2JUL A;  4HSZ A;  1CDP A;  1F4O A;  1DGU A;  3FS7 A;  1L2O B;  3OX5 A;  1XVJ A;  4WQ3 A;  1ALV A;  3TS5 C;  1N2D A;  1M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...