1J7OA

Solution structure of calcium-calmodulin n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
76
structure length
76
Chain Sequence
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7oA00
1V1FA 2HQ8A 1XO5A 2MAZA 4ZCVA 1CLBA 1B9AA 2JRFA 4USLA 1DTLA 3K21A 4YBHB 2MA2A 1BT6A 4P2YB 2AMIA 1KK7Z 1SR6B 1ODBA 1PVBA 1R6PA 1UURA 1KK7Y 2WCEA 2BKIB 1K2HA 1Y0VH 2SASA 3I5HC 1SL8A 2L51A 1G8IA 4DS7A 4AQIA 1NPQA 3VRQA 1YUSA 3KO0A 3NSKA 1MQ1A 2LV7A 1QS7A 2MLFC 3A4UB 3I5GC 4YRUA 1K94A 2QPTA 2K7DA 3CR5X 3SG6A 1MF8B 1QATA 4P5OE 1HT9A 1YUTA 1JSAA 3JTDC 1IG5A 1C07A 2NXQA 2Q4UA 1A4PA 1JFJA 2CTNA 1OE9B 1SRAA 2IS9A 5AANA 1CFDA 1TNWA 3I5GB 2KQ6A 4MSPA 2NCPA 1B7TZ 1R2UA 4OCIA 3TUYC 1OZSA 2WORA 1CDLA 1B7TY 5AFPA 1S5GZ 3TZ1A 2ZRTA 3JTDB 2WNDA 4CLNA 1K9PA 1MUXA 2JTTA 2E30A 1XA5A 3I5IC 1S5GY 4GNKB 1DJWA 1QX7A 3OX6A 1BF5A 3NSIA 1EG4A 3ICBA 1J7PA 2V53A 4FTGA 1CLLA 5I8NA 4A4BA 1B8RA 4DIRA 1G4YR 5D7FA 2H61A 1OZOA 2L98A 1SW8A 1TOPA 4U8DA 1CB1A 1L2OC 2KFHA 3VRPA 3FWCA 1S6JA 1SCVA 2LHIA 1LXFC 2LCPA 5HYDA 1PALA 1ZFSA 1IGVA 2CT9A 3I5IB 3TDUA 3DVJA 4C0LA 2F2PA 1MWNA 1U5IB 3O4YA 1SK6D 4NDCA 1BR1B 3DD4A 4OR9B 1JWDA 1NP8A 3BQ3A 2I18A 4GUKA 2PRUA 4GGFC 1J1DA 2PASA 1IQ3A 1UP5A 1L2OB 3TDIA 1TNQA 1ALVA 2K0JA 3D10A 1YTZC 1PSBA 3NSLA 2L0PA 1A29A 4I5JA 1OMVA 1CFCA 4MN0A 1JFKA 1EJ3A 1YRUB 2BL0C 3SG5A 2WCBA 4PHMA 5TNCA 3DF0B 1DF0B 2BE4A 4MZLA 2L4IA 1IWQA 3PM8A 3O2PA 1CM1A 2EGDA 1VRKA 2R2IA 4MBEA 4XYNA 4WQ3A 5DKRA 1IJ6A 2ZN9A 1QX2A 2Y5IA 2NZ0A 2BL0B 1CKKA 2M8UA 3KF9A 1U5IA 4GFTA 5PALA 2AAOA 1A2XA 1S6IA 3F45A 1WLMA 3SIBA 5DKNA 1FI5A 3AKAA 2M7NA 4Q04A 3PN7B 1IKUA 4GBAA 1M46A 2KOTA 1UHJA 2HQWA 1DJGA 1LA0A 2FJUB 2H2KA 2KI6D 1Y1XA 3AKBA 2SCPA 3NXAA 2L5XB 4DCKA 5AXIA 3ZNIA 1MHOA 2FCEA 2LLSA 3DF0A 1DF0A 1KWOC 2JT8A 5HLOA 4DUQA 4C0JA 1JBAA 2M97A 1ZUZA 2BBMA 1KQMC 3FWBA 1LINA 2LMVA 1NWDA 2KYCA 3BUMB 3HX4A 1E8AA 3VRNA 2KFFA 3HCMA 5CPVA 3CWGA 1Y6WA 1KWOB 1EL4A 1C7WA 2JXCA 1DMOA 1TIZA 1TRFA 1CMGA 1B47A 1KSMA 5CSIA 3IQQA 1XYDA 4MZKA 2WC8A 1OMRA 3KHEA 2MHHA 3C1VA 1OSAA 2K7CA 2KDHA 3PSRA 1SKTA 3SG3A 1IRJA 1NX0A 3CZTX 4M2OA 1XK4C 4HRGA 1PRWA 3DVMA 3EVRA 4FQOA 5CSFA 1YX8A 4PE0A 3PFVA 2KHNA 4CPVA 1JC2A 3MSEB 1LA3A 3LL8B 2KAYA 2G9BA 4M2QA 2MLEC 1Q80A 3BOWB 5ER5A 1NIWA 3I5HB 5B8IB 2JT3A 2LM5A 1SL7A 2ZFDA 3JVTC 1H4BA 1YVLA 1KCYA 4NDDA 3OX5A 1RWYA 2Y1MA 2CXJA 3KEVA 1MXEA 5I2OA 2CCMA 3NSOA 5HKYA 1QTXA 2LUCA 4CFRA 1GQMA 3GK1A 2M29A 5KU1A 1SYMA 3JVTB 4M2PA 1ALWA 3SIAA 1LKJA 2K2AA 1J7QA 1EG3A 1KFUL 3LLEA 2LHLA 4D1EA 3WNXB 1XVJA 1OQPA 3BYAA 2JXLA 3CS1A 4I5KA 3TUYB 1DVIA 1GJYA 5CSNA 4YGDB 5JOLA 3VROA 1KFXL 1NX2A 3VRRA 3DVEA 1DGVA 2KGBC 2LLTA 4YGEB 3BOWA 3WHTB 2L4HA 1XK4A 4N1FA 1N65A 1XFXO 1S1EA 2M49B 1RECA 1F70A 2KQYA 2OTGC 2F3YA 2KGRA 2DOQA 2OS8C 1NX3A 3SG4A 1D1OA 1FPWA 1JF2A 4I5NB 1QV1A 1CFPA 3WXAA 2OPOA 3LK1A 3AAKA 2ISDA 5ER4X 3O78A 2M1KB 3EK4A 1K96A 1NCYA 3EKHA 1BMOA 4HRHA 2RGIA 2HF5A 1SY9A 1KSOA 2OTGB 2JWWA 3BUOB 1CDPA 1TN4A 1QV0A 2KAVA 1BJFA 5FYXA 1JF0A 1WRLA 2JU0A 1W7IB 4QJ5B 1G33A 3GK2A 2LP3A 4MRXA 1XFUO 1DJXA 1F4QA 1SMGA 1WLZA 2KYFA 4QJ4B 1DJZA 1SNLA 2O60A 1S26D 1MXLC 4PDZA 1TCOB 5I2LA 4F0ZB 1DJYA 1DGUA 2MRDA 2KI4C 3IQOA 1BLQA 1UWOA 1K90D 2F8PA 1CLMA 2I94A 1CDNA 4BY5A 4AQJA 1TCFA 3OB2B 1CNPA 1F4OA 2FOTA 1BU3A 1ZACA 1DJIA 2ZNEA 2P6BB 2Y4QA 3RLZA 2JQ6A 1YX7A 3KPXA 1PVAA 2K2FA 2F33A 1BOCA 4JPZB 2KI4B 4R1EA 1QJTA 5DKQA 5HKZA 1B8CA 2LVIA 5J3XA 2FCDA 2A4JA 4GGFA 2TN4A 1EXRA 1M45A 4PHNA 3CLNA 2I2RE 1W7JB 1FBVA 1WRZA 1MR8A 4PE7A 2K8MB 3PALA 4OKHA 3RM1A 5JJGA 1ZMZA 1IH0A 2BCXA 5AERA 4MEWA 1UHNA 1FW4A 2LVKA 3O6BA 3E3RA 2NLNA 1ZOTB 4MZJA 2MJWB 1KQMB 5IBWA 4ORCB 2ZN8A 2BBNA 4HREE 1TNPA 1Y1AA 2KBIA 1XFVO 3BXKA 2KAXA 1B1GA 2PSRA 1AHRA 1WDCC 1K8UA 1OOJA 1RROA 1NX1A 4MRYA 1QIVA 1K93D 1TTXA 2I7AA 4ORAB 1PULA 1EH2A 4CIDA 3D0YB 2B1UA 1SCMC 2K7BA 1SPYA 1XFZO 3CR4X 1WDCB 2LANA 2WCFA 4ZCUA 3M0WA 2LE9B 1PSRA 4L9MA 2JZIA 2LUXA 2LMUA 4GGNA 1LVCD 1PK0D 1QXPA 1TNXA 2JT0A 1DJHA 5K89A 3EKJA 1IJ5A 2H61C 1UHHA 2LVJA 4PHJA 4QJ3B 1QX5B 1F71A 4YGAA 1FF1A 4YGBB 1KQVA 1YURA 1SCMB 1YR5A 1RK9A 2EC6C 1AUIB 3BUWB 4YI8A 1B8LA 3BUNB 3DVKA 4TNCA 4YGCB 1S3PA 2WOSA 1YUUA 3EVVA 5KTYA 3CR2A 1XFWO 2GGZA 4WQ2A 3IF7A 5G08A 2PALA 1SBJA 5GQQC 3ZWHA 2D8NA 2L2EA 5HLVA 2LVVA 5BPJA 4N1GA 4MLWA 1Y1UA 4PHKA 2F2OA 3LK0A 2EC6B 5CSJA 4E68A 1QASA 1DT7B 4JQ0D 1WY9A 1GGZA 1GGWA 2LNKA 2JC2A 3D0YA 2M0RA 2BCBA 4UPGA 5AEQA 1IQ5A 2LMTA 2EHBA 2ZRSA 1H8BA 1V1GA 2ZKMX 1CTRA 1CFFA 3FS7A 1C7VA 1CMFA 2JULA 4PE4A 2HPSA 3PLFB 2JOJA 1L7ZA 1RJVA 1UHKA 2JTZA 4OV2A 2K61A 1B4CA 3A8RA 2LC5A 3EVUA 1NYAA 2JPTA 3I5FC 5I2QA 4IL1A 1K95A 1AVSA 4GPLB 4MVFA 4PCWA 2BCAA 3SG2A 1M63B 1YVHA 5F6TA 4I5LB 1K9UA 1KFUS 2OS8B 2CBLA 2PVBA 2LP2A 1CM4A 1YRTB 1KK8C 4CFQA 1A03A 1SL9A 3AAJA 4XJKB 2COLB 2JNFA 3I5FB 1KFXS 3SG7A 1JUOA 3CGAA 2KFGA 1XFYO 1A75B 2M1UA 2AUCA 1F55A 2KNEA 1OMDA 2BKHB 5HKWA 2KSPA 2O5GA 5KSZA 1KK8B 2M9GA 1QLKA 2ZNDA 3OHMB 4GAOA 2LAPA 3OB1B 1UUSA 2GV5A 1NUBA 4ORBB 4PALA 4DRWA 4PE1A 3LCPC 3TDZA 1AP4A 3VGOA 1J7OA 2LLUA 2M7LA 2VRGA 1QVIZ 3OP0A 4ETOA 1QLSA 1AJ5A 3EK7A 2BE6A 1FI6A 2G2BA 2GGMA 4N5XA 1QVIY 3QRXA 2NCOA 3BUXB 2CNPA 4C0KA 1BG1A 1F54A 3PN7C 1CDMA 2KI6C 1M39A 2F3ZA 3H4SE 3TS5C 3SJSA 4XJKA 2MBXA 4YI9A 1J7RA 5D69A 1A75A 2QACA 1BODA 1S6CA 1J55A 3PATA 1HQVA 1N2DA 2PMYA 4AOMA 4OVNF 4ICBA 1AK8A 1M31A 1BR4B 1NSHA 2KBMA 2K7OA 2Y1NA 1QIWA 3EK8A 3GOFA 3TS5B 4A4CA 1N0YA 1RTP1 4JWQA 1X02A 1NCXA 1K9KA 2BECA 1J1EA 1NCZA 4BY4A 1WRKA 4NQGA 1AJ4A 4NDBA 2M3WA 1RFJA 1S36A 2L50A 1UHIA 3GK4X 1SR6C 3CTNA 3WHUB 2JNXA 2Q91A 3FIAA 4WRIA 2HETA 1F8HA 2E6WA 4HSZA
chains in the Genus database with same CATH superfamily
1V1FA 2HQ8A 1XO5A 2MAZA 4ZCVA 1CLBA 1B9AA 2JRFA 4USLA 3B6XA 1DTLA 3K21A 4YBHB 3FE9A 2MA2A 1BT6A 4P2YB 2AMIA 1KK7Z 3EG5B 1SR6B 1ODBA 1PVBA 1R6PA 3B7AA 1UURA 1KK7Y 2WCEA 3D77A 2BKIB 1K2HA 1Y0VH 3NHTA 2SASA 3I5HC 1SL8A 2L51A 1G8IA 4DS7A 4AQIA 5HL1A 1NPQA 3VRQA 1YUSA 3KO0A 3NSKA 1MQ1A 2LV7A 2L5YA 1QS7A 2MLFC 3A4UB 3BFAA 1TUZA 3I5GC 4YRUA 1K94A 2QPTA 2K7DA 3CR5X 1DELA 3SG6A 1MF8B 1QATA 4INWA 4P5OE 1HT9A 1YUTA 3S0BA 1JSAA 3JTDC 1IG5A 1C07A 2NXQA 2Q4UA 5EL2A 3S0AA 1A4PA 1JFJA 2CTNA 1OE9B 1SRAA 2IS9A 3NHIA 5AANA 1CFDA 1TNWA 3I5GB 2KQ6A 4JKTA 4MSPA 2NCPA 1B7TZ 1R2UA 4OCIA 3TUYC 1OZSA 1TUJA 2WORA 1CDLA 1B7TY 5AFPA 1S5GZ 3TZ1A 3SS3A 2ZRTA 3JTDB 2WNDA 4CLNA 1K9PA 1MUXA 2JTTA 2E30A 1XA5A 3I5IC 1S5GY 4GNKB 1DJWA 1QX7A 3OX6A 1BF5A 3NSIA 3D78A 1EG4A 3ICBA 1ORGA 1J7PA 5FI7A 2V53A 4FTGA 1CLLA 5I8NA 4A4BA 1B8RA 4DIRA 1G4YR 5D7FA 2H61A 3BFHA 1OZOA 2L98A 1SW8A 1TOPA 4U8DA 1CB1A 1L2OC 2KFHA 2YGUA 3VRPA 3FWCA 1S6JA 1SCVA 2LHIA 1LXFC 2LCPA 5HYDA 1PALA 1ZFSA 1IGVA 2CT9A 2K60A 3I5IB 3DVJA 3TDUA 1P28A 2F2PA 1MWNA 1U5IB 3O4YA 1SK6D 4NDCA 1BR1B 3DD4A 4OR9B 1JWDA 1NP8A 3L4AA 3BQ3A 2I18A 2KPHA 4GUKA 2PRUA 4GGFC 1J1DA 2PASA 3CZ2A 1UP5A 1IQ3A 1L2OB 3TDIA 1TNQA 1ALVA 2K0JA 3D10A 1YTZC 1PSBA 2BNXA 3NSLA 2L0PA 1A29A 4I5JA 1OMVA 1CFCA 4MN0A 1JFKA 1EJ3A 1YRUB 2BL0C 3SG5A 2WCBA 4PHMA 5TNCA 2WC6A 3DF0B 1DF0B 2BE4A 4MZLA 2L4IA 3FE6A 1IWQA 3PM8A 3O2PA 1CM1A 2EGDA 1VRKA 2QEBA 2R2IA 4MBEA 4XYNA 4WQ3A 5DKRA 1IJ6A 2ZN9A 1QX2A 2Y5IA 2NZ0A 2BL0B 1CKKA 2M8UA 3KF9A 1U5IA 4GFTA 5PALA 2AAOA 1A2XA 1S6IA 3IVTA 3F45A 1WLMA 3CDNA 3SIBA 5DKNA 1FI5A 3AKAA 2M7NA 4Q04A 3PN7B 1IKUA 4GBAA 1M46A 2KOTA 5I94A 1UHJA 1DC1A 2HQWA 1DJGA 1LA0A 2FJUB 2H2KA 2KI6D 3PJIA 1Y1XA 3AKBA 2SCPA 3NXAA 2L5XB 4DCKA 5AXIA 3ZNIA 1MHOA 2FCEA 2LLSA 3DF0A 1DF0A 1KWOC 2JT8A 3DZTA 5HLOA 4C0JA 4DUQA 1JBAA 5D3OA 2M97A 1ZUZA 2BBMA 1KQMC 1GM0A 3FWBA 3K1EA 1LINA 2LMVA 1NWDA 2KYCA 3BUMB 3HX4A 1E8AA 3VRNA 2KFFA 3HCMA 5CPVA 3CWGA 1Y6WA 1KWOB 1EL4A 1C7WA 2JXCA 1DMOA 1TIZA 1TRFA 1CMGA 1B47A 1KSMA 5CSIA 4PT1A 1DEKA 3IQQA 1XYDA 4MZKA 2H8VA 2WC8A 1OMRA 3KHEA 2MHHA 3C1VA 5DICA 3DXLA 1OSAA 2K7CA 2KDHA 3PSRA 1SKTA 2BAPA 3SG3A 1IRJA 1NX0A 3CZTX 4M2OA 1XK4C 4HRGA 1PRWA 3DVMA 3EVRA 4FQOA 5CSFA 1YX8A 4PE0A 3PFVA 2KHNA 4CPVA 1JC2A 4JD9A 3MSEB 1LA3A 3LL8B 2KAYA 2G9BA 4M2QA 2MLEC 1Q80A 3BOWB 5ER5A 1NIWA 3I5HB 5B8IB 2JT3A 2LM5A 1SL7A 2ZFDA 3JVTC 1H4BA 1YVLA 3VB1A 1KCYA 4NDDA 3OX5A 1RWYA 2Y1MA 2CXJA 3KEVA 1MXEA 5I2OA 2CCMA 4IJ7A 3NSOA 5HKYA 1QTXA 1TWOA 2LUCA 4CFRA 3D75A 1GQMA 3GK1A 3L4LA 2M29A 3UO9A 5KU1A 1SYMA 3JVTB 2WCJA 1ALWA 4M2PA 3RZSA 3SIAA 1LKJA 2QEVA 2K2AA 1J7QA 1OOGA 1EG3A 3SS5A 1KFUL 2PQLA 3LLEA 2LHLA 4D1EA 2WC5A 3WNXB 2GTEA 1XVJA 1OQPA 3BYAA 2JXLA 3CS1A 4I5KA 3TUYB 1DVIA 1GJYA 5CSNA 4YGDB 5JOLA 3VROA 1KFXL 1NX2A 3VRRA 3DVEA 1DGVA 2KGBC 2LLTA 2QEOA 3BOWA 4YGEB 3WHTB 2L4HA 1XK4A 4N1FA 1N65A 1XFXO 1S1EA 2M49B 1RECA 3CABA 1F70A 3N7HA 2KQYA 2OTGC 2F3YA 2KGRA 2DOQA 2OS8C 1NX3A 2L2CA 3OBVA 3SG4A 1D1OA 1FPWA 1JF2A 4I5NB 1QV1A 1CFPA 3WXAA 2OPOA 2WCHA 3LK1A 3AAKA 2ISDA 5ER4X 3O78A 2M1KB 3EK4A 1K96A 3B88A 1NCYA 3EKHA 3L47A 1QWVA 1BMOA 4HRHA 2RGIA 2HF5A 1SY9A 1KSOA 2OTGB 2JWWA 3BUOB 1CDPA 1TN4A 1QV0A 3BFBA 2KAVA 1BJFA 5FYXA 1JF0A 5FI2A 1WRLA 2JU0A 1W7IB 4QJ5B 1G33A 3GK2A 2LP3A 3R1PA 4MRXA 1XFUO 1DJXA 1F4QA 1SMGA 1WLZA 2KYFA 4QJ4B 1DJZA 1SNLA 2O60A 1S26D 1MXLC 4PDZA 1TCOB 5I2LA 4F0ZB 3SS4A 1DJYA 1DGUA 2JPOA 2MRDA 2KI4C 1OOFA 3IQOA 1BLQA 1UWOA 1K90D 2F8PA 1CLMA 2I94A 1CDNA 4BY5A 4AQJA 1TCFA 3CYZA 3OB2B 1CNPA 1F4OA 4INXA 2FOTA 1BU3A 1ZACA 1DJIA 2ZNEA 1C3YA 2P6BB 2Y4QA 3RLZA 2JQ6A 1YX7A 3KPXA 1PVAA 2K2FA 2F33A 1BOCA 4JPZB 2KI4B 3S0FA 1DQEA 4R1EA 1QJTA 5DKQA 5HKZA 1B8CA 2LVIA 5J3XA 2FCDA 2A4JA 3DY9A 4GGFA 2TN4A 1EXRA 1M45A 4PHNA 3CLNA 2I2RE 1W7JB 2ERBA 1FBVA 1WRZA 2KLEA 1MR8A 4PE7A 2K8MB 3PALA 4OKHA 3RM1A 5JJGA 1ZMZA 3Q8IA 1IH0A 4OZDA 2BCXA 5AERA 4MEWA 3O4XA 1Z4HA 1UHNA 1FW4A 2LVKA 3O6BA 3E3RA 2NLNA 1IIOA 1ZOTB 4MZJA 2MJWB 1KQMB 5IBWA 4ORCB 2ZN8A 2BBNA 4HREE 1TNPA 1Y1AA 2KBIA 1XFVO 3BXKA 2KAXA 1B1GA 2PSRA 3OGNA 1AHRA 1WDCC 1K8UA 1OOJA 1Z2CB 1RROA 4C0LA 1NX1A 2WCLA 2FJYA 4MRYA 1QIVA 1K93D 3D74A 3D73A 1TTXA 2I7AA 4ORAB 1PULA 1EH2A 4CIDA 3D0YB 2B1UA 1SCMC 2K7BA 1SPYA 1XFZO 3CR4X 1OOHA 1WDCB 1SSEB 2LANA 2WCFA 3M0WA 2LE9B 1PSRA 4L9MA 4ZCUA 2JZIA 2LUXA 2LMUA 4GGNA 1LS8A 1LVCD 1PK0D 1QXPA 1TNXA 3PM2A 2JT0A 1DJHA 5K89A 3EKJA 1IJ5A 2H61C 1UHHA 2LVJA 4PHJA 4QJ3B 1QX5B 3B86A 1F71A 4YGAA 1FF1A 4YGBB 1KQVA 1YURA 1SCMB 1YR5A 1RK9A 2EC6C 1AUIB 3BUWB 4YI8A 1B8LA 3BUNB 3DVKA 4TNCA 4YGCB 1S3PA 2WOSA 1YUUA 3EVVA 5KTYA 3CR2A 1XFWO 2GGZA 4WQ2A 3IF7A 5G08A 3S0EA 2PALA 3S0DA 1SBJA 5GQQC 3ZWHA 1XFRA 2D8NA 2L2EA 5HLVA 2LVVA 5BPJA 4N1GA 4MLWA 1C3ZA 1Y1UA 4PHKA 2F2OA 3LK0A 2EC6B 3CZ1A 5CSJA 4E68A 2PYQA 1QASA 1DT7B 4JQ0D 1WY9A 3CZ0A 1GGZA 1GGWA 2LNKA 2JC2A 3D0YA 2M0RA 2BCBA 3DYEA 4UPGA 5AEQA 1IQ5A 2LMTA 3B87A 2EHBA 2ZRSA 1H8BA 1V1GA 2ZKMX 1CTRA 1CFFA 3FS7A 3V2LA 1C7VA 1CMFA 1T14A 2JULA 4PE4A 2HPSA 3PLFB 4KYNA 2JOJA 1L7ZA 1RJVA 1UHKA 2JTZA 4OV2A 4FQTA 2K61A 1B4CA 3A8RA 2LC5A 3EVUA 1NYAA 2JPTA 3I5FC 5I2QA 4IL1A 1K95A 1AVSA 4GPLB 4MVFA 4PCWA 2BCAA 3SG2A 1M63B 1YVHA 5F6TA 4I5LB 1K9UA 5FI6A 1KFUS 2OS8B 2CBLA 2PVBA 2LP2A 1CM4A 1YRTB 1KK8C 4CFQA 1A03A 1SL9A 3AAJA 4XJKB 2COLB 2JNFA 3I5FB 1KFXS 3SG7A 1JUOA 3CGAA 2KFGA 1XFYO 1A75B 2M1UA 2AUCA 3FE8A 1F55A 2KNEA 1OMDA 2BKHB 5HKWA 2KSPA 2O5GA 5KSZA 1KK8B 2M9GA 1QLKA 2ZNDA 3D76A 3OHMB 2LAPA 3R1OA 4GAOA 3OB1B 3S0GA 1UUSA 2KLDA 3UNWA 2GV5A 1NUBA 4ORBB 4PALA 4DRWA 4PE1A 3LCPC 3TDZA 1AP4A 3VGOA 1J7OA 3NGVA 2LLUA 2M7LA 2VRGA 1QVIZ 3OP0A 4ETOA 1QLSA 1AJ5A 3EK7A 2BE6A 1FI6A 2G2BA 2GGMA 4N5XA 2P70A 1QVIY 3QRXA 2WCMA 2NCOA 3BUXB 2CNPA 4C0KA 1BG1A 1F54A 3PN7C 1CDMA 2KI6C 3QMEA 1M39A 1OW4A 2F3ZA 3H4SE 3TS5C 3SJSA 2P71A 4XJKA 2MBXA 4YI9A 1J7RA 3R1VA 5D69A 1A75A 2QACA 1BODA 1S6CA 1J55A 3PATA 1HQVA 1W9ZA 1N2DA 2PMYA 4AOMA 4OVNF 4ICBA 1AK8A 1M31A 1BR4B 1NSHA 2KBMA 2K7OA 2Y1NA 1QIWA 3EK8A 3GOFA 3TS5B 4A4CA 1N0YA 1RTP1 4JWQA 1X02A 1OOIX 4F7FA 2WCKA 1NCXA 1K9KA 3R72A 2BECA 2QDIA 1J1EA 1NCZA 4BY4A 1WRKA 3BJHA 1AJ4A 4NDBA 4NQGA 2M3WA 1RFJA 1S36A 2QEHA 2L50A 1UHIA 3GK4X 1SR6C 3CTNA 3WHUB 2JNXA 2Q91A 3FIAA 4WRIA 2HETA 1F8HA 2E6WA 4HSZA
chains in the Genus database with same CATH topology
1V1FA 2HQ8A 1XO5A 2MAZA 4ZCVA 1CLBA 1B9AA 2JRFA 4USLA 1DTLA 3K21A 4YBHB 2MA2A 1BT6A 4P2YB 2AMIA 1KK7Z 1SR6B 1ODBA 1PVBA 1R6PA 1UURA 1KK7Y 2WCEA 2BKIB 1K2HA 1Y0VH 2SASA 3I5HC 1SL8A 2L51A 1G8IA 4DS7A 4AQIA 1NPQA 3VRQA 1YUSA 3KO0A 3NSKA 1MQ1A 2LV7A 1QS7A 2MLFC 3A4UB 3I5GC 4YRUA 1K94A 2QPTA 2K7DA 3CR5X 3SG6A 1MF8B 1QATA 4P5OE 1HT9A 1YUTA 1JSAA 3JTDC 1IG5A 1C07A 2NXQA 2Q4UA 1A4PA 1JFJA 2CTNA 1OE9B 1SRAA 2IS9A 5AANA 1CFDA 1TNWA 3I5GB 2KQ6A 4MSPA 2NCPA 1B7TZ 1R2UA 4OCIA 3TUYC 1OZSA 2WORA 1CDLA 1B7TY 5AFPA 1S5GZ 3TZ1A 2ZRTA 3JTDB 2WNDA 4CLNA 1K9PA 1MUXA 2JTTA 2E30A 1XA5A 3I5IC 1S5GY 4GNKB 1DJWA 1QX7A 3OX6A 1BF5A 3NSIA 1EG4A 3ICBA 1J7PA 2V53A 4FTGA 1CLLA 5I8NA 4A4BA 1B8RA 4DIRA 1G4YR 5D7FA 2H61A 1OZOA 2L98A 1SW8A 1TOPA 4U8DA 1CB1A 1L2OC 2KFHA 3VRPA 3FWCA 1S6JA 1SCVA 2LHIA 1LXFC 2LCPA 5HYDA 1PALA 1ZFSA 1IGVA 2CT9A 3I5IB 3TDUA 3DVJA 4C0LA 2F2PA 1MWNA 1U5IB 3O4YA 1SK6D 4NDCA 1BR1B 3DD4A 4OR9B 1JWDA 1NP8A 3BQ3A 2I18A 4GUKA 2PRUA 4GGFC 1J1DA 2PASA 1IQ3A 1UP5A 1L2OB 3TDIA 1TNQA 1ALVA 2K0JA 3D10A 1YTZC 1PSBA 3NSLA 2L0PA 1A29A 4I5JA 1OMVA 1CFCA 4MN0A 1JFKA 1EJ3A 1YRUB 2BL0C 3SG5A 2WCBA 4PHMA 5TNCA 3DF0B 1DF0B 2BE4A 4MZLA 2L4IA 1IWQA 3PM8A 3O2PA 1CM1A 2EGDA 1VRKA 2R2IA 4MBEA 4XYNA 4WQ3A 5DKRA 1IJ6A 2ZN9A 1QX2A 2Y5IA 2NZ0A 2BL0B 1CKKA 2M8UA 3KF9A 1U5IA 4GFTA 5PALA 2AAOA 1A2XA 1S6IA 3F45A 1WLMA 3SIBA 5DKNA 1FI5A 3AKAA 2M7NA 4Q04A 3PN7B 1IKUA 4GBAA 1M46A 2KOTA 1UHJA 2HQWA 1DJGA 1LA0A 2FJUB 2H2KA 2KI6D 1Y1XA 3AKBA 2SCPA 3NXAA 2L5XB 4DCKA 5AXIA 3ZNIA 1MHOA 2FCEA 2LLSA 3DF0A 1DF0A 1KWOC 2JT8A 5HLOA 4DUQA 4C0JA 1JBAA 2M97A 1ZUZA 2BBMA 1KQMC 3FWBA 1LINA 2LMVA 1NWDA 2KYCA 3BUMB 3HX4A 1E8AA 3VRNA 2KFFA 3HCMA 5CPVA 3CWGA 1Y6WA 1KWOB 1EL4A 1C7WA 2JXCA 1DMOA 1TIZA 1TRFA 1CMGA 1B47A 1KSMA 5CSIA 3IQQA 1XYDA 4MZKA 2WC8A 1OMRA 3KHEA 2MHHA 3C1VA 1OSAA 2K7CA 2KDHA 3PSRA 1SKTA 3SG3A 1IRJA 1NX0A 3CZTX 4M2OA 1XK4C 4HRGA 1PRWA 3DVMA 3EVRA 4FQOA 5CSFA 1YX8A 4PE0A 3PFVA 2KHNA 4CPVA 1JC2A 3MSEB 1LA3A 3LL8B 2KAYA 2G9BA 4M2QA 2MLEC 1Q80A 3BOWB 5ER5A 1NIWA 3I5HB 5B8IB 2JT3A 2LM5A 1SL7A 2ZFDA 3JVTC 1H4BA 1YVLA 1KCYA 4NDDA 3OX5A 1RWYA 2Y1MA 2CXJA 3KEVA 1MXEA 5I2OA 2CCMA 3NSOA 5HKYA 1QTXA 2LUCA 4CFRA 1GQMA 3GK1A 2M29A 5KU1A 1SYMA 3JVTB 4M2PA 1ALWA 3SIAA 1LKJA 2K2AA 1J7QA 1EG3A 1KFUL 3LLEA 2LHLA 4D1EA 3WNXB 1XVJA 1OQPA 3BYAA 2JXLA 3CS1A 4I5KA 3TUYB 1DVIA 1GJYA 5CSNA 4YGDB 5JOLA 3VROA 1KFXL 1NX2A 3VRRA 3DVEA 1DGVA 2KGBC 2LLTA 4YGEB 3BOWA 3WHTB 2L4HA 1XK4A 4N1FA 1N65A 1XFXO 1S1EA 2M49B 1RECA 1F70A 2KQYA 2OTGC 2F3YA 2KGRA 2DOQA 2OS8C 1NX3A 3SG4A 1D1OA 1FPWA 1JF2A 4I5NB 1QV1A 1CFPA 3WXAA 2OPOA 3LK1A 3AAKA 2ISDA 5ER4X 3O78A 2M1KB 3EK4A 1K96A 1NCYA 3EKHA 1BMOA 4HRHA 2RGIA 2HF5A 1SY9A 1KSOA 2OTGB 2JWWA 3BUOB 1CDPA 1TN4A 1QV0A 2KAVA 1BJFA 5FYXA 1JF0A 1WRLA 2JU0A 1W7IB 4QJ5B 1G33A 3GK2A 2LP3A 4MRXA 1XFUO 1DJXA 1F4QA 1SMGA 1WLZA 2KYFA 4QJ4B 1DJZA 1SNLA 2O60A 1S26D 1MXLC 4PDZA 1TCOB 5I2LA 4F0ZB 1DJYA 1DGUA 2MRDA 2KI4C 3IQOA 1BLQA 1UWOA 1K90D 2F8PA 1CLMA 2I94A 1CDNA 4BY5A 4AQJA 1TCFA 3OB2B 1CNPA 1F4OA 2FOTA 1BU3A 1ZACA 1DJIA 2ZNEA 2P6BB 2Y4QA 3RLZA 2JQ6A 1YX7A 3KPXA 1PVAA 2K2FA 2F33A 1BOCA 4JPZB 2KI4B 4R1EA 1QJTA 5DKQA 5HKZA 1B8CA 2LVIA 5J3XA 2FCDA 2A4JA 4GGFA 2TN4A 1EXRA 1M45A 4PHNA 3CLNA 2I2RE 1W7JB 1FBVA 1WRZA 1MR8A 4PE7A 2K8MB 3PALA 4OKHA 3RM1A 5JJGA 1ZMZA 1IH0A 2BCXA 5AERA 4MEWA 1UHNA 1FW4A 2LVKA 3O6BA 3E3RA 2NLNA 1ZOTB 4MZJA 2MJWB 1KQMB 5IBWA 4ORCB 2ZN8A 2BBNA 4HREE 1TNPA 1Y1AA 2KBIA 1XFVO 3BXKA 2KAXA 1B1GA 2PSRA 1AHRA 1WDCC 1K8UA 1OOJA 1RROA 1NX1A 4MRYA 1QIVA 1K93D 1TTXA 2I7AA 4ORAB 1PULA 1EH2A 4CIDA 3D0YB 2B1UA 1SCMC 2K7BA 1SPYA 1XFZO 3CR4X 1WDCB 2LANA 2WCFA 4ZCUA 3M0WA 2LE9B 1PSRA 4L9MA 2JZIA 2LUXA 2LMUA 4GGNA 1LVCD 1PK0D 1QXPA 1TNXA 2JT0A 1DJHA 5K89A 3EKJA 1IJ5A 2H61C 1UHHA 2LVJA 4PHJA 4QJ3B 1QX5B 1F71A 4YGAA 1FF1A 4YGBB 1KQVA 1YURA 1SCMB 1YR5A 1RK9A 2EC6C 1AUIB 3BUWB 4YI8A 1B8LA 3BUNB 3DVKA 4TNCA 4YGCB 1S3PA 2WOSA 1YUUA 3EVVA 5KTYA 3CR2A 1XFWO 2GGZA 4WQ2A 3IF7A 5G08A 2PALA 1SBJA 5GQQC 3ZWHA 2D8NA 2L2EA 5HLVA 2LVVA 5BPJA 4N1GA 4MLWA 1Y1UA 4PHKA 2F2OA 3LK0A 2EC6B 5CSJA 4E68A 1QASA 1DT7B 4JQ0D 1WY9A 1GGZA 1GGWA 2LNKA 2JC2A 3D0YA 2M0RA 2BCBA 4UPGA 5AEQA 1IQ5A 2LMTA 2EHBA 2ZRSA 1H8BA 1V1GA 2ZKMX 1CTRA 1CFFA 3FS7A 1C7VA 1CMFA 2JULA 4PE4A 2HPSA 3PLFB 2JOJA 1L7ZA 1RJVA 1UHKA 2JTZA 4OV2A 2K61A 1B4CA 3A8RA 2LC5A 3EVUA 1NYAA 2JPTA 3I5FC 5I2QA 4IL1A 1K95A 1AVSA 4GPLB 4MVFA 4PCWA 2BCAA 3SG2A 1M63B 1YVHA 5F6TA 4I5LB 1K9UA 1KFUS 2OS8B 2CBLA 2PVBA 2LP2A 1CM4A 1YRTB 1KK8C 4CFQA 1A03A 1SL9A 3AAJA 4XJKB 2COLB 2JNFA 3I5FB 1KFXS 3SG7A 1JUOA 3CGAA 2KFGA 1XFYO 1A75B 2M1UA 2AUCA 1F55A 2KNEA 1OMDA 2BKHB 5HKWA 2KSPA 2O5GA 5KSZA 1KK8B 2M9GA 1QLKA 2ZNDA 3OHMB 4GAOA 2LAPA 3OB1B 1UUSA 2GV5A 1NUBA 4ORBB 4PALA 4DRWA 4PE1A 3LCPC 3TDZA 1AP4A 3VGOA 1J7OA 2LLUA 2M7LA 2VRGA 1QVIZ 3OP0A 4ETOA 1QLSA 1AJ5A 3EK7A 2BE6A 1FI6A 2G2BA 2GGMA 4N5XA 1QVIY 3QRXA 2NCOA 3BUXB 2CNPA 4C0KA 1BG1A 1F54A 3PN7C 1CDMA 2KI6C 1M39A 2F3ZA 3H4SE 3TS5C 3SJSA 4XJKA 2MBXA 4YI9A 1J7RA 5D69A 1A75A 2QACA 1BODA 1S6CA 1J55A 3PATA 1HQVA 1N2DA 2PMYA 4AOMA 4OVNF 4ICBA 1AK8A 1M31A 1BR4B 1NSHA 2KBMA 2K7OA 2Y1NA 1QIWA 3EK8A 3GOFA 3TS5B 4A4CA 1N0YA 1RTP1 4JWQA 1X02A 1NCXA 1K9KA 2BECA 1J1EA 1NCZA 4BY4A 1WRKA 4NQGA 1AJ4A 4NDBA 2M3WA 1RFJA 1S36A 2L50A 1UHIA 3GK4X 1SR6C 3CTNA 3WHUB 2JNXA 2Q91A 3FIAA 4WRIA 2HETA 1F8HA 2E6WA 4HSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1F A;  2HQ8 A;  1XO5 A;  2MAZ A;  4ZCV A;  1CLB A;  1B9A A;  2JRF A;  4USL A;  1DTL A;  3K21 A;  4YBH B;  2MA2 A;  1BT6 A;  4P2Y B;  2AMI A;  1KK7 Z;  1SR6 B;  1ODB A;  1PVB A;  1R6P A;  1UUR A;  1KK7 Y;  2WCE A;  2BKI B;  1K2H A;  1Y0V H;  2SAS A;  3I5H C;  1SL8 A;  2L51 A;  1G8I A;  4DS7 A;  4AQI A;  1NPQ A;  3VRQ A;  1YUS A;  3KO0 A;  3NSK A;  1MQ1 A;  2LV7 A;  1QS7 A;  2MLF C;  3A4U B;  3I5G C;  4YRU A;  1K94 A;  2QPT A;  2K7D A;  3CR5 X;  3SG6 A;  1MF8 B;  1QAT A;  4P5O E;  1HT9 A;  1YUT A;  1JSA A;  3JTD C;  1IG5 A;  1C07 A;  2NXQ A;  2Q4U A;  1A4P A;  1JFJ A;  2CTN A;  1OE9 B;  1SRA A;  2IS9 A;  5AAN A;  1CFD A;  1TNW A;  3I5G B;  2KQ6 A;  4MSP A;  2NCP A;  1B7T Z;  1R2U A;  4OCI A;  3TUY C;  1OZS A;  2WOR A;  1CDL A;  1B7T Y;  5AFP A;  1S5G Z;  3TZ1 A;  2ZRT A;  3JTD B;  2WND A;  4CLN A;  1K9P A;  1MUX A;  2JTT A;  2E30 A;  1XA5 A;  3I5I C;  1S5G Y;  4GNK B;  1DJW A;  1QX7 A;  3OX6 A;  1BF5 A;  3NSI A;  1EG4 A;  3ICB A;  1J7P A;  2V53 A;  4FTG A;  1CLL A;  5I8N A;  4A4B A;  1B8R A;  4DIR A;  1G4Y R;  5D7F A;  2H61 A;  1OZO A;  2L98 A;  1SW8 A;  1TOP A;  4U8D A;  1CB1 A;  1L2O C;  2KFH A;  3VRP A;  3FWC A;  1S6J A;  1SCV A;  2LHI A;  1LXF C;  2LCP A;  5HYD A;  1PAL A;  1ZFS A;  1IGV A;  2CT9 A;  3I5I B;  3TDU A;  3DVJ A;  4C0L A;  2F2P A;  1MWN A;  1U5I B;  3O4Y A;  1SK6 D;  4NDC A;  1BR1 B;  3DD4 A;  4OR9 B;  1JWD A;  1NP8 A;  3BQ3 A;  2I18 A;  4GUK A;  2PRU A;  4GGF C;  1J1D A;  2PAS A;  1IQ3 A;  1UP5 A;  1L2O B;  3TDI A;  1TNQ A;  1ALV A;  2K0J A;  3D10 A;  1YTZ C;  1PSB A;  3NSL A;  2L0P A;  1A29 A;  4I5J A;  1OMV A;  1CFC A;  4MN0 A;  1JFK A;  1EJ3 A;  1YRU B;  2BL0 C;  3SG5 A;  2WCB A;  4PHM A;  5TNC A;  3DF0 B;  1DF0 B;  2BE4 A;  4MZL A;  2L4I A;  1IWQ A;  3PM8 A;  3O2P A;  1CM1 A;  2EGD A;  1VRK A;  2R2I A;  4MBE A;  4XYN A;  4WQ3 A;  5DKR A;  1IJ6 A;  2ZN9 A;  1QX2 A;  2Y5I A;  2NZ0 A;  2BL0 B;  1CKK A;  2M8U A;  3KF9 A;  1U5I A;  4GFT A;  5PAL A;  2AAO A;  1A2X A;  1S6I A;  3F45 A;  1WLM A;  3SIB A;  5DKN A;  1FI5 A;  3AKA A;  2M7N A;  4Q04 A;  3PN7 B;  1IKU A;  4GBA A;  1M46 A;  2KOT A;  1UHJ A;  2HQW A;  1DJG A;  1LA0 A;  2FJU B;  2H2K A;  2KI6 D;  1Y1X A;  3AKB A;  2SCP A;  3NXA A;  2L5X B;  4DCK A;  5AXI A;  3ZNI A;  1MHO A;  2FCE A;  2LLS A;  3DF0 A;  1DF0 A;  1KWO C;  2JT8 A;  5HLO A;  4DUQ A;  4C0J A;  1JBA A;  2M97 A;  1ZUZ A;  2BBM A;  1KQM C;  3FWB A;  1LIN A;  2LMV A;  1NWD A;  2KYC A;  3BUM B;  3HX4 A;  1E8A A;  3VRN A;  2KFF A;  3HCM A;  5CPV A;  3CWG A;  1Y6W A;  1KWO B;  1EL4 A;  1C7W A;  2JXC A;  1DMO A;  1TIZ A;  1TRF A;  1CMG A;  1B47 A;  1KSM A;  5CSI A;  3IQQ A;  1XYD A;  4MZK A;  2WC8 A;  1OMR A;  3KHE A;  2MHH A;  3C1V A;  1OSA A;  2K7C A;  2KDH A;  3PSR A;  1SKT A;  3SG3 A;  1IRJ A;  1NX0 A;  3CZT X;  4M2O A;  1XK4 C;  4HRG A;  1PRW A;  3DVM A;  3EVR A;  4FQO A;  5CSF A;  1YX8 A;  4PE0 A;  3PFV A;  2KHN A;  4CPV A;  1JC2 A;  3MSE B;  1LA3 A;  3LL8 B;  2KAY A;  2G9B A;  4M2Q A;  2MLE C;  1Q80 A;  3BOW B;  5ER5 A;  1NIW A;  3I5H B;  5B8I B;  2JT3 A;  2LM5 A;  1SL7 A;  2ZFD A;  3JVT C;  1H4B A;  1YVL A;  1KCY A;  4NDD A;  3OX5 A;  1RWY A;  2Y1M A;  2CXJ A;  3KEV A;  1MXE A;  5I2O A;  2CCM A;  3NSO A;  5HKY A;  1QTX A;  2LUC A;  4CFR A;  1GQM A;  3GK1 A;  2M29 A;  5KU1 A;  1SYM A;  3JVT B;  4M2P A;  1ALW A;  3SIA A;  1LKJ A;  2K2A A;  1J7Q A;  1EG3 A;  1KFU L;  3LLE A;  2LHL A;  4D1E A;  3WNX B;  1XVJ A;  1OQP A;  3BYA A;  2JXL A;  3CS1 A;  4I5K A;  3TUY B;  1DVI A;  1GJY A;  5CSN A;  4YGD B;  5JOL A;  3VRO A;  1KFX L;  1NX2 A;  3VRR A;  3DVE A;  1DGV A;  2KGB C;  2LLT A;  4YGE B;  3BOW A;  3WHT B;  2L4H A;  1XK4 A;  4N1F A;  1N65 A;  1XFX O;  1S1E A;  2M49 B;  1REC A;  1F70 A;  2KQY A;  2OTG C;  2F3Y A;  2KGR A;  2DOQ A;  2OS8 C;  1NX3 A;  3SG4 A;  1D1O A;  1FPW A;  1JF2 A;  4I5N B;  1QV1 A;  1CFP A;  3WXA A;  2OPO A;  3LK1 A;  3AAK A;  2ISD A;  5ER4 X;  3O78 A;  2M1K B;  3EK4 A;  1K96 A;  1NCY A;  3EKH A;  1BMO A;  4HRH A;  2RGI A;  2HF5 A;  1SY9 A;  1KSO A;  2OTG B;  2JWW A;  3BUO B;  1CDP A;  1TN4 A;  1QV0 A;  2KAV A;  1BJF A;  5FYX A;  1JF0 A;  1WRL A;  2JU0 A;  1W7I B;  4QJ5 B;  1G33 A;  3GK2 A;  2LP3 A;  4MRX A;  1XFU O;  1DJX A;  1F4Q A;  1SMG A;  1WLZ A;  2KYF A;  4QJ4 B;  1DJZ A;  1SNL A;  2O60 A;  1S26 D;  1MXL C;  4PDZ A;  1TCO B;  5I2L A;  4F0Z B;  1DJY A;  1DGU A;  2MRD A;  2KI4 C;  3IQO A;  1BLQ A;  1UWO A;  1K90 D;  2F8P A;  1CLM A;  2I94 A;  1CDN A;  4BY5 A;  4AQJ A;  1TCF A;  3OB2 B;  1CNP A;  1F4O A;  2FOT A;  1BU3 A;  1ZAC A;  1DJI A;  2ZNE A;  2P6B B;  2Y4Q A;  3RLZ A;  2JQ6 A;  1YX7 A;  3KPX A;  1PVA A;  2K2F A;  2F33 A;  1BOC A;  4JPZ B;  2KI4 B;  4R1E A;  1QJT A;  5DKQ A;  5HKZ A;  1B8C A;  2LVI A;  5J3X A;  2FCD A;  2A4J A;  4GGF A;  2TN4 A;  1EXR A;  1M45 A;  4PHN A;  3CLN A;  2I2R E;  1W7J B;  1FBV A;  1WRZ A;  1MR8 A;  4PE7 A;  2K8M B;  3PAL A;  4OKH A;  3RM1 A;  5JJG A;  1ZMZ A;  1IH0 A;  2BCX A;  5AER A;  4MEW A;  1UHN A;  1FW4 A;  2LVK A;  3O6B A;  3E3R A;  2NLN A;  1ZOT B;  4MZJ A;  2MJW B;  1KQM B;  5IBW A;  4ORC B;  2ZN8 A;  2BBN A;  4HRE E;  1TNP A;  1Y1A A;  2KBI A;  1XFV O;  3BXK A;  2KAX A;  1B1G A;  2PSR A;  1AHR A;  1WDC C;  1K8U A;  1OOJ A;  1RRO A;  1NX1 A;  4MRY A;  1QIV A;  1K93 D;  1TTX A;  2I7A A;  4ORA B;  1PUL A;  1EH2 A;  4CID A;  3D0Y B;  2B1U A;  1SCM C;  2K7B A;  1SPY A;  1XFZ O;  3CR4 X;  1WDC B;  2LAN A;  2WCF A;  4ZCU A;  3M0W A;  2LE9 B;  1PSR A;  4L9M A;  2JZI A;  2LUX A;  2LMU A;  4GGN A;  1LVC D;  1PK0 D;  1QXP A;  1TNX A;  2JT0 A;  1DJH A;  5K89 A;  3EKJ A;  1IJ5 A;  2H61 C;  1UHH A;  2LVJ A;  4PHJ A;  4QJ3 B;  1QX5 B;  1F71 A;  4YGA A;  1FF1 A;  4YGB B;  1KQV A;  1YUR A;  1SCM B;  1YR5 A;  1RK9 A;  2EC6 C;  1AUI B;  3BUW B;  4YI8 A;  1B8L A;  3BUN B;  3DVK A;  4TNC A;  4YGC B;  1S3P A;  2WOS A;  1YUU A;  3EVV A;  5KTY A;  3CR2 A;  1XFW O;  2GGZ A;  4WQ2 A;  3IF7 A;  5G08 A;  2PAL A;  1SBJ A;  5GQQ C;  3ZWH A;  2D8N A;  2L2E A;  5HLV A;  2LVV A;  5BPJ A;  4N1G A;  4MLW A;  1Y1U A;  4PHK A;  2F2O A;  3LK0 A;  2EC6 B;  5CSJ A;  4E68 A;  1QAS A;  1DT7 B;  4JQ0 D;  1WY9 A;  1GGZ A;  1GGW A;  2LNK A;  2JC2 A;  3D0Y A;  2M0R A;  2BCB A;  4UPG A;  5AEQ A;  1IQ5 A;  2LMT A;  2EHB A;  2ZRS A;  1H8B A;  1V1G A;  2ZKM X;  1CTR A;  1CFF A;  3FS7 A;  1C7V A;  1CMF A;  2JUL A;  4PE4 A;  2HPS A;  3PLF B;  2JOJ A;  1L7Z A;  1RJV A;  1UHK A;  2JTZ A;  4OV2 A;  2K61 A;  1B4C A;  3A8R A;  2LC5 A;  3EVU A;  1NYA A;  2JPT A;  3I5F C;  5I2Q A;  4IL1 A;  1K95 A;  1AVS A;  4GPL B;  4MVF A;  4PCW A;  2BCA A;  3SG2 A;  1M63 B;  1YVH A;  5F6T A;  4I5L B;  1K9U A;  1KFU S;  2OS8 B;  2CBL A;  2PVB A;  2LP2 A;  1CM4 A;  1YRT B;  1KK8 C;  4CFQ A;  1A03 A;  1SL9 A;  3AAJ A;  4XJK B;  2COL B;  2JNF A;  3I5F B;  1KFX S;  3SG7 A;  1JUO A;  3CGA A;  2KFG A;  1XFY O;  1A75 B;  2M1U A;  2AUC A;  1F55 A;  2KNE A;  1OMD A;  2BKH B;  5HKW A;  2KSP A;  2O5G A;  5KSZ A;  1KK8 B;  2M9G A;  1QLK A;  2ZND A;  3OHM B;  4GAO A;  2LAP A;  3OB1 B;  1UUS A;  2GV5 A;  1NUB A;  4ORB B;  4PAL A;  4DRW A;  4PE1 A;  3LCP C;  3TDZ A;  1AP4 A;  3VGO A;  1J7O A;  2LLU A;  2M7L A;  2VRG A;  1QVI Z;  3OP0 A;  4ETO A;  1QLS A;  1AJ5 A;  3EK7 A;  2BE6 A;  1FI6 A;  2G2B A;  2GGM A;  4N5X A;  1QVI Y;  3QRX A;  2NCO A;  3BUX B;  2CNP A;  4C0K A;  1BG1 A;  1F54 A;  3PN7 C;  1CDM A;  2KI6 C;  1M39 A;  2F3Z A;  3H4S E;  3TS5 C;  3SJS A;  4XJK A;  2MBX A;  4YI9 A;  1J7R A;  5D69 A;  1A75 A;  2QAC A;  1BOD A;  1S6C A;  1J55 A;  3PAT A;  1HQV A;  1N2D A;  2PMY A;  4AOM A;  4OVN F;  4ICB A;  1AK8 A;  1M31 A;  1BR4 B;  1NSH A;  2KBM A;  2K7O A;  2Y1N A;  1QIW A;  3EK8 A;  3GOF A;  3TS5 B;  4A4C A;  1N0Y A;  1RTP 1;  4JWQ A;  1X02 A;  1NCX A;  1K9K A;  2BEC A;  1J1E A;  1NCZ A;  4BY4 A;  1WRK A;  4NQG A;  1AJ4 A;  4NDB A;  2M3W A;  1RFJ A;  1S36 A;  2L50 A;  1UHI A;  3GK4 X;  1SR6 C;  3CTN A;  3WHU B;  2JNX A;  2Q91 A;  3FIA A;  4WRI A;  2HET A;  1F8H A;  2E6W A;  4HSZ A; 
#chains in the Genus database with same CATH topology
 1V1F A;  2HQ8 A;  1XO5 A;  2MAZ A;  4ZCV A;  1CLB A;  1B9A A;  2JRF A;  4USL A;  3B6X A;  1DTL A;  3K21 A;  4YBH B;  3FE9 A;  2MA2 A;  1BT6 A;  4P2Y B;  2AMI A;  1KK7 Z;  3EG5 B;  1SR6 B;  1ODB A;  1PVB A;  1R6P A;  3B7A A;  1UUR A;  1KK7 Y;  2WCE A;  3D77 A;  2BKI B;  1K2H A;  1Y0V H;  3NHT A;  2SAS A;  3I5H C;  1SL8 A;  2L51 A;  1G8I A;  4DS7 A;  4AQI A;  5HL1 A;  1NPQ A;  3VRQ A;  1YUS A;  3KO0 A;  3NSK A;  1MQ1 A;  2LV7 A;  2L5Y A;  1QS7 A;  2MLF C;  3A4U B;  3BFA A;  1TUZ A;  3I5G C;  4YRU A;  1K94 A;  2QPT A;  2K7D A;  3CR5 X;  1DEL A;  3SG6 A;  1MF8 B;  1QAT A;  4INW A;  4P5O E;  1HT9 A;  1YUT A;  3S0B A;  1JSA A;  3JTD C;  1IG5 A;  1C07 A;  2NXQ A;  2Q4U A;  5EL2 A;  3S0A A;  1A4P A;  1JFJ A;  2CTN A;  1OE9 B;  1SRA A;  2IS9 A;  3NHI A;  5AAN A;  1CFD A;  1TNW A;  3I5G B;  2KQ6 A;  4JKT A;  4MSP A;  2NCP A;  1B7T Z;  1R2U A;  4OCI A;  3TUY C;  1OZS A;  1TUJ A;  2WOR A;  1CDL A;  1B7T Y;  5AFP A;  1S5G Z;  3TZ1 A;  3SS3 A;  2ZRT A;  3JTD B;  2WND A;  4CLN A;  1K9P A;  1MUX A;  2JTT A;  2E30 A;  1XA5 A;  3I5I C;  1S5G Y;  4GNK B;  1DJW A;  1QX7 A;  3OX6 A;  1BF5 A;  3NSI A;  3D78 A;  1EG4 A;  3ICB A;  1ORG A;  1J7P A;  5FI7 A;  2V53 A;  4FTG A;  1CLL A;  5I8N A;  4A4B A;  1B8R A;  4DIR A;  1G4Y R;  5D7F A;  2H61 A;  3BFH A;  1OZO A;  2L98 A;  1SW8 A;  1TOP A;  4U8D A;  1CB1 A;  1L2O C;  2KFH A;  2YGU A;  3VRP A;  3FWC A;  1S6J A;  1SCV A;  2LHI A;  1LXF C;  2LCP A;  5HYD A;  1PAL A;  1ZFS A;  1IGV A;  2CT9 A;  2K60 A;  3I5I B;  3DVJ A;  3TDU A;  1P28 A;  2F2P A;  1MWN A;  1U5I B;  3O4Y A;  1SK6 D;  4NDC A;  1BR1 B;  3DD4 A;  4OR9 B;  1JWD A;  1NP8 A;  3L4A A;  3BQ3 A;  2I18 A;  2KPH A;  4GUK A;  2PRU A;  4GGF C;  1J1D A;  2PAS A;  3CZ2 A;  1UP5 A;  1IQ3 A;  1L2O B;  3TDI A;  1TNQ A;  1ALV A;  2K0J A;  3D10 A;  1YTZ C;  1PSB A;  2BNX A;  3NSL A;  2L0P A;  1A29 A;  4I5J A;  1OMV A;  1CFC A;  4MN0 A;  1JFK A;  1EJ3 A;  1YRU B;  2BL0 C;  3SG5 A;  2WCB A;  4PHM A;  5TNC A;  2WC6 A;  3DF0 B;  1DF0 B;  2BE4 A;  4MZL A;  2L4I A;  3FE6 A;  1IWQ A;  3PM8 A;  3O2P A;  1CM1 A;  2EGD A;  1VRK A;  2QEB A;  2R2I A;  4MBE A;  4XYN A;  4WQ3 A;  5DKR A;  1IJ6 A;  2ZN9 A;  1QX2 A;  2Y5I A;  2NZ0 A;  2BL0 B;  1CKK A;  2M8U A;  3KF9 A;  1U5I A;  4GFT A;  5PAL A;  2AAO A;  1A2X A;  1S6I A;  3IVT A;  3F45 A;  1WLM A;  3CDN A;  3SIB A;  5DKN A;  1FI5 A;  3AKA A;  2M7N A;  4Q04 A;  3PN7 B;  1IKU A;  4GBA A;  1M46 A;  2KOT A;  5I94 A;  1UHJ A;  1DC1 A;  2HQW A;  1DJG A;  1LA0 A;  2FJU B;  2H2K A;  2KI6 D;  3PJI A;  1Y1X A;  3AKB A;  2SCP A;  3NXA A;  2L5X B;  4DCK A;  5AXI A;  3ZNI A;  1MHO A;  2FCE A;  2LLS A;  3DF0 A;  1DF0 A;  1KWO C;  2JT8 A;  3DZT A;  5HLO A;  4C0J A;  4DUQ A;  1JBA A;  5D3O A;  2M97 A;  1ZUZ A;  2BBM A;  1KQM C;  1GM0 A;  3FWB A;  3K1E A;  1LIN A;  2LMV A;  1NWD A;  2KYC A;  3BUM B;  3HX4 A;  1E8A A;  3VRN A;  2KFF A;  3HCM A;  5CPV A;  3CWG A;  1Y6W A;  1KWO B;  1EL4 A;  1C7W A;  2JXC A;  1DMO A;  1TIZ A;  1TRF A;  1CMG A;  1B47 A;  1KSM A;  5CSI A;  4PT1 A;  1DEK A;  3IQQ A;  1XYD A;  4MZK A;  2H8V A;  2WC8 A;  1OMR A;  3KHE A;  2MHH A;  3C1V A;  5DIC A;  3DXL A;  1OSA A;  2K7C A;  2KDH A;  3PSR A;  1SKT A;  2BAP A;  3SG3 A;  1IRJ A;  1NX0 A;  3CZT X;  4M2O A;  1XK4 C;  4HRG A;  1PRW A;  3DVM A;  3EVR A;  4FQO A;  5CSF A;  1YX8 A;  4PE0 A;  3PFV A;  2KHN A;  4CPV A;  1JC2 A;  4JD9 A;  3MSE B;  1LA3 A;  3LL8 B;  2KAY A;  2G9B A;  4M2Q A;  2MLE C;  1Q80 A;  3BOW B;  5ER5 A;  1NIW A;  3I5H B;  5B8I B;  2JT3 A;  2LM5 A;  1SL7 A;  2ZFD A;  3JVT C;  1H4B A;  1YVL A;  3VB1 A;  1KCY A;  4NDD A;  3OX5 A;  1RWY A;  2Y1M A;  2CXJ A;  3KEV A;  1MXE A;  5I2O A;  2CCM A;  4IJ7 A;  3NSO A;  5HKY A;  1QTX A;  1TWO A;  2LUC A;  4CFR A;  3D75 A;  1GQM A;  3GK1 A;  3L4L A;  2M29 A;  3UO9 A;  5KU1 A;  1SYM A;  3JVT B;  2WCJ A;  1ALW A;  4M2P A;  3RZS A;  3SIA A;  1LKJ A;  2QEV A;  2K2A A;  1J7Q A;  1OOG A;  1EG3 A;  3SS5 A;  1KFU L;  2PQL A;  3LLE A;  2LHL A;  4D1E A;  2WC5 A;  3WNX B;  2GTE A;  1XVJ A;  1OQP A;  3BYA A;  2JXL A;  3CS1 A;  4I5K A;  3TUY B;  1DVI A;  1GJY A;  5CSN A;  4YGD B;  5JOL A;  3VRO A;  1KFX L;  1NX2 A;  3VRR A;  3DVE A;  1DGV A;  2KGB C;  2LLT A;  2QEO A;  3BOW A;  4YGE B;  3WHT B;  2L4H A;  1XK4 A;  4N1F A;  1N65 A;  1XFX O;  1S1E A;  2M49 B;  1REC A;  3CAB A;  1F70 A;  3N7H A;  2KQY A;  2OTG C;  2F3Y A;  2KGR A;  2DOQ A;  2OS8 C;  1NX3 A;  2L2C A;  3OBV A;  3SG4 A;  1D1O A;  1FPW A;  1JF2 A;  4I5N B;  1QV1 A;  1CFP A;  3WXA A;  2OPO A;  2WCH A;  3LK1 A;  3AAK A;  2ISD A;  5ER4 X;  3O78 A;  2M1K B;  3EK4 A;  1K96 A;  3B88 A;  1NCY A;  3EKH A;  3L47 A;  1QWV A;  1BMO A;  4HRH A;  2RGI A;  2HF5 A;  1SY9 A;  1KSO A;  2OTG B;  2JWW A;  3BUO B;  1CDP A;  1TN4 A;  1QV0 A;  3BFB A;  2KAV A;  1BJF A;  5FYX A;  1JF0 A;  5FI2 A;  1WRL A;  2JU0 A;  1W7I B;  4QJ5 B;  1G33 A;  3GK2 A;  2LP3 A;  3R1P A;  4MRX A;  1XFU O;  1DJX A;  1F4Q A;  1SMG A;  1WLZ A;  2KYF A;  4QJ4 B;  1DJZ A;  1SNL A;  2O60 A;  1S26 D;  1MXL C;  4PDZ A;  1TCO B;  5I2L A;  4F0Z B;  3SS4 A;  1DJY A;  1DGU A;  2JPO A;  2MRD A;  2KI4 C;  1OOF A;  3IQO A;  1BLQ A;  1UWO A;  1K90 D;  2F8P A;  1CLM A;  2I94 A;  1CDN A;  4BY5 A;  4AQJ A;  1TCF A;  3CYZ A;  3OB2 B;  1CNP A;  1F4O A;  4INX A;  2FOT A;  1BU3 A;  1ZAC A;  1DJI A;  2ZNE A;  1C3Y A;  2P6B B;  2Y4Q A;  3RLZ A;  2JQ6 A;  1YX7 A;  3KPX A;  1PVA A;  2K2F A;  2F33 A;  1BOC A;  4JPZ B;  2KI4 B;  3S0F A;  1DQE A;  4R1E A;  1QJT A;  5DKQ A;  5HKZ A;  1B8C A;  2LVI A;  5J3X A;  2FCD A;  2A4J A;  3DY9 A;  4GGF A;  2TN4 A;  1EXR A;  1M45 A;  4PHN A;  3CLN A;  2I2R E;  1W7J B;  2ERB A;  1FBV A;  1WRZ A;  2KLE A;  1MR8 A;  4PE7 A;  2K8M B;  3PAL A;  4OKH A;  3RM1 A;  5JJG A;  1ZMZ A;  3Q8I A;  1IH0 A;  4OZD A;  2BCX A;  5AER A;  4MEW A;  3O4X A;  1Z4H A;  1UHN A;  1FW4 A;  2LVK A;  3O6B A;  3E3R A;  2NLN A;  1IIO A;  1ZOT B;  4MZJ A;  2MJW B;  1KQM B;  5IBW A;  4ORC B;  2ZN8 A;  2BBN A;  4HRE E;  1TNP A;  1Y1A A;  2KBI A;  1XFV O;  3BXK A;  2KAX A;  1B1G A;  2PSR A;  3OGN A;  1AHR A;  1WDC C;  1K8U A;  1OOJ A;  1Z2C B;  1RRO A;  4C0L A;  1NX1 A;  2WCL A;  2FJY A;  4MRY A;  1QIV A;  1K93 D;  3D74 A;  3D73 A;  1TTX A;  2I7A A;  4ORA B;  1PUL A;  1EH2 A;  4CID A;  3D0Y B;  2B1U A;  1SCM C;  2K7B A;  1SPY A;  1XFZ O;  3CR4 X;  1OOH A;  1WDC B;  1SSE B;  2LAN A;  2WCF A;  3M0W A;  2LE9 B;  1PSR A;  4L9M A;  4ZCU A;  2JZI A;  2LUX A;  2LMU A;  4GGN A;  1LS8 A;  1LVC D;  1PK0 D;  1QXP A;  1TNX A;  3PM2 A;  2JT0 A;  1DJH A;  5K89 A;  3EKJ A;  1IJ5 A;  2H61 C;  1UHH A;  2LVJ A;  4PHJ A;  4QJ3 B;  1QX5 B;  3B86 A;  1F71 A;  4YGA A;  1FF1 A;  4YGB B;  1KQV A;  1YUR A;  1SCM B;  1YR5 A;  1RK9 A;  2EC6 C;  1AUI B;  3BUW B;  4YI8 A;  1B8L A;  3BUN B;  3DVK A;  4TNC A;  4YGC B;  1S3P A;  2WOS A;  1YUU A;  3EVV A;  5KTY A;  3CR2 A;  1XFW O;  2GGZ A;  4WQ2 A;  3IF7 A;  5G08 A;  3S0E A;  2PAL A;  3S0D A;  1SBJ A;  5GQQ C;  3ZWH A;  1XFR A;  2D8N A;  2L2E A;  5HLV A;  2LVV A;  5BPJ A;  4N1G A;  4MLW A;  1C3Z A;  1Y1U A;  4PHK A;  2F2O A;  3LK0 A;  2EC6 B;  3CZ1 A;  5CSJ A;  4E68 A;  2PYQ A;  1QAS A;  1DT7 B;  4JQ0 D;  1WY9 A;  3CZ0 A;  1GGZ A;  1GGW A;  2LNK A;  2JC2 A;  3D0Y A;  2M0R A;  2BCB A;  3DYE A;  4UPG A;  5AEQ A;  1IQ5 A;  2LMT A;  3B87 A;  2EHB A;  2ZRS A;  1H8B A;  1V1G A;  2ZKM X;  1CTR A;  1CFF A;  3FS7 A;  3V2L A;  1C7V A;  1CMF A;  1T14 A;  2JUL A;  4PE4 A;  2HPS A;  3PLF B;  4KYN A;  2JOJ A;  1L7Z A;  1RJV A;  1UHK A;  2JTZ A;  4OV2 A;  4FQT A;  2K61 A;  1B4C A;  3A8R A;  2LC5 A;  3EVU A;  1NYA A;  2JPT A;  3I5F C;  5I2Q A;  4IL1 A;  1K95 A;  1AVS A;  4GPL B;  4MVF A;  4PCW A;  2BCA A;  3SG2 A;  1M63 B;  1YVH A;  5F6T A;  4I5L B;  1K9U A;  5FI6 A;  1KFU S;  2OS8 B;  2CBL A;  2PVB A;  2LP2 A;  1CM4 A;  1YRT B;  1KK8 C;  4CFQ A;  1A03 A;  1SL9 A;  3AAJ A;  4XJK B;  2COL B;  2JNF A;  3I5F B;  1KFX S;  3SG7 A;  1JUO A;  3CGA A;  2KFG A;  1XFY O;  1A75 B;  2M1U A;  2AUC A;  3FE8 A;  1F55 A;  2KNE A;  1OMD A;  2BKH B;  5HKW A;  2KSP A;  2O5G A;  5KSZ A;  1KK8 B;  2M9G A;  1QLK A;  2ZND A;  3D76 A;  3OHM B;  2LAP A;  3R1O A;  4GAO A;  3OB1 B;  3S0G A;  1UUS A;  2KLD A;  3UNW A;  2GV5 A;  1NUB A;  4ORB B;  4PAL A;  4DRW A;  4PE1 A;  3LCP C;  3TDZ A;  1AP4 A;  3VGO A;  1J7O A;  3NGV A;  2LLU A;  2M7L A;  2VRG A;  1QVI Z;  3OP0 A;  4ETO A;  1QLS A;  1AJ5 A;  3EK7 A;  2BE6 A;  1FI6 A;  2G2B A;  2GGM A;  4N5X A;  2P70 A;  1QVI Y;  3QRX A;  2WCM A;  2NCO A;  3BUX B;  2CNP A;  4C0K A;  1BG1 A;  1F54 A;  3PN7 C;  1CDM A;  2KI6 C;  3QME A;  1M39 A;  1OW4 A;  2F3Z A;  3H4S E;  3TS5 C;  3SJS A;  2P71 A;  4XJK A;  2MBX A;  4YI9 A;  1J7R A;  3R1V A;  5D69 A;  1A75 A;  2QAC A;  1BOD A;  1S6C A;  1J55 A;  3PAT A;  1HQV A;  1W9Z A;  1N2D A;  2PMY A;  4AOM A;  4OVN F;  4ICB A;  1AK8 A;  1M31 A;  1BR4 B;  1NSH A;  2KBM A;  2K7O A;  2Y1N A;  1QIW A;  3EK8 A;  3GOF A;  3TS5 B;  4A4C A;  1N0Y A;  1RTP 1;  4JWQ A;  1X02 A;  1OOI X;  4F7F A;  2WCK A;  1NCX A;  1K9K A;  3R72 A;  2BEC A;  2QDI A;  1J1E A;  1NCZ A;  4BY4 A;  1WRK A;  3BJH A;  1AJ4 A;  4NDB A;  4NQG A;  2M3W A;  1RFJ A;  1S36 A;  2QEH A;  2L50 A;  1UHI A;  3GK4 X;  1SR6 C;  3CTN A;  3WHU B;  2JNX A;  2Q91 A;  3FIA A;  4WRI A;  2HET A;  1F8H A;  2E6W A;  4HSZ A; 
#chains in the Genus database with same CATH homology
 1V1F A;  2HQ8 A;  1XO5 A;  2MAZ A;  4ZCV A;  1CLB A;  1B9A A;  2JRF A;  4USL A;  1DTL A;  3K21 A;  4YBH B;  2MA2 A;  1BT6 A;  4P2Y B;  2AMI A;  1KK7 Z;  1SR6 B;  1ODB A;  1PVB A;  1R6P A;  1UUR A;  1KK7 Y;  2WCE A;  2BKI B;  1K2H A;  1Y0V H;  2SAS A;  3I5H C;  1SL8 A;  2L51 A;  1G8I A;  4DS7 A;  4AQI A;  1NPQ A;  3VRQ A;  1YUS A;  3KO0 A;  3NSK A;  1MQ1 A;  2LV7 A;  1QS7 A;  2MLF C;  3A4U B;  3I5G C;  4YRU A;  1K94 A;  2QPT A;  2K7D A;  3CR5 X;  3SG6 A;  1MF8 B;  1QAT A;  4P5O E;  1HT9 A;  1YUT A;  1JSA A;  3JTD C;  1IG5 A;  1C07 A;  2NXQ A;  2Q4U A;  1A4P A;  1JFJ A;  2CTN A;  1OE9 B;  1SRA A;  2IS9 A;  5AAN A;  1CFD A;  1TNW A;  3I5G B;  2KQ6 A;  4MSP A;  2NCP A;  1B7T Z;  1R2U A;  4OCI A;  3TUY C;  1OZS A;  2WOR A;  1CDL A;  1B7T Y;  5AFP A;  1S5G Z;  3TZ1 A;  2ZRT A;  3JTD B;  2WND A;  4CLN A;  1K9P A;  1MUX A;  2JTT A;  2E30 A;  1XA5 A;  3I5I C;  1S5G Y;  4GNK B;  1DJW A;  1QX7 A;  3OX6 A;  1BF5 A;  3NSI A;  1EG4 A;  3ICB A;  1J7P A;  2V53 A;  4FTG A;  1CLL A;  5I8N A;  4A4B A;  1B8R A;  4DIR A;  1G4Y R;  5D7F A;  2H61 A;  1OZO A;  2L98 A;  1SW8 A;  1TOP A;  4U8D A;  1CB1 A;  1L2O C;  2KFH A;  3VRP A;  3FWC A;  1S6J A;  1SCV A;  2LHI A;  1LXF C;  2LCP A;  5HYD A;  1PAL A;  1ZFS A;  1IGV A;  2CT9 A;  3I5I B;  3TDU A;  3DVJ A;  4C0L A;  2F2P A;  1MWN A;  1U5I B;  3O4Y A;  1SK6 D;  4NDC A;  1BR1 B;  3DD4 A;  4OR9 B;  1JWD A;  1NP8 A;  3BQ3 A;  2I18 A;  4GUK A;  2PRU A;  4GGF C;  1J1D A;  2PAS A;  1IQ3 A;  1UP5 A;  1L2O B;  3TDI A;  1TNQ A;  1ALV A;  2K0J A;  3D10 A;  1YTZ C;  1PSB A;  3NSL A;  2L0P A;  1A29 A;  4I5J A;  1OMV A;  1CFC A;  4MN0 A;  1JFK A;  1EJ3 A;  1YRU B;  2BL0 C;  3SG5 A;  2WCB A;  4PHM A;  5TNC A;  3DF0 B;  1DF0 B;  2BE4 A;  4MZL A;  2L4I A;  1IWQ A;  3PM8 A;  3O2P A;  1CM1 A;  2EGD A;  1VRK A;  2R2I A;  4MBE A;  4XYN A;  4WQ3 A;  5DKR A;  1IJ6 A;  2ZN9 A;  1QX2 A;  2Y5I A;  2NZ0 A;  2BL0 B;  1CKK A;  2M8U A;  3KF9 A;  1U5I A;  4GFT A;  5PAL A;  2AAO A;  1A2X A;  1S6I A;  3F45 A;  1WLM A;  3SIB A;  5DKN A;  1FI5 A;  3AKA A;  2M7N A;  4Q04 A;  3PN7 B;  1IKU A;  4GBA A;  1M46 A;  2KOT A;  1UHJ A;  2HQW A;  1DJG A;  1LA0 A;  2FJU B;  2H2K A;  2KI6 D;  1Y1X A;  3AKB A;  2SCP A;  3NXA A;  2L5X B;  4DCK A;  5AXI A;  3ZNI A;  1MHO A;  2FCE A;  2LLS A;  3DF0 A;  1DF0 A;  1KWO C;  2JT8 A;  5HLO A;  4DUQ A;  4C0J A;  1JBA A;  2M97 A;  1ZUZ A;  2BBM A;  1KQM C;  3FWB A;  1LIN A;  2LMV A;  1NWD A;  2KYC A;  3BUM B;  3HX4 A;  1E8A A;  3VRN A;  2KFF A;  3HCM A;  5CPV A;  3CWG A;  1Y6W A;  1KWO B;  1EL4 A;  1C7W A;  2JXC A;  1DMO A;  1TIZ A;  1TRF A;  1CMG A;  1B47 A;  1KSM A;  5CSI A;  3IQQ A;  1XYD A;  4MZK A;  2WC8 A;  1OMR A;  3KHE A;  2MHH A;  3C1V A;  1OSA A;  2K7C A;  2KDH A;  3PSR A;  1SKT A;  3SG3 A;  1IRJ A;  1NX0 A;  3CZT X;  4M2O A;  1XK4 C;  4HRG A;  1PRW A;  3DVM A;  3EVR A;  4FQO A;  5CSF A;  1YX8 A;  4PE0 A;  3PFV A;  2KHN A;  4CPV A;  1JC2 A;  3MSE B;  1LA3 A;  3LL8 B;  2KAY A;  2G9B A;  4M2Q A;  2MLE C;  1Q80 A;  3BOW B;  5ER5 A;  1NIW A;  3I5H B;  5B8I B;  2JT3 A;  2LM5 A;  1SL7 A;  2ZFD A;  3JVT C;  1H4B A;  1YVL A;  1KCY A;  4NDD A;  3OX5 A;  1RWY A;  2Y1M A;  2CXJ A;  3KEV A;  1MXE A;  5I2O A;  2CCM A;  3NSO A;  5HKY A;  1QTX A;  2LUC A;  4CFR A;  1GQM A;  3GK1 A;  2M29 A;  5KU1 A;  1SYM A;  3JVT B;  4M2P A;  1ALW A;  3SIA A;  1LKJ A;  2K2A A;  1J7Q A;  1EG3 A;  1KFU L;  3LLE A;  2LHL A;  4D1E A;  3WNX B;  1XVJ A;  1OQP A;  3BYA A;  2JXL A;  3CS1 A;  4I5K A;  3TUY B;  1DVI A;  1GJY A;  5CSN A;  4YGD B;  5JOL A;  3VRO A;  1KFX L;  1NX2 A;  3VRR A;  3DVE A;  1DGV A;  2KGB C;  2LLT A;  4YGE B;  3BOW A;  3WHT B;  2L4H A;  1XK4 A;  4N1F A;  1N65 A;  1XFX O;  1S1E A;  2M49 B;  1REC A;  1F70 A;  2KQY A;  2OTG C;  2F3Y A;  2KGR A;  2DOQ A;  2OS8 C;  1NX3 A;  3SG4 A;  1D1O A;  1FPW A;  1JF2 A;  4I5N B;  1QV1 A;  1CFP A;  3WXA A;  2OPO A;  3LK1 A;  3AAK A;  2ISD A;  5ER4 X;  3O78 A;  2M1K B;  3EK4 A;  1K96 A;  1NCY A;  3EKH A;  1BMO A;  4HRH A;  2RGI A;  2HF5 A;  1SY9 A;  1KSO A;  2OTG B;  2JWW A;  3BUO B;  1CDP A;  1TN4 A;  1QV0 A;  2KAV A;  1BJF A;  5FYX A;  1JF0 A;  1WRL A;  2JU0 A;  1W7I B;  4QJ5 B;  1G33 A;  3GK2 A;  2LP3 A;  4MRX A;  1XFU O;  1DJX A;  1F4Q A;  1SMG A;  1WLZ A;  2KYF A;  4QJ4 B;  1DJZ A;  1SNL A;  2O60 A;  1S26 D;  1MXL C;  4PDZ A;  1TCO B;  5I2L A;  4F0Z B;  1DJY A;  1DGU A;  2MRD A;  2KI4 C;  3IQO A;  1BLQ A;  1UWO A;  1K90 D;  2F8P A;  1CLM A;  2I94 A;  1CDN A;  4BY5 A;  4AQJ A;  1TCF A;  3OB2 B;  1CNP A;  1F4O A;  2FOT A;  1BU3 A;  1ZAC A;  1DJI A;  2ZNE A;  2P6B B;  2Y4Q A;  3RLZ A;  2JQ6 A;  1YX7 A;  3KPX A;  1PVA A;  2K2F A;  2F33 A;  1BOC A;  4JPZ B;  2KI4 B;  4R1E A;  1QJT A;  5DKQ A;  5HKZ A;  1B8C A;  2LVI A;  5J3X A;  2FCD A;  2A4J A;  4GGF A;  2TN4 A;  1EXR A;  1M45 A;  4PHN A;  3CLN A;  2I2R E;  1W7J B;  1FBV A;  1WRZ A;  1MR8 A;  4PE7 A;  2K8M B;  3PAL A;  4OKH A;  3RM1 A;  5JJG A;  1ZMZ A;  1IH0 A;  2BCX A;  5AER A;  4MEW A;  1UHN A;  1FW4 A;  2LVK A;  3O6B A;  3E3R A;  2NLN A;  1ZOT B;  4MZJ A;  2MJW B;  1KQM B;  5IBW A;  4ORC B;  2ZN8 A;  2BBN A;  4HRE E;  1TNP A;  1Y1A A;  2KBI A;  1XFV O;  3BXK A;  2KAX A;  1B1G A;  2PSR A;  1AHR A;  1WDC C;  1K8U A;  1OOJ A;  1RRO A;  1NX1 A;  4MRY A;  1QIV A;  1K93 D;  1TTX A;  2I7A A;  4ORA B;  1PUL A;  1EH2 A;  4CID A;  3D0Y B;  2B1U A;  1SCM C;  2K7B A;  1SPY A;  1XFZ O;  3CR4 X;  1WDC B;  2LAN A;  2WCF A;  4ZCU A;  3M0W A;  2LE9 B;  1PSR A;  4L9M A;  2JZI A;  2LUX A;  2LMU A;  4GGN A;  1LVC D;  1PK0 D;  1QXP A;  1TNX A;  2JT0 A;  1DJH A;  5K89 A;  3EKJ A;  1IJ5 A;  2H61 C;  1UHH A;  2LVJ A;  4PHJ A;  4QJ3 B;  1QX5 B;  1F71 A;  4YGA A;  1FF1 A;  4YGB B;  1KQV A;  1YUR A;  1SCM B;  1YR5 A;  1RK9 A;  2EC6 C;  1AUI B;  3BUW B;  4YI8 A;  1B8L A;  3BUN B;  3DVK A;  4TNC A;  4YGC B;  1S3P A;  2WOS A;  1YUU A;  3EVV A;  5KTY A;  3CR2 A;  1XFW O;  2GGZ A;  4WQ2 A;  3IF7 A;  5G08 A;  2PAL A;  1SBJ A;  5GQQ C;  3ZWH A;  2D8N A;  2L2E A;  5HLV A;  2LVV A;  5BPJ A;  4N1G A;  4MLW A;  1Y1U A;  4PHK A;  2F2O A;  3LK0 A;  2EC6 B;  5CSJ A;  4E68 A;  1QAS A;  1DT7 B;  4JQ0 D;  1WY9 A;  1GGZ A;  1GGW A;  2LNK A;  2JC2 A;  3D0Y A;  2M0R A;  2BCB A;  4UPG A;  5AEQ A;  1IQ5 A;  2LMT A;  2EHB A;  2ZRS A;  1H8B A;  1V1G A;  2ZKM X;  1CTR A;  1CFF A;  3FS7 A;  1C7V A;  1CMF A;  2JUL A;  4PE4 A;  2HPS A;  3PLF B;  2JOJ A;  1L7Z A;  1RJV A;  1UHK A;  2JTZ A;  4OV2 A;  2K61 A;  1B4C A;  3A8R A;  2LC5 A;  3EVU A;  1NYA A;  2JPT A;  3I5F C;  5I2Q A;  4IL1 A;  1K95 A;  1AVS A;  4GPL B;  4MVF A;  4PCW A;  2BCA A;  3SG2 A;  1M63 B;  1YVH A;  5F6T A;  4I5L B;  1K9U A;  1KFU S;  2OS8 B;  2CBL A;  2PVB A;  2LP2 A;  1CM4 A;  1YRT B;  1KK8 C;  4CFQ A;  1A03 A;  1SL9 A;  3AAJ A;  4XJK B;  2COL B;  2JNF A;  3I5F B;  1KFX S;  3SG7 A;  1JUO A;  3CGA A;  2KFG A;  1XFY O;  1A75 B;  2M1U A;  2AUC A;  1F55 A;  2KNE A;  1OMD A;  2BKH B;  5HKW A;  2KSP A;  2O5G A;  5KSZ A;  1KK8 B;  2M9G A;  1QLK A;  2ZND A;  3OHM B;  4GAO A;  2LAP A;  3OB1 B;  1UUS A;  2GV5 A;  1NUB A;  4ORB B;  4PAL A;  4DRW A;  4PE1 A;  3LCP C;  3TDZ A;  1AP4 A;  3VGO A;  1J7O A;  2LLU A;  2M7L A;  2VRG A;  1QVI Z;  3OP0 A;  4ETO A;  1QLS A;  1AJ5 A;  3EK7 A;  2BE6 A;  1FI6 A;  2G2B A;  2GGM A;  4N5X A;  1QVI Y;  3QRX A;  2NCO A;  3BUX B;  2CNP A;  4C0K A;  1BG1 A;  1F54 A;  3PN7 C;  1CDM A;  2KI6 C;  1M39 A;  2F3Z A;  3H4S E;  3TS5 C;  3SJS A;  4XJK A;  2MBX A;  4YI9 A;  1J7R A;  5D69 A;  1A75 A;  2QAC A;  1BOD A;  1S6C A;  1J55 A;  3PAT A;  1HQV A;  1N2D A;  2PMY A;  4AOM A;  4OVN F;  4ICB A;  1AK8 A;  1M31 A;  1BR4 B;  1NSH A;  2KBM A;  2K7O A;  2Y1N A;  1QIW A;  3EK8 A;  3GOF A;  3TS5 B;  4A4C A;  1N0Y A;  1RTP 1;  4JWQ A;  1X02 A;  1NCX A;  1K9K A;  2BEC A;  1J1E A;  1NCZ A;  4BY4 A;  1WRK A;  4NQG A;  1AJ4 A;  4NDB A;  2M3W A;  1RFJ A;  1S36 A;  2L50 A;  1UHI A;  3GK4 X;  1SR6 C;  3CTN A;  3WHU B;  2JNX A;  2Q91 A;  3FIA A;  4WRI A;  2HET A;  1F8H A;  2E6W A;  4HSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...