1J7PA

Solution structure of calcium calmodulin c-terminal domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
EEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Calmodulin
publication title Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2001-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7pA00
1K95A 2F2PA 1CDMA 5B8IB 4XYNA 1QVIY 2MAZA 1RJVA 3RM1A 2E30A 4YI9A 5HLOA 4MBEA 2WCFA 2KI4C 4OCIA 4HRHA 3PALA 3BUXB 3EVVA 1B8CA 3HCMA 2K0JA 3BOWA 1RWYA 1AK8A 2BL0B 3A4UB 1IG5A 2V53A 1BODA 1FW4A 5KU1A 1CDLA 5HKYA 2Q4UA 4PALA 1GGZA 3EVRA 2GGMA 1DJYA 4PHMA 1PVBA 3I5HC 1OQPA 2P6BB 2OTGC 4ZCUA 2NLNA 4IL1A 1TNPA 1SPYA 2K2FA 1G4YR 3BYAA 2B1UA 1S3PA 3AAKA 2JXCA 2M49B 3JVTC 2K7DA 3O4YA 2F3ZA 4YGDB 1NPQA 4GAOA 2KGRA 2KAYA 1BLQA 2TN4A 1A75B 1F4OA 3VROA 4JPZB 1PSBA 1F55A 1GGWA 2BE6A 2L5XB 1LVCD 3IQQA 2CBLA 4GNKB 5CPVA 4FQOA 1TNWA 1CTRA 1QX7A 1R6PA 1EG3A 1N65A 1FF1A 4PE1A 4DCKA 1ALVA 1Y0VH 4I5LB 2H2KA 1XFXO 1CM4A 3NSLA 1NP8A 2M0RA 3OP0A 3PFVA 2EGDA 1UHNA 2AUCA 1X02A 1PVAA 1SNLA 1E8AA 1IJ5A 2IS9A 4A4BA 4ICBA 4AOMA 1ZOTB 3WXAA 1QS7A 3FWCA 3NSIA 1UHKA 5KTYA 2FCEA 4PCWA 1CM1A 1KK7Z 5AEQA 2Y1NA 1CFFA 3NSOA 1F54A 2BBNA 3PLFB 1U5IB 5JJGA 3DVJA 1JBAA 1M46A 2LMUA 2CXJA 5DKQA 1QTXA 2JULA 3OX6A 1N0YA 1RFJA 2RGIA 3PN7B 2ISDA 3WHUB 1WRKA 3TDIA 5JOLA 1AHRA 1DVIA 1NCYA 3LK1A 3TS5B 2JQ6A 4U8DA 1XYDA 1ZUZA 1SCMC 4N5XA 1MF8B 1PALA 2M7LA 3CLNA 2PALA 1JWDA 1KWOB 4PHKA 1OZSA 4WQ2A 4GUKA 1EH2A 1B8RA 2F8PA 4NDBA 1Y1UA 2K8MB 1OE9B 4HSZA 3QRXA 2NCOA 2A4JA 2LV7A 2AAOA 2KHNA 2I18A 2LVKA 4UPGA 2KGBC 3FS7A 1KK7Y 1UHJA 5HKZA 3HX4A 3LK0A 4YRUA 1IJ6A 1S6CA 2KNEA 3CZTX 1J55A 1YVLA 1DF0A 1YUTA 3DVEA 2MHHA 1WY9A 1H4BA 3CR2A 1YVHA 1WRZA 2KI4B 1KFXS 1OZOA 2JZIA 2FCDA 3D0YA 1DJHA 1XVJA 4MVFA 3VRQA 2JPTA 2LLSA 1PULA 1K94A 2ZNDA 5CSJA 1NX0A 2COLB 1DGVA 5I2LA 1YR5A 2LUCA 2O60A 5CSFA 4DIRA 3KHEA 1KK8B 4GFTA 5D69A 1YURA 1H8BA 3GK2A 3I5HB 1CFDA 1TCOB 2I7AA 3DVMA 1LXFC 2OTGB 3BOWB 3I5GC 2JWWA 3DD4A 2ZKMX 2LMVA 3PATA 1FI6A 1YRTB 1DGUA 1UUSA 4N1GA 3JVTB 3SG2A 2ZRSA 1UP5A 3F45A 3M0WA 2JT0A 2LLUA 2K7CA 1F70A 2LHLA 4OV2A 1IRJA 2PRUA 2SASA 2L98A 3OB2B 2F2OA 1DJGA 3CGAA 1AVSA 2I2RE 2K7BA 4R1EA 4YGCB 1M31A 4MRXA 1V1FA 2M7NA 1WLMA 3AKBA 1KK8C 2K2AA 2ZNEA 4I5JA 5ER5A 1QV0A 5AERA 2HPSA 1IWQA 1SR6C 3NSKA 5ER4X 2F33A 2MLFC 1UHHA 3LCPC 1D1OA 2G2BA 1YUSA 2LNKA 3KF9A 1A2XA 1CFCA 1QJTA 2LUXA 1QV1A 4C0JA 4AQIA 1V1GA 3GOFA 2VRGA 1QX2A 2OS8C 1PRWA 3AKAA 4YI8A 2LM5A 2FJUB 3K21A 1AJ5A 1M39A 5KSZA 1EXRA 4N1FA 3CWGA 1OSAA 1SK6D 4CFRA 1AUIB 1KQVA 5I2QA 4BY4A 3AAJA 2M29A 1TNQA 1DJZA 3EVUA 5FYXA 1QATA 4PE7A 1RK9A 3SG6A 2KFHA 1BJFA 1SBJA 2LLTA 2H61A 1NX1A 2KBMA 1SCMB 3WHTB 1ZFSA 2LCPA 1LA3A 3OX5A 2CT9A 1F8HA 1S6JA 3O78A 1B47A 1OMDA 1FBVA 2LVVA 3C1VA 3CR5X 2G9BA 2LE9B 4A4CA 1ODBA 2WCEA 1C7VA 2JRFA 2KDHA 2L4HA 2H61C 4DRWA 4NQGA 3BUNB 3SIBA 3CS1A 1EG4A 3A8RA 1KCYA 1XA5A 4MSPA 2BBMA 2GV5A 4E68A 5I2OA 3O6BA 1J1EA 2PASA 3DF0A 4BY5A 3PM8A 1NUBA 2HQ8A 3TDZA 1DMOA 2JC2A 2JTZA 2MRDA 3CTNA 1SYMA 5IBWA 1MR8A 1G33A 2PSRA 2Q91A 1NX2A 4M2QA 1A75A 1FPWA 3BXKA 3H4SE 1CKKA 4XJKA 1AP4A 1KSMA 4CFQA 3SG7A 2LVIA 1J7RA 2BCAA 1IQ5A 4GGNA 1TN4A 2WC8A 2FOTA 1QIWA 1BMOA 3BUWB 3SG4A 1CLBA 2AMIA 2E6WA 1NCXA 2WORA 1DF0B 1MXLC 1YUUA 2HF5A 4MN0A 1MXEA 2Y4QA 4GPLB 1SKTA 2KYCA 1M63B 2BKIB 2L2EA 3FIAA 1SY9A 4D1EA 3D0YB 3SG5A 2KBIA 3EKHA 1JUOA 3OHMB 4NDCA 1S26D 4OKHA 3VRRA 5I8NA 2O5GA 3I5GB 1DT7B 3TUYC 3I5IC 1RECA 2ZN8A 3O2PA 1W7IB 2CCMA 1TTXA 1QXPA 2KFFA 2MJWB 1K8UA 1HQVA 1PK0D 1QLKA 3D10A 2D8NA 1K9PA 1CNPA 3RLZA 1NSHA 1PSRA 1S6IA 3VGOA 1HT9A 1NWDA 1L7ZA 1B1GA 2QPTA 3TZ1A 1J7PA 1DJWA 3EK7A 1BOCA 4MLWA 4CIDA 2BKHB 2M8UA 2M1UA 3IF7A 3FWBA 1LINA 4QJ5B 1TCFA 5AXIA 1EJ3A 2KAXA 1KQMC 1C07A 1B9AA 1B7TZ 1F4QA 1A29A 2OPOA 4MZJA 1SR6B 1MWNA 1KFUS 1K9UA 1K2HA 1CDPA 5HLVA 1W7JB 1WDCC 1Y1AA 4YGEB 1YX8A 2BCXA 2OS8B 5DKNA 5G08A 2EC6C 2CTNA 2LP3A 3SIAA 1RTP1 2LVJA 5J3XA 2JOJA 1JFKA 1SW8A 2M3WA 2WNDA 4TNCA 1NYAA 4C0KA 1DJIA 2DOQA 2ZRTA 1EL4A 1C7WA 2MLEC 1KFXL 2BCBA 1XK4A 3BQ3A 2KSPA 1A4PA 1QX5B 2PMYA 1JF2A 4QJ3B 1M45A 4MZKA 1J1DA 4PDZA 5DKRA 1ALWA 3DVKA 4ETOA 4ZCVA 1JF0A 1UHIA 1SL8A 1BU3A 4WQ3A 1XK4C 4MZLA 1YRUB 2M9GA 1KFUL 1Y6WA 1NIWA 2LANA 2CNPA 1XFYO 2KI6C 2L51A 5F6TA 3I5FC 1B7TY 1BR1B 1BR4B 2NCPA 1MQ1A 2JNFA 1S1EA 3JTDC 4JWQA 4OVNF 1RROA 4I5NB 1IQ3A 1B8LA 1K9KA 3ZNIA 4JQ0D 4PHJA 3ZWHA 4CPVA 2PVBA 2L4IA 2JT8A 1K90D 4YGBB 1GJYA 4L9MA 3EK8A 2R2IA 3E3RA 4YBHB 5K89A 5CSNA 2F3YA 1L2OC 3EK4A 3SG3A 1J7QA 3ICBA 3LL8B 3DF0B 2L50A 1XFUO 1SRAA 1UWOA 2K61A 3GK4X 3PSRA 2WCBA 4OR9B 1N2DA 1F71A 1BT6A 3TDUA 1CMGA 1QASA 2M1KB 1GQMA 1CFPA 1TRFA 3CR4X 1NCZA 2JNXA 4USLA 5HYDA 2JXLA 1WLZA 4XJKB 1B4CA 5TNCA 2EHBA 2BL0C 2LMTA 3MSEB 4HRGA 2JTTA 4MRYA 1A03A 1QLSA 3TUYB 2LAPA 2ZFDA 2KOTA 1CLMA 3I5IB 5AFPA 1VRKA 3OB1B 2NXQA 4YGAA 3EKJA 1CLLA 1LA0A 1Y1XA 1SL7A 2KQ6A 3KEVA 2KAVA 1J7OA 4M2OA 2I94A 4PE0A 1G8IA 1SCVA 2KFGA 5HKWA 3VRPA 5GQQC 1CMFA 2GGZA 4F0ZB 1DJXA 3WNXB 1XFWO 3BUMB 3BUOB 1KSOA 5PALA 1TIZA 3VRNA 1BF5A 1KQMB 1R2UA 1BG1A 1IKUA 1MHOA 4PHNA 2BE4A 2MBXA 1K93D 1QIVA 1WDCB 2Y5IA 2LC5A 1YX7A 1JC2A 1XO5A 1S5GZ 4PE4A 1TNXA 1U5IA 1DTLA 1OMRA 3GK1A 1UURA 2EC6B 2NZ0A 4FTGA 1NX3A 5D7FA 4MEWA 1XFZO 2HETA 1ZACA 1XFVO 1Q80A 4GBAA 3KPXA 1QVIZ 3KO0A 2KQYA 1FI5A 4AQJA 4ORAB 4Q04A 2KI6D 2L0PA 4HREE 2JT3A 2JU0A 4DUQA 1S36A 4DS7A 4GGFA 3PN7C 1AJ4A 2HQWA 3TS5C 3IQOA 1IH0A 2LP2A 1JSAA 1YTZC 4C0LA 1IGVA 2MA2A 1CB1A 2K7OA 2LHIA 3I5FB 1KWOC 4GGFC 1OOJA 3SJSA 1CDNA 1ZMZA 2KYFA 3JTDB 1TOPA 2SCPA 4QJ4B 4ORCB 5AANA 2ZN9A 4NDDA 4P2YB 2M97A 1S5GY 1K96A 1SL9A 2BECA 4ORBB 5CSIA 4P5OE 1OMVA 1MUXA 1WRLA 2Y1MA 4M2PA 1LKJA 4I5KA 1L2OB 4CLNA 3NXAA 1JFJA 3LLEA 2WOSA 1SMGA 2QACA 5BPJA 4WRIA
chains in the Genus database with same CATH superfamily
1K95A 2F2PA 1CDMA 5B8IB 4XYNA 1QVIY 2MAZA 1RJVA 3RM1A 3D74A 2E30A 4YI9A 5HLOA 4MBEA 2WCFA 2KI4C 3D73A 4HRHA 4OCIA 3PALA 3BUXB 3EVVA 1B8CA 3HCMA 2K0JA 3BOWA 1RWYA 1AK8A 2BL0B 2ERBA 3A4UB 3BJHA 3CZ2A 1IG5A 2V53A 1BODA 1FW4A 5KU1A 1CDLA 5HKYA 2Q4UA 4PALA 1GGZA 3EVRA 2GGMA 1DJYA 4PHMA 1PVBA 3I5HC 1OQPA 2P6BB 2OTGC 4OZDA 4ZCUA 2NLNA 4IL1A 1TNPA 1SPYA 2K2FA 1G4YR 3BYAA 2B1UA 1S3PA 3AAKA 2JXCA 2M49B 3JVTC 2K7DA 3O4YA 3S0GA 2F3ZA 4YGDB 1NPQA 4GAOA 2KGRA 2KAYA 1BLQA 2TN4A 1A75B 1F4OA 3VROA 4JPZB 1PSBA 1F55A 1GGWA 1SSEB 2BE6A 1LVCD 2L5XB 3IQQA 2JPOA 2CBLA 4GNKB 5CPVA 4FQOA 1TNWA 1CTRA 1QX7A 1R6PA 1EG3A 1N65A 1FF1A 1DELA 4PE1A 4DCKA 1IIOA 1ALVA 1Y0VH 3RZSA 4I5LB 2H2KA 1XFXO 1CM4A 3NSLA 1NP8A 2M0RA 3OP0A 3PFVA 2EGDA 1UHNA 2AUCA 1X02A 1PVAA 1SNLA 1E8AA 1IJ5A 2IS9A 4A4BA 4ICBA 4AOMA 1ZOTB 3WXAA 1QS7A 4JD9A 3FWCA 3NSIA 1UHKA 5KTYA 2FCEA 4PCWA 1CM1A 1KK7Z 5AEQA 2Y1NA 3S0DA 1CFFA 3NSOA 1F54A 2BBNA 3PLFB 1TUJA 3SS4A 1U5IB 3K1EA 5JJGA 3DVJA 1JBAA 1M46A 2LMUA 2CXJA 5DKQA 1QTXA 2JULA 3OX6A 3L4LA 1N0YA 1RFJA 2RGIA 3PN7B 2ISDA 1QWVA 1WRKA 3WHUB 3TDIA 5JOLA 1AHRA 1DVIA 1NCYA 3LK1A 3TS5B 2QEOA 2JQ6A 4U8DA 3SS5A 1XYDA 1ZUZA 1SCMC 4N5XA 1MF8B 1PALA 1P28A 2M7LA 3CLNA 2PALA 1JWDA 1KWOB 4PHKA 1OZSA 4WQ2A 4GUKA 3DY9A 1EH2A 1B8RA 2F8PA 4NDBA 3D76A 1Y1UA 2K8MB 1OE9B 4HSZA 3QRXA 2NCOA 2A4JA 1IQ3A 2LV7A 2AAOA 2KHNA 2I18A 4IJ7A 2LVKA 4UPGA 2KGBC 3FS7A 1KK7Y 1UHJA 5HKZA 3DXLA 3HX4A 2BAPA 3LK0A 4YRUA 1IJ6A 1S6CA 2KNEA 3IVTA 3CZTX 1J55A 1YVLA 1DF0A 1YUTA 3DVEA 2MHHA 1WY9A 1H4BA 3CR2A 1YVHA 1WRZA 2KI4B 1KFXS 1OZOA 2JZIA 2FCDA 3D0YA 1DJHA 1XVJA 4MVFA 3VRQA 2JPTA 2LLSA 1PULA 1K94A 2ZNDA 5CSJA 1NX0A 2COLB 1DGVA 5I2LA 1YR5A 2LUCA 4INXA 2O60A 5CSFA 4DIRA 3KHEA 1KK8B 3NGVA 4GFTA 5D69A 1YURA 1H8BA 3GK2A 3I5HB 1CFDA 1TCOB 2I7AA 3DVMA 1LXFC 2OTGB 3BOWB 3I5GC 2JWWA 3DD4A 2ZKMX 2LMVA 3PATA 1FI6A 1YRTB 4KYNA 1DGUA 1UUSA 1C3ZA 4N1GA 3JVTB 3SG2A 2ZRSA 1UP5A 3F45A 3M0WA 3N7HA 2JT0A 2LLUA 2K7CA 1DC1A 2LHLA 4OV2A 1IRJA 2PRUA 2SASA 1F70A 2L98A 3OB2B 2F2OA 1DJGA 3CGAA 1C3YA 1AVSA 2I2RE 2K7BA 4R1EA 4YGCB 1M31A 4MRXA 1V1FA 2M7NA 3B6XA 1WLMA 3AKBA 1KK8C 5FI2A 2K2AA 2ZNEA 4I5JA 5ER5A 1OW4A 1QV0A 5AERA 2HPSA 1IWQA 1SR6C 3NSKA 4PT1A 5ER4X 5FI6A 2F33A 2MLFC 1UHHA 3LCPC 1D1OA 2G2BA 1YUSA 2LNKA 3KF9A 1A2XA 1CFCA 1QJTA 2LUXA 1QV1A 4C0JA 4AQIA 1V1GA 3GOFA 2VRGA 1QX2A 2OS8C 2H8VA 5EL2A 1PRWA 3AKAA 4YI8A 2LM5A 2FJUB 3K21A 1AJ5A 1M39A 5KSZA 1EXRA 4N1FA 3CWGA 1OSAA 1SK6D 3BFHA 1AUIB 2WCKA 4CFRA 1KQVA 5I2QA 4BY4A 3AAJA 2M29A 1TNQA 1DJZA 3O4XA 3EVUA 3R72A 1QATA 5FYXA 4PE7A 1RK9A 3SG6A 2KFHA 1BJFA 1SBJA 2LLTA 3L47A 3VB1A 2H61A 1NX1A 2KBMA 3UNWA 1SCMB 3WHTB 1ZFSA 2LCPA 3B88A 1LA3A 4F7FA 3OX5A 2CT9A 1F8HA 1S6JA 3O78A 1B47A 1OMDA 1FBVA 2LVVA 3C1VA 2FJYA 3CR5X 2G9BA 2LE9B 2YGUA 4A4CA 1ODBA 2WCEA 1C7VA 2JRFA 2KDHA 2L4HA 2QDIA 2H61C 4DRWA 4NQGA 3BUNB 3SIBA 3CS1A 1EG4A 3A8RA 5DICA 1KCYA 1XA5A 4MSPA 2BBMA 2GV5A 3NHIA 4E68A 2WC5A 5I2OA 3O6BA 3S0FA 1J1EA 2WCMA 2PASA 3DF0A 4BY5A 3PM8A 1NUBA 2HQ8A 3TDZA 1DMOA 2JC2A 2JTZA 2MRDA 3CTNA 1SYMA 5IBWA 1MR8A 1G33A 1OOGA 2PSRA 2Q91A 1NX2A 4M2QA 1A75A 1FPWA 3BXKA 3H4SE 3D75A 3DYEA 1CKKA 3B86A 4XJKA 1AP4A 1KSMA 4CFQA 3SG7A 2LVIA 1J7RA 2BCAA 1IQ5A 3L4AA 1TN4A 2WC8A 2FOTA 1QIWA 1BMOA 3OBVA 3BUWB 4GGNA 3SS3A 3SG4A 3V2LA 1CLBA 1GM0A 2AMIA 2E6WA 1NCXA 2WORA 1DF0B 1MXLC 1YUUA 2HF5A 4MN0A 1MXEA 2Y4QA 4GPLB 2L2CA 1SKTA 2KYCA 1M63B 2BKIB 2L2EA 3FIAA 1SY9A 4D1EA 3D0YB 3SG5A 2KBIA 3EKHA 1JUOA 3OHMB 4NDCA 1S26D 4OKHA 3VRRA 2PQLA 5I8NA 2O5GA 3I5GB 1DT7B 3EG5B 3TUYC 3I5IC 3S0BA 1RECA 2ZN8A 3O2PA 1W7IB 2CCMA 1TTXA 1QXPA 2KFFA 2MJWB 1K8UA 1HQVA 1PK0D 1QLKA 3D10A 2D8NA 1K9PA 3B7AA 3RLZA 1NSHA 1PSRA 1S6IA 1CNPA 3VGOA 1HT9A 1NWDA 1L7ZA 1B1GA 2QPTA 3TZ1A 1J7PA 1DJWA 3EK7A 1BOCA 4MLWA 4CIDA 2BKHB 2M8UA 2M1UA 3CABA 5HL1A 3IF7A 1TUZA 3FWBA 1LINA 3S0AA 4QJ5B 1TCFA 5AXIA 1EJ3A 2KAXA 1KQMC 1C07A 1B9AA 1B7TZ 1F4QA 1A29A 2KLDA 2OPOA 4MZJA 1SR6B 1MWNA 3S0EA 1KFUS 4FQTA 1K9UA 2PYQA 3UO9A 1CDPA 1K2HA 5HLVA 1W7JB 1WDCC 1Y1AA 3PJIA 4YGEB 3FE6A 1YX8A 1T14A 3DZTA 2BCXA 2OS8B 5DKNA 5G08A 2EC6C 2CTNA 2LP3A 3SIAA 5FI7A 1RTP1 3CZ0A 2LVJA 5J3XA 2JOJA 1JFKA 1SW8A 2M3WA 2WNDA 4TNCA 1NYAA 4C0KA 1DJIA 2DOQA 1OOIX 2ZRTA 1EL4A 1C7WA 2MLEC 3Q8IA 1KFXL 3D77A 3R1OA 2BCBA 1XK4A 2WCJA 3BQ3A 2KSPA 1A4PA 1QX5B 1W9ZA 2PMYA 1JF2A 4QJ3B 1M45A 4MZKA 1J1DA 3R1VA 4PDZA 5DKRA 1ALWA 1OOFA 3DVKA 4ETOA 4ZCVA 1ORGA 3CZ1A 1JF0A 1UHIA 1SL8A 1BU3A 4WQ3A 1XK4C 2QEBA 4MZLA 1YRUB 2M9GA 1KFUL 1Y6WA 1NIWA 2LANA 2CNPA 1XFYO 2KI6C 2L51A 5F6TA 3I5FC 3OGNA 1B7TY 1BR1B 2BNXA 1BR4B 2NCPA 1MQ1A 2JNFA 1S1EA 3JTDC 3D78A 4JWQA 1RROA 3QMEA 4I5NB 4OVNF 1B8LA 1K9KA 3ZNIA 4JQ0D 4PHJA 3ZWHA 4CPVA 2PVBA 2L4IA 2JT8A 2KPHA 1K90D 4YGBB 1GJYA 3FE9A 4L9MA 3EK8A 2R2IA 3E3RA 4YBHB 5K89A 5CSNA 2F3YA 1L2OC 3EK4A 3SG3A 1J7QA 3ICBA 3LL8B 3DF0B 2L50A 1XFUO 1SRAA 1UWOA 2K61A 3GK4X 3PSRA 2KLEA 2WCBA 1N2DA 4OR9B 1F71A 1BT6A 3TDUA 1CMGA 1Z2CB 1QASA 2M1KB 1GQMA 1CFPA 1TRFA 3CR4X 1NCZA 2JNXA 4USLA 5HYDA 2JXLA 1WLZA 4XJKB 1B4CA 5TNCA 2EHBA 2BL0C 2LMTA 3MSEB 3BFAA 2JTTA 4HRGA 4MRYA 3CYZA 3NHTA 1A03A 1QLSA 3TUYB 2LAPA 2ZFDA 2KOTA 1CLMA 3I5IB 5AFPA 1VRKA 3OB1B 2NXQA 4YGAA 3EKJA 1CLLA 1LA0A 1Y1XA 3B87A 1SL7A 2KQ6A 3KEVA 2KAVA 1J7OA 2QEHA 4M2OA 2I94A 4PE0A 2K60A 1G8IA 1SCVA 2KFGA 5HKWA 3VRPA 5GQQC 1CMFA 2GGZA 4F0ZB 1DJXA 3WNXB 1XFWO 3BUMB 3BUOB 1KSOA 5PALA 1TIZA 4INWA 3VRNA 1BF5A 1KQMB 1R2UA 1BG1A 1IKUA 1MHOA 4PHNA 2BE4A 2QEVA 2MBXA 5D3OA 2WCHA 1K93D 1QIVA 1WDCB 2Y5IA 2LC5A 1YX7A 1Z4HA 1JC2A 1XO5A 1S5GZ 1DQEA 4PE4A 1TNXA 1U5IA 1DTLA 1OMRA 3GK1A 1UURA 2EC6B 2NZ0A 4FTGA 1NX3A 1OOHA 5D7FA 2P71A 4MEWA 1XFZO 2WC6A 2HETA 1ZACA 2WCLA 1XFVO 1Q80A 4GBAA 3KPXA 1QVIZ 3KO0A 2KQYA 1FI5A 3PM2A 4AQJA 3CDNA 4ORAB 4Q04A 2KI6D 2L0PA 1LS8A 4HREE 2JT3A 2JU0A 4DUQA 1S36A 2GTEA 4DS7A 4GGFA 3PN7C 1AJ4A 2HQWA 2L5YA 3TS5C 3IQOA 1IH0A 2LP2A 2P70A 1JSAA 1YTZC 4C0LA 1IGVA 2MA2A 3R1PA 3FE8A 1CB1A 2K7OA 2LHIA 3I5FB 1KWOC 4GGFC 1OOJA 3SJSA 1CDNA 1DEKA 1ZMZA 2KYFA 3JTDB 1TOPA 1TWOA 2SCPA 4QJ4B 3BFBA 4ORCB 5AANA 2ZN9A 4NDDA 4P2YB 2M97A 1S5GY 1K96A 1SL9A 2BECA 4ORBB 5CSIA 4P5OE 1OMVA 1MUXA 1WRLA 1XFRA 2Y1MA 4JKTA 1LKJA 4I5KA 4M2PA 1L2OB 5I94A 4CLNA 3NXAA 1JFJA 3LLEA 2WOSA 1SMGA 2QACA 5BPJA 4WRIA
chains in the Genus database with same CATH topology
1K95A 2F2PA 1CDMA 5B8IB 4XYNA 1QVIY 2MAZA 1RJVA 3RM1A 2E30A 4YI9A 5HLOA 4MBEA 2WCFA 2KI4C 4OCIA 4HRHA 3PALA 3BUXB 3EVVA 1B8CA 3HCMA 2K0JA 3BOWA 1RWYA 1AK8A 2BL0B 3A4UB 1IG5A 2V53A 1BODA 1FW4A 5KU1A 1CDLA 5HKYA 2Q4UA 4PALA 1GGZA 3EVRA 2GGMA 1DJYA 4PHMA 1PVBA 3I5HC 1OQPA 2P6BB 2OTGC 4ZCUA 2NLNA 4IL1A 1TNPA 1SPYA 2K2FA 1G4YR 3BYAA 2B1UA 1S3PA 3AAKA 2JXCA 2M49B 3JVTC 2K7DA 3O4YA 2F3ZA 4YGDB 1NPQA 4GAOA 2KGRA 2KAYA 1BLQA 2TN4A 1A75B 1F4OA 3VROA 4JPZB 1PSBA 1F55A 1GGWA 2BE6A 2L5XB 1LVCD 3IQQA 2CBLA 4GNKB 5CPVA 4FQOA 1TNWA 1CTRA 1QX7A 1R6PA 1EG3A 1N65A 1FF1A 4PE1A 4DCKA 1ALVA 1Y0VH 4I5LB 2H2KA 1XFXO 1CM4A 3NSLA 1NP8A 2M0RA 3OP0A 3PFVA 2EGDA 1UHNA 2AUCA 1X02A 1PVAA 1SNLA 1E8AA 1IJ5A 2IS9A 4A4BA 4ICBA 4AOMA 1ZOTB 3WXAA 1QS7A 3FWCA 3NSIA 1UHKA 5KTYA 2FCEA 4PCWA 1CM1A 1KK7Z 5AEQA 2Y1NA 1CFFA 3NSOA 1F54A 2BBNA 3PLFB 1U5IB 5JJGA 3DVJA 1JBAA 1M46A 2LMUA 2CXJA 5DKQA 1QTXA 2JULA 3OX6A 1N0YA 1RFJA 2RGIA 3PN7B 2ISDA 3WHUB 1WRKA 3TDIA 5JOLA 1AHRA 1DVIA 1NCYA 3LK1A 3TS5B 2JQ6A 4U8DA 1XYDA 1ZUZA 1SCMC 4N5XA 1MF8B 1PALA 2M7LA 3CLNA 2PALA 1JWDA 1KWOB 4PHKA 1OZSA 4WQ2A 4GUKA 1EH2A 1B8RA 2F8PA 4NDBA 1Y1UA 2K8MB 1OE9B 4HSZA 3QRXA 2NCOA 2A4JA 2LV7A 2AAOA 2KHNA 2I18A 2LVKA 4UPGA 2KGBC 3FS7A 1KK7Y 1UHJA 5HKZA 3HX4A 3LK0A 4YRUA 1IJ6A 1S6CA 2KNEA 3CZTX 1J55A 1YVLA 1DF0A 1YUTA 3DVEA 2MHHA 1WY9A 1H4BA 3CR2A 1YVHA 1WRZA 2KI4B 1KFXS 1OZOA 2JZIA 2FCDA 3D0YA 1DJHA 1XVJA 4MVFA 3VRQA 2JPTA 2LLSA 1PULA 1K94A 2ZNDA 5CSJA 1NX0A 2COLB 1DGVA 5I2LA 1YR5A 2LUCA 2O60A 5CSFA 4DIRA 3KHEA 1KK8B 4GFTA 5D69A 1YURA 1H8BA 3GK2A 3I5HB 1CFDA 1TCOB 2I7AA 3DVMA 1LXFC 2OTGB 3BOWB 3I5GC 2JWWA 3DD4A 2ZKMX 2LMVA 3PATA 1FI6A 1YRTB 1DGUA 1UUSA 4N1GA 3JVTB 3SG2A 2ZRSA 1UP5A 3F45A 3M0WA 2JT0A 2LLUA 2K7CA 1F70A 2LHLA 4OV2A 1IRJA 2PRUA 2SASA 2L98A 3OB2B 2F2OA 1DJGA 3CGAA 1AVSA 2I2RE 2K7BA 4R1EA 4YGCB 1M31A 4MRXA 1V1FA 2M7NA 1WLMA 3AKBA 1KK8C 2K2AA 2ZNEA 4I5JA 5ER5A 1QV0A 5AERA 2HPSA 1IWQA 1SR6C 3NSKA 5ER4X 2F33A 2MLFC 1UHHA 3LCPC 1D1OA 2G2BA 1YUSA 2LNKA 3KF9A 1A2XA 1CFCA 1QJTA 2LUXA 1QV1A 4C0JA 4AQIA 1V1GA 3GOFA 2VRGA 1QX2A 2OS8C 1PRWA 3AKAA 4YI8A 2LM5A 2FJUB 3K21A 1AJ5A 1M39A 5KSZA 1EXRA 4N1FA 3CWGA 1OSAA 1SK6D 4CFRA 1AUIB 1KQVA 5I2QA 4BY4A 3AAJA 2M29A 1TNQA 1DJZA 3EVUA 5FYXA 1QATA 4PE7A 1RK9A 3SG6A 2KFHA 1BJFA 1SBJA 2LLTA 2H61A 1NX1A 2KBMA 1SCMB 3WHTB 1ZFSA 2LCPA 1LA3A 3OX5A 2CT9A 1F8HA 1S6JA 3O78A 1B47A 1OMDA 1FBVA 2LVVA 3C1VA 3CR5X 2G9BA 2LE9B 4A4CA 1ODBA 2WCEA 1C7VA 2JRFA 2KDHA 2L4HA 2H61C 4DRWA 4NQGA 3BUNB 3SIBA 3CS1A 1EG4A 3A8RA 1KCYA 1XA5A 4MSPA 2BBMA 2GV5A 4E68A 5I2OA 3O6BA 1J1EA 2PASA 3DF0A 4BY5A 3PM8A 1NUBA 2HQ8A 3TDZA 1DMOA 2JC2A 2JTZA 2MRDA 3CTNA 1SYMA 5IBWA 1MR8A 1G33A 2PSRA 2Q91A 1NX2A 4M2QA 1A75A 1FPWA 3BXKA 3H4SE 1CKKA 4XJKA 1AP4A 1KSMA 4CFQA 3SG7A 2LVIA 1J7RA 2BCAA 1IQ5A 4GGNA 1TN4A 2WC8A 2FOTA 1QIWA 1BMOA 3BUWB 3SG4A 1CLBA 2AMIA 2E6WA 1NCXA 2WORA 1DF0B 1MXLC 1YUUA 2HF5A 4MN0A 1MXEA 2Y4QA 4GPLB 1SKTA 2KYCA 1M63B 2BKIB 2L2EA 3FIAA 1SY9A 4D1EA 3D0YB 3SG5A 2KBIA 3EKHA 1JUOA 3OHMB 4NDCA 1S26D 4OKHA 3VRRA 5I8NA 2O5GA 3I5GB 1DT7B 3TUYC 3I5IC 1RECA 2ZN8A 3O2PA 1W7IB 2CCMA 1TTXA 1QXPA 2KFFA 2MJWB 1K8UA 1HQVA 1PK0D 1QLKA 3D10A 2D8NA 1K9PA 1CNPA 3RLZA 1NSHA 1PSRA 1S6IA 3VGOA 1HT9A 1NWDA 1L7ZA 1B1GA 2QPTA 3TZ1A 1J7PA 1DJWA 3EK7A 1BOCA 4MLWA 4CIDA 2BKHB 2M8UA 2M1UA 3IF7A 3FWBA 1LINA 4QJ5B 1TCFA 5AXIA 1EJ3A 2KAXA 1KQMC 1C07A 1B9AA 1B7TZ 1F4QA 1A29A 2OPOA 4MZJA 1SR6B 1MWNA 1KFUS 1K9UA 1K2HA 1CDPA 5HLVA 1W7JB 1WDCC 1Y1AA 4YGEB 1YX8A 2BCXA 2OS8B 5DKNA 5G08A 2EC6C 2CTNA 2LP3A 3SIAA 1RTP1 2LVJA 5J3XA 2JOJA 1JFKA 1SW8A 2M3WA 2WNDA 4TNCA 1NYAA 4C0KA 1DJIA 2DOQA 2ZRTA 1EL4A 1C7WA 2MLEC 1KFXL 2BCBA 1XK4A 3BQ3A 2KSPA 1A4PA 1QX5B 2PMYA 1JF2A 4QJ3B 1M45A 4MZKA 1J1DA 4PDZA 5DKRA 1ALWA 3DVKA 4ETOA 4ZCVA 1JF0A 1UHIA 1SL8A 1BU3A 4WQ3A 1XK4C 4MZLA 1YRUB 2M9GA 1KFUL 1Y6WA 1NIWA 2LANA 2CNPA 1XFYO 2KI6C 2L51A 5F6TA 3I5FC 1B7TY 1BR1B 1BR4B 2NCPA 1MQ1A 2JNFA 1S1EA 3JTDC 4JWQA 4OVNF 1RROA 4I5NB 1IQ3A 1B8LA 1K9KA 3ZNIA 4JQ0D 4PHJA 3ZWHA 4CPVA 2PVBA 2L4IA 2JT8A 1K90D 4YGBB 1GJYA 4L9MA 3EK8A 2R2IA 3E3RA 4YBHB 5K89A 5CSNA 2F3YA 1L2OC 3EK4A 3SG3A 1J7QA 3ICBA 3LL8B 3DF0B 2L50A 1XFUO 1SRAA 1UWOA 2K61A 3GK4X 3PSRA 2WCBA 4OR9B 1N2DA 1F71A 1BT6A 3TDUA 1CMGA 1QASA 2M1KB 1GQMA 1CFPA 1TRFA 3CR4X 1NCZA 2JNXA 4USLA 5HYDA 2JXLA 1WLZA 4XJKB 1B4CA 5TNCA 2EHBA 2BL0C 2LMTA 3MSEB 4HRGA 2JTTA 4MRYA 1A03A 1QLSA 3TUYB 2LAPA 2ZFDA 2KOTA 1CLMA 3I5IB 5AFPA 1VRKA 3OB1B 2NXQA 4YGAA 3EKJA 1CLLA 1LA0A 1Y1XA 1SL7A 2KQ6A 3KEVA 2KAVA 1J7OA 4M2OA 2I94A 4PE0A 1G8IA 1SCVA 2KFGA 5HKWA 3VRPA 5GQQC 1CMFA 2GGZA 4F0ZB 1DJXA 3WNXB 1XFWO 3BUMB 3BUOB 1KSOA 5PALA 1TIZA 3VRNA 1BF5A 1KQMB 1R2UA 1BG1A 1IKUA 1MHOA 4PHNA 2BE4A 2MBXA 1K93D 1QIVA 1WDCB 2Y5IA 2LC5A 1YX7A 1JC2A 1XO5A 1S5GZ 4PE4A 1TNXA 1U5IA 1DTLA 1OMRA 3GK1A 1UURA 2EC6B 2NZ0A 4FTGA 1NX3A 5D7FA 4MEWA 1XFZO 2HETA 1ZACA 1XFVO 1Q80A 4GBAA 3KPXA 1QVIZ 3KO0A 2KQYA 1FI5A 4AQJA 4ORAB 4Q04A 2KI6D 2L0PA 4HREE 2JT3A 2JU0A 4DUQA 1S36A 4DS7A 4GGFA 3PN7C 1AJ4A 2HQWA 3TS5C 3IQOA 1IH0A 2LP2A 1JSAA 1YTZC 4C0LA 1IGVA 2MA2A 1CB1A 2K7OA 2LHIA 3I5FB 1KWOC 4GGFC 1OOJA 3SJSA 1CDNA 1ZMZA 2KYFA 3JTDB 1TOPA 2SCPA 4QJ4B 4ORCB 5AANA 2ZN9A 4NDDA 4P2YB 2M97A 1S5GY 1K96A 1SL9A 2BECA 4ORBB 5CSIA 4P5OE 1OMVA 1MUXA 1WRLA 2Y1MA 4M2PA 1LKJA 4I5KA 1L2OB 4CLNA 3NXAA 1JFJA 3LLEA 2WOSA 1SMGA 2QACA 5BPJA 4WRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K95 A;  2F2P A;  1CDM A;  5B8I B;  4XYN A;  1QVI Y;  2MAZ A;  1RJV A;  3RM1 A;  2E30 A;  4YI9 A;  5HLO A;  4MBE A;  2WCF A;  2KI4 C;  4OCI A;  4HRH A;  3PAL A;  3BUX B;  3EVV A;  1B8C A;  3HCM A;  2K0J A;  3BOW A;  1RWY A;  1AK8 A;  2BL0 B;  3A4U B;  1IG5 A;  2V53 A;  1BOD A;  1FW4 A;  5KU1 A;  1CDL A;  5HKY A;  2Q4U A;  4PAL A;  1GGZ A;  3EVR A;  2GGM A;  1DJY A;  4PHM A;  1PVB A;  3I5H C;  1OQP A;  2P6B B;  2OTG C;  4ZCU A;  2NLN A;  4IL1 A;  1TNP A;  1SPY A;  2K2F A;  1G4Y R;  3BYA A;  2B1U A;  1S3P A;  3AAK A;  2JXC A;  2M49 B;  3JVT C;  2K7D A;  3O4Y A;  2F3Z A;  4YGD B;  1NPQ A;  4GAO A;  2KGR A;  2KAY A;  1BLQ A;  2TN4 A;  1A75 B;  1F4O A;  3VRO A;  4JPZ B;  1PSB A;  1F55 A;  1GGW A;  2BE6 A;  2L5X B;  1LVC D;  3IQQ A;  2CBL A;  4GNK B;  5CPV A;  4FQO A;  1TNW A;  1CTR A;  1QX7 A;  1R6P A;  1EG3 A;  1N65 A;  1FF1 A;  4PE1 A;  4DCK A;  1ALV A;  1Y0V H;  4I5L B;  2H2K A;  1XFX O;  1CM4 A;  3NSL A;  1NP8 A;  2M0R A;  3OP0 A;  3PFV A;  2EGD A;  1UHN A;  2AUC A;  1X02 A;  1PVA A;  1SNL A;  1E8A A;  1IJ5 A;  2IS9 A;  4A4B A;  4ICB A;  4AOM A;  1ZOT B;  3WXA A;  1QS7 A;  3FWC A;  3NSI A;  1UHK A;  5KTY A;  2FCE A;  4PCW A;  1CM1 A;  1KK7 Z;  5AEQ A;  2Y1N A;  1CFF A;  3NSO A;  1F54 A;  2BBN A;  3PLF B;  1U5I B;  5JJG A;  3DVJ A;  1JBA A;  1M46 A;  2LMU A;  2CXJ A;  5DKQ A;  1QTX A;  2JUL A;  3OX6 A;  1N0Y A;  1RFJ A;  2RGI A;  3PN7 B;  2ISD A;  3WHU B;  1WRK A;  3TDI A;  5JOL A;  1AHR A;  1DVI A;  1NCY A;  3LK1 A;  3TS5 B;  2JQ6 A;  4U8D A;  1XYD A;  1ZUZ A;  1SCM C;  4N5X A;  1MF8 B;  1PAL A;  2M7L A;  3CLN A;  2PAL A;  1JWD A;  1KWO B;  4PHK A;  1OZS A;  4WQ2 A;  4GUK A;  1EH2 A;  1B8R A;  2F8P A;  4NDB A;  1Y1U A;  2K8M B;  1OE9 B;  4HSZ A;  3QRX A;  2NCO A;  2A4J A;  2LV7 A;  2AAO A;  2KHN A;  2I18 A;  2LVK A;  4UPG A;  2KGB C;  3FS7 A;  1KK7 Y;  1UHJ A;  5HKZ A;  3HX4 A;  3LK0 A;  4YRU A;  1IJ6 A;  1S6C A;  2KNE A;  3CZT X;  1J55 A;  1YVL A;  1DF0 A;  1YUT A;  3DVE A;  2MHH A;  1WY9 A;  1H4B A;  3CR2 A;  1YVH A;  1WRZ A;  2KI4 B;  1KFX S;  1OZO A;  2JZI A;  2FCD A;  3D0Y A;  1DJH A;  1XVJ A;  4MVF A;  3VRQ A;  2JPT A;  2LLS A;  1PUL A;  1K94 A;  2ZND A;  5CSJ A;  1NX0 A;  2COL B;  1DGV A;  5I2L A;  1YR5 A;  2LUC A;  2O60 A;  5CSF A;  4DIR A;  3KHE A;  1KK8 B;  4GFT A;  5D69 A;  1YUR A;  1H8B A;  3GK2 A;  3I5H B;  1CFD A;  1TCO B;  2I7A A;  3DVM A;  1LXF C;  2OTG B;  3BOW B;  3I5G C;  2JWW A;  3DD4 A;  2ZKM X;  2LMV A;  3PAT A;  1FI6 A;  1YRT B;  1DGU A;  1UUS A;  4N1G A;  3JVT B;  3SG2 A;  2ZRS A;  1UP5 A;  3F45 A;  3M0W A;  2JT0 A;  2LLU A;  2K7C A;  1F70 A;  2LHL A;  4OV2 A;  1IRJ A;  2PRU A;  2SAS A;  2L98 A;  3OB2 B;  2F2O A;  1DJG A;  3CGA A;  1AVS A;  2I2R E;  2K7B A;  4R1E A;  4YGC B;  1M31 A;  4MRX A;  1V1F A;  2M7N A;  1WLM A;  3AKB A;  1KK8 C;  2K2A A;  2ZNE A;  4I5J A;  5ER5 A;  1QV0 A;  5AER A;  2HPS A;  1IWQ A;  1SR6 C;  3NSK A;  5ER4 X;  2F33 A;  2MLF C;  1UHH A;  3LCP C;  1D1O A;  2G2B A;  1YUS A;  2LNK A;  3KF9 A;  1A2X A;  1CFC A;  1QJT A;  2LUX A;  1QV1 A;  4C0J A;  4AQI A;  1V1G A;  3GOF A;  2VRG A;  1QX2 A;  2OS8 C;  1PRW A;  3AKA A;  4YI8 A;  2LM5 A;  2FJU B;  3K21 A;  1AJ5 A;  1M39 A;  5KSZ A;  1EXR A;  4N1F A;  3CWG A;  1OSA A;  1SK6 D;  4CFR A;  1AUI B;  1KQV A;  5I2Q A;  4BY4 A;  3AAJ A;  2M29 A;  1TNQ A;  1DJZ A;  3EVU A;  5FYX A;  1QAT A;  4PE7 A;  1RK9 A;  3SG6 A;  2KFH A;  1BJF A;  1SBJ A;  2LLT A;  2H61 A;  1NX1 A;  2KBM A;  1SCM B;  3WHT B;  1ZFS A;  2LCP A;  1LA3 A;  3OX5 A;  2CT9 A;  1F8H A;  1S6J A;  3O78 A;  1B47 A;  1OMD A;  1FBV A;  2LVV A;  3C1V A;  3CR5 X;  2G9B A;  2LE9 B;  4A4C A;  1ODB A;  2WCE A;  1C7V A;  2JRF A;  2KDH A;  2L4H A;  2H61 C;  4DRW A;  4NQG A;  3BUN B;  3SIB A;  3CS1 A;  1EG4 A;  3A8R A;  1KCY A;  1XA5 A;  4MSP A;  2BBM A;  2GV5 A;  4E68 A;  5I2O A;  3O6B A;  1J1E A;  2PAS A;  3DF0 A;  4BY5 A;  3PM8 A;  1NUB A;  2HQ8 A;  3TDZ A;  1DMO A;  2JC2 A;  2JTZ A;  2MRD A;  3CTN A;  1SYM A;  5IBW A;  1MR8 A;  1G33 A;  2PSR A;  2Q91 A;  1NX2 A;  4M2Q A;  1A75 A;  1FPW A;  3BXK A;  3H4S E;  1CKK A;  4XJK A;  1AP4 A;  1KSM A;  4CFQ A;  3SG7 A;  2LVI A;  1J7R A;  2BCA A;  1IQ5 A;  4GGN A;  1TN4 A;  2WC8 A;  2FOT A;  1QIW A;  1BMO A;  3BUW B;  3SG4 A;  1CLB A;  2AMI A;  2E6W A;  1NCX A;  2WOR A;  1DF0 B;  1MXL C;  1YUU A;  2HF5 A;  4MN0 A;  1MXE A;  2Y4Q A;  4GPL B;  1SKT A;  2KYC A;  1M63 B;  2BKI B;  2L2E A;  3FIA A;  1SY9 A;  4D1E A;  3D0Y B;  3SG5 A;  2KBI A;  3EKH A;  1JUO A;  3OHM B;  4NDC A;  1S26 D;  4OKH A;  3VRR A;  5I8N A;  2O5G A;  3I5G B;  1DT7 B;  3TUY C;  3I5I C;  1REC A;  2ZN8 A;  3O2P A;  1W7I B;  2CCM A;  1TTX A;  1QXP A;  2KFF A;  2MJW B;  1K8U A;  1HQV A;  1PK0 D;  1QLK A;  3D10 A;  2D8N A;  1K9P A;  1CNP A;  3RLZ A;  1NSH A;  1PSR A;  1S6I A;  3VGO A;  1HT9 A;  1NWD A;  1L7Z A;  1B1G A;  2QPT A;  3TZ1 A;  1J7P A;  1DJW A;  3EK7 A;  1BOC A;  4MLW A;  4CID A;  2BKH B;  2M8U A;  2M1U A;  3IF7 A;  3FWB A;  1LIN A;  4QJ5 B;  1TCF A;  5AXI A;  1EJ3 A;  2KAX A;  1KQM C;  1C07 A;  1B9A A;  1B7T Z;  1F4Q A;  1A29 A;  2OPO A;  4MZJ A;  1SR6 B;  1MWN A;  1KFU S;  1K9U A;  1K2H A;  1CDP A;  5HLV A;  1W7J B;  1WDC C;  1Y1A A;  4YGE B;  1YX8 A;  2BCX A;  2OS8 B;  5DKN A;  5G08 A;  2EC6 C;  2CTN A;  2LP3 A;  3SIA A;  1RTP 1;  2LVJ A;  5J3X A;  2JOJ A;  1JFK A;  1SW8 A;  2M3W A;  2WND A;  4TNC A;  1NYA A;  4C0K A;  1DJI A;  2DOQ A;  2ZRT A;  1EL4 A;  1C7W A;  2MLE C;  1KFX L;  2BCB A;  1XK4 A;  3BQ3 A;  2KSP A;  1A4P A;  1QX5 B;  2PMY A;  1JF2 A;  4QJ3 B;  1M45 A;  4MZK A;  1J1D A;  4PDZ A;  5DKR A;  1ALW A;  3DVK A;  4ETO A;  4ZCV A;  1JF0 A;  1UHI A;  1SL8 A;  1BU3 A;  4WQ3 A;  1XK4 C;  4MZL A;  1YRU B;  2M9G A;  1KFU L;  1Y6W A;  1NIW A;  2LAN A;  2CNP A;  1XFY O;  2KI6 C;  2L51 A;  5F6T A;  3I5F C;  1B7T Y;  1BR1 B;  1BR4 B;  2NCP A;  1MQ1 A;  2JNF A;  1S1E A;  3JTD C;  4JWQ A;  4OVN F;  1RRO A;  4I5N B;  1IQ3 A;  1B8L A;  1K9K A;  3ZNI A;  4JQ0 D;  4PHJ A;  3ZWH A;  4CPV A;  2PVB A;  2L4I A;  2JT8 A;  1K90 D;  4YGB B;  1GJY A;  4L9M A;  3EK8 A;  2R2I A;  3E3R A;  4YBH B;  5K89 A;  5CSN A;  2F3Y A;  1L2O C;  3EK4 A;  3SG3 A;  1J7Q A;  3ICB A;  3LL8 B;  3DF0 B;  2L50 A;  1XFU O;  1SRA A;  1UWO A;  2K61 A;  3GK4 X;  3PSR A;  2WCB A;  4OR9 B;  1N2D A;  1F71 A;  1BT6 A;  3TDU A;  1CMG A;  1QAS A;  2M1K B;  1GQM A;  1CFP A;  1TRF A;  3CR4 X;  1NCZ A;  2JNX A;  4USL A;  5HYD A;  2JXL A;  1WLZ A;  4XJK B;  1B4C A;  5TNC A;  2EHB A;  2BL0 C;  2LMT A;  3MSE B;  4HRG A;  2JTT A;  4MRY A;  1A03 A;  1QLS A;  3TUY B;  2LAP A;  2ZFD A;  2KOT A;  1CLM A;  3I5I B;  5AFP A;  1VRK A;  3OB1 B;  2NXQ A;  4YGA A;  3EKJ A;  1CLL A;  1LA0 A;  1Y1X A;  1SL7 A;  2KQ6 A;  3KEV A;  2KAV A;  1J7O A;  4M2O A;  2I94 A;  4PE0 A;  1G8I A;  1SCV A;  2KFG A;  5HKW A;  3VRP A;  5GQQ C;  1CMF A;  2GGZ A;  4F0Z B;  1DJX A;  3WNX B;  1XFW O;  3BUM B;  3BUO B;  1KSO A;  5PAL A;  1TIZ A;  3VRN A;  1BF5 A;  1KQM B;  1R2U A;  1BG1 A;  1IKU A;  1MHO A;  4PHN A;  2BE4 A;  2MBX A;  1K93 D;  1QIV A;  1WDC B;  2Y5I A;  2LC5 A;  1YX7 A;  1JC2 A;  1XO5 A;  1S5G Z;  4PE4 A;  1TNX A;  1U5I A;  1DTL A;  1OMR A;  3GK1 A;  1UUR A;  2EC6 B;  2NZ0 A;  4FTG A;  1NX3 A;  5D7F A;  4MEW A;  1XFZ O;  2HET A;  1ZAC A;  1XFV O;  1Q80 A;  4GBA A;  3KPX A;  1QVI Z;  3KO0 A;  2KQY A;  1FI5 A;  4AQJ A;  4ORA B;  4Q04 A;  2KI6 D;  2L0P A;  4HRE E;  2JT3 A;  2JU0 A;  4DUQ A;  1S36 A;  4DS7 A;  4GGF A;  3PN7 C;  1AJ4 A;  2HQW A;  3TS5 C;  3IQO A;  1IH0 A;  2LP2 A;  1JSA A;  1YTZ C;  4C0L A;  1IGV A;  2MA2 A;  1CB1 A;  2K7O A;  2LHI A;  3I5F B;  1KWO C;  4GGF C;  1OOJ A;  3SJS A;  1CDN A;  1ZMZ A;  2KYF A;  3JTD B;  1TOP A;  2SCP A;  4QJ4 B;  4ORC B;  5AAN A;  2ZN9 A;  4NDD A;  4P2Y B;  2M97 A;  1S5G Y;  1K96 A;  1SL9 A;  2BEC A;  4ORB B;  5CSI A;  4P5O E;  1OMV A;  1MUX A;  1WRL A;  2Y1M A;  4M2P A;  1LKJ A;  4I5K A;  1L2O B;  4CLN A;  3NXA A;  1JFJ A;  3LLE A;  2WOS A;  1SMG A;  2QAC A;  5BPJ A;  4WRI A; 
#chains in the Genus database with same CATH topology
 1K95 A;  2F2P A;  1CDM A;  5B8I B;  4XYN A;  1QVI Y;  2MAZ A;  1RJV A;  3RM1 A;  3D74 A;  2E30 A;  4YI9 A;  5HLO A;  4MBE A;  2WCF A;  2KI4 C;  3D73 A;  4HRH A;  4OCI A;  3PAL A;  3BUX B;  3EVV A;  1B8C A;  3HCM A;  2K0J A;  3BOW A;  1RWY A;  1AK8 A;  2BL0 B;  2ERB A;  3A4U B;  3BJH A;  3CZ2 A;  1IG5 A;  2V53 A;  1BOD A;  1FW4 A;  5KU1 A;  1CDL A;  5HKY A;  2Q4U A;  4PAL A;  1GGZ A;  3EVR A;  2GGM A;  1DJY A;  4PHM A;  1PVB A;  3I5H C;  1OQP A;  2P6B B;  2OTG C;  4OZD A;  4ZCU A;  2NLN A;  4IL1 A;  1TNP A;  1SPY A;  2K2F A;  1G4Y R;  3BYA A;  2B1U A;  1S3P A;  3AAK A;  2JXC A;  2M49 B;  3JVT C;  2K7D A;  3O4Y A;  3S0G A;  2F3Z A;  4YGD B;  1NPQ A;  4GAO A;  2KGR A;  2KAY A;  1BLQ A;  2TN4 A;  1A75 B;  1F4O A;  3VRO A;  4JPZ B;  1PSB A;  1F55 A;  1GGW A;  1SSE B;  2BE6 A;  1LVC D;  2L5X B;  3IQQ A;  2JPO A;  2CBL A;  4GNK B;  5CPV A;  4FQO A;  1TNW A;  1CTR A;  1QX7 A;  1R6P A;  1EG3 A;  1N65 A;  1FF1 A;  1DEL A;  4PE1 A;  4DCK A;  1IIO A;  1ALV A;  1Y0V H;  3RZS A;  4I5L B;  2H2K A;  1XFX O;  1CM4 A;  3NSL A;  1NP8 A;  2M0R A;  3OP0 A;  3PFV A;  2EGD A;  1UHN A;  2AUC A;  1X02 A;  1PVA A;  1SNL A;  1E8A A;  1IJ5 A;  2IS9 A;  4A4B A;  4ICB A;  4AOM A;  1ZOT B;  3WXA A;  1QS7 A;  4JD9 A;  3FWC A;  3NSI A;  1UHK A;  5KTY A;  2FCE A;  4PCW A;  1CM1 A;  1KK7 Z;  5AEQ A;  2Y1N A;  3S0D A;  1CFF A;  3NSO A;  1F54 A;  2BBN A;  3PLF B;  1TUJ A;  3SS4 A;  1U5I B;  3K1E A;  5JJG A;  3DVJ A;  1JBA A;  1M46 A;  2LMU A;  2CXJ A;  5DKQ A;  1QTX A;  2JUL A;  3OX6 A;  3L4L A;  1N0Y A;  1RFJ A;  2RGI A;  3PN7 B;  2ISD A;  1QWV A;  1WRK A;  3WHU B;  3TDI A;  5JOL A;  1AHR A;  1DVI A;  1NCY A;  3LK1 A;  3TS5 B;  2QEO A;  2JQ6 A;  4U8D A;  3SS5 A;  1XYD A;  1ZUZ A;  1SCM C;  4N5X A;  1MF8 B;  1PAL A;  1P28 A;  2M7L A;  3CLN A;  2PAL A;  1JWD A;  1KWO B;  4PHK A;  1OZS A;  4WQ2 A;  4GUK A;  3DY9 A;  1EH2 A;  1B8R A;  2F8P A;  4NDB A;  3D76 A;  1Y1U A;  2K8M B;  1OE9 B;  4HSZ A;  3QRX A;  2NCO A;  2A4J A;  1IQ3 A;  2LV7 A;  2AAO A;  2KHN A;  2I18 A;  4IJ7 A;  2LVK A;  4UPG A;  2KGB C;  3FS7 A;  1KK7 Y;  1UHJ A;  5HKZ A;  3DXL A;  3HX4 A;  2BAP A;  3LK0 A;  4YRU A;  1IJ6 A;  1S6C A;  2KNE A;  3IVT A;  3CZT X;  1J55 A;  1YVL A;  1DF0 A;  1YUT A;  3DVE A;  2MHH A;  1WY9 A;  1H4B A;  3CR2 A;  1YVH A;  1WRZ A;  2KI4 B;  1KFX S;  1OZO A;  2JZI A;  2FCD A;  3D0Y A;  1DJH A;  1XVJ A;  4MVF A;  3VRQ A;  2JPT A;  2LLS A;  1PUL A;  1K94 A;  2ZND A;  5CSJ A;  1NX0 A;  2COL B;  1DGV A;  5I2L A;  1YR5 A;  2LUC A;  4INX A;  2O60 A;  5CSF A;  4DIR A;  3KHE A;  1KK8 B;  3NGV A;  4GFT A;  5D69 A;  1YUR A;  1H8B A;  3GK2 A;  3I5H B;  1CFD A;  1TCO B;  2I7A A;  3DVM A;  1LXF C;  2OTG B;  3BOW B;  3I5G C;  2JWW A;  3DD4 A;  2ZKM X;  2LMV A;  3PAT A;  1FI6 A;  1YRT B;  4KYN A;  1DGU A;  1UUS A;  1C3Z A;  4N1G A;  3JVT B;  3SG2 A;  2ZRS A;  1UP5 A;  3F45 A;  3M0W A;  3N7H A;  2JT0 A;  2LLU A;  2K7C A;  1DC1 A;  2LHL A;  4OV2 A;  1IRJ A;  2PRU A;  2SAS A;  1F70 A;  2L98 A;  3OB2 B;  2F2O A;  1DJG A;  3CGA A;  1C3Y A;  1AVS A;  2I2R E;  2K7B A;  4R1E A;  4YGC B;  1M31 A;  4MRX A;  1V1F A;  2M7N A;  3B6X A;  1WLM A;  3AKB A;  1KK8 C;  5FI2 A;  2K2A A;  2ZNE A;  4I5J A;  5ER5 A;  1OW4 A;  1QV0 A;  5AER A;  2HPS A;  1IWQ A;  1SR6 C;  3NSK A;  4PT1 A;  5ER4 X;  5FI6 A;  2F33 A;  2MLF C;  1UHH A;  3LCP C;  1D1O A;  2G2B A;  1YUS A;  2LNK A;  3KF9 A;  1A2X A;  1CFC A;  1QJT A;  2LUX A;  1QV1 A;  4C0J A;  4AQI A;  1V1G A;  3GOF A;  2VRG A;  1QX2 A;  2OS8 C;  2H8V A;  5EL2 A;  1PRW A;  3AKA A;  4YI8 A;  2LM5 A;  2FJU B;  3K21 A;  1AJ5 A;  1M39 A;  5KSZ A;  1EXR A;  4N1F A;  3CWG A;  1OSA A;  1SK6 D;  3BFH A;  1AUI B;  2WCK A;  4CFR A;  1KQV A;  5I2Q A;  4BY4 A;  3AAJ A;  2M29 A;  1TNQ A;  1DJZ A;  3O4X A;  3EVU A;  3R72 A;  1QAT A;  5FYX A;  4PE7 A;  1RK9 A;  3SG6 A;  2KFH A;  1BJF A;  1SBJ A;  2LLT A;  3L47 A;  3VB1 A;  2H61 A;  1NX1 A;  2KBM A;  3UNW A;  1SCM B;  3WHT B;  1ZFS A;  2LCP A;  3B88 A;  1LA3 A;  4F7F A;  3OX5 A;  2CT9 A;  1F8H A;  1S6J A;  3O78 A;  1B47 A;  1OMD A;  1FBV A;  2LVV A;  3C1V A;  2FJY A;  3CR5 X;  2G9B A;  2LE9 B;  2YGU A;  4A4C A;  1ODB A;  2WCE A;  1C7V A;  2JRF A;  2KDH A;  2L4H A;  2QDI A;  2H61 C;  4DRW A;  4NQG A;  3BUN B;  3SIB A;  3CS1 A;  1EG4 A;  3A8R A;  5DIC A;  1KCY A;  1XA5 A;  4MSP A;  2BBM A;  2GV5 A;  3NHI A;  4E68 A;  2WC5 A;  5I2O A;  3O6B A;  3S0F A;  1J1E A;  2WCM A;  2PAS A;  3DF0 A;  4BY5 A;  3PM8 A;  1NUB A;  2HQ8 A;  3TDZ A;  1DMO A;  2JC2 A;  2JTZ A;  2MRD A;  3CTN A;  1SYM A;  5IBW A;  1MR8 A;  1G33 A;  1OOG A;  2PSR A;  2Q91 A;  1NX2 A;  4M2Q A;  1A75 A;  1FPW A;  3BXK A;  3H4S E;  3D75 A;  3DYE A;  1CKK A;  3B86 A;  4XJK A;  1AP4 A;  1KSM A;  4CFQ A;  3SG7 A;  2LVI A;  1J7R A;  2BCA A;  1IQ5 A;  3L4A A;  1TN4 A;  2WC8 A;  2FOT A;  1QIW A;  1BMO A;  3OBV A;  3BUW B;  4GGN A;  3SS3 A;  3SG4 A;  3V2L A;  1CLB A;  1GM0 A;  2AMI A;  2E6W A;  1NCX A;  2WOR A;  1DF0 B;  1MXL C;  1YUU A;  2HF5 A;  4MN0 A;  1MXE A;  2Y4Q A;  4GPL B;  2L2C A;  1SKT A;  2KYC A;  1M63 B;  2BKI B;  2L2E A;  3FIA A;  1SY9 A;  4D1E A;  3D0Y B;  3SG5 A;  2KBI A;  3EKH A;  1JUO A;  3OHM B;  4NDC A;  1S26 D;  4OKH A;  3VRR A;  2PQL A;  5I8N A;  2O5G A;  3I5G B;  1DT7 B;  3EG5 B;  3TUY C;  3I5I C;  3S0B A;  1REC A;  2ZN8 A;  3O2P A;  1W7I B;  2CCM A;  1TTX A;  1QXP A;  2KFF A;  2MJW B;  1K8U A;  1HQV A;  1PK0 D;  1QLK A;  3D10 A;  2D8N A;  1K9P A;  3B7A A;  3RLZ A;  1NSH A;  1PSR A;  1S6I A;  1CNP A;  3VGO A;  1HT9 A;  1NWD A;  1L7Z A;  1B1G A;  2QPT A;  3TZ1 A;  1J7P A;  1DJW A;  3EK7 A;  1BOC A;  4MLW A;  4CID A;  2BKH B;  2M8U A;  2M1U A;  3CAB A;  5HL1 A;  3IF7 A;  1TUZ A;  3FWB A;  1LIN A;  3S0A A;  4QJ5 B;  1TCF A;  5AXI A;  1EJ3 A;  2KAX A;  1KQM C;  1C07 A;  1B9A A;  1B7T Z;  1F4Q A;  1A29 A;  2KLD A;  2OPO A;  4MZJ A;  1SR6 B;  1MWN A;  3S0E A;  1KFU S;  4FQT A;  1K9U A;  2PYQ A;  3UO9 A;  1CDP A;  1K2H A;  5HLV A;  1W7J B;  1WDC C;  1Y1A A;  3PJI A;  4YGE B;  3FE6 A;  1YX8 A;  1T14 A;  3DZT A;  2BCX A;  2OS8 B;  5DKN A;  5G08 A;  2EC6 C;  2CTN A;  2LP3 A;  3SIA A;  5FI7 A;  1RTP 1;  3CZ0 A;  2LVJ A;  5J3X A;  2JOJ A;  1JFK A;  1SW8 A;  2M3W A;  2WND A;  4TNC A;  1NYA A;  4C0K A;  1DJI A;  2DOQ A;  1OOI X;  2ZRT A;  1EL4 A;  1C7W A;  2MLE C;  3Q8I A;  1KFX L;  3D77 A;  3R1O A;  2BCB A;  1XK4 A;  2WCJ A;  3BQ3 A;  2KSP A;  1A4P A;  1QX5 B;  1W9Z A;  2PMY A;  1JF2 A;  4QJ3 B;  1M45 A;  4MZK A;  1J1D A;  3R1V A;  4PDZ A;  5DKR A;  1ALW A;  1OOF A;  3DVK A;  4ETO A;  4ZCV A;  1ORG A;  3CZ1 A;  1JF0 A;  1UHI A;  1SL8 A;  1BU3 A;  4WQ3 A;  1XK4 C;  2QEB A;  4MZL A;  1YRU B;  2M9G A;  1KFU L;  1Y6W A;  1NIW A;  2LAN A;  2CNP A;  1XFY O;  2KI6 C;  2L51 A;  5F6T A;  3I5F C;  3OGN A;  1B7T Y;  1BR1 B;  2BNX A;  1BR4 B;  2NCP A;  1MQ1 A;  2JNF A;  1S1E A;  3JTD C;  3D78 A;  4JWQ A;  1RRO A;  3QME A;  4I5N B;  4OVN F;  1B8L A;  1K9K A;  3ZNI A;  4JQ0 D;  4PHJ A;  3ZWH A;  4CPV A;  2PVB A;  2L4I A;  2JT8 A;  2KPH A;  1K90 D;  4YGB B;  1GJY A;  3FE9 A;  4L9M A;  3EK8 A;  2R2I A;  3E3R A;  4YBH B;  5K89 A;  5CSN A;  2F3Y A;  1L2O C;  3EK4 A;  3SG3 A;  1J7Q A;  3ICB A;  3LL8 B;  3DF0 B;  2L50 A;  1XFU O;  1SRA A;  1UWO A;  2K61 A;  3GK4 X;  3PSR A;  2KLE A;  2WCB A;  1N2D A;  4OR9 B;  1F71 A;  1BT6 A;  3TDU A;  1CMG A;  1Z2C B;  1QAS A;  2M1K B;  1GQM A;  1CFP A;  1TRF A;  3CR4 X;  1NCZ A;  2JNX A;  4USL A;  5HYD A;  2JXL A;  1WLZ A;  4XJK B;  1B4C A;  5TNC A;  2EHB A;  2BL0 C;  2LMT A;  3MSE B;  3BFA A;  2JTT A;  4HRG A;  4MRY A;  3CYZ A;  3NHT A;  1A03 A;  1QLS A;  3TUY B;  2LAP A;  2ZFD A;  2KOT A;  1CLM A;  3I5I B;  5AFP A;  1VRK A;  3OB1 B;  2NXQ A;  4YGA A;  3EKJ A;  1CLL A;  1LA0 A;  1Y1X A;  3B87 A;  1SL7 A;  2KQ6 A;  3KEV A;  2KAV A;  1J7O A;  2QEH A;  4M2O A;  2I94 A;  4PE0 A;  2K60 A;  1G8I A;  1SCV A;  2KFG A;  5HKW A;  3VRP A;  5GQQ C;  1CMF A;  2GGZ A;  4F0Z B;  1DJX A;  3WNX B;  1XFW O;  3BUM B;  3BUO B;  1KSO A;  5PAL A;  1TIZ A;  4INW A;  3VRN A;  1BF5 A;  1KQM B;  1R2U A;  1BG1 A;  1IKU A;  1MHO A;  4PHN A;  2BE4 A;  2QEV A;  2MBX A;  5D3O A;  2WCH A;  1K93 D;  1QIV A;  1WDC B;  2Y5I A;  2LC5 A;  1YX7 A;  1Z4H A;  1JC2 A;  1XO5 A;  1S5G Z;  1DQE A;  4PE4 A;  1TNX A;  1U5I A;  1DTL A;  1OMR A;  3GK1 A;  1UUR A;  2EC6 B;  2NZ0 A;  4FTG A;  1NX3 A;  1OOH A;  5D7F A;  2P71 A;  4MEW A;  1XFZ O;  2WC6 A;  2HET A;  1ZAC A;  2WCL A;  1XFV O;  1Q80 A;  4GBA A;  3KPX A;  1QVI Z;  3KO0 A;  2KQY A;  1FI5 A;  3PM2 A;  4AQJ A;  3CDN A;  4ORA B;  4Q04 A;  2KI6 D;  2L0P A;  1LS8 A;  4HRE E;  2JT3 A;  2JU0 A;  4DUQ A;  1S36 A;  2GTE A;  4DS7 A;  4GGF A;  3PN7 C;  1AJ4 A;  2HQW A;  2L5Y A;  3TS5 C;  3IQO A;  1IH0 A;  2LP2 A;  2P70 A;  1JSA A;  1YTZ C;  4C0L A;  1IGV A;  2MA2 A;  3R1P A;  3FE8 A;  1CB1 A;  2K7O A;  2LHI A;  3I5F B;  1KWO C;  4GGF C;  1OOJ A;  3SJS A;  1CDN A;  1DEK A;  1ZMZ A;  2KYF A;  3JTD B;  1TOP A;  1TWO A;  2SCP A;  4QJ4 B;  3BFB A;  4ORC B;  5AAN A;  2ZN9 A;  4NDD A;  4P2Y B;  2M97 A;  1S5G Y;  1K96 A;  1SL9 A;  2BEC A;  4ORB B;  5CSI A;  4P5O E;  1OMV A;  1MUX A;  1WRL A;  1XFR A;  2Y1M A;  4JKT A;  1LKJ A;  4I5K A;  4M2P A;  1L2O B;  5I94 A;  4CLN A;  3NXA A;  1JFJ A;  3LLE A;  2WOS A;  1SMG A;  2QAC A;  5BPJ A;  4WRI A; 
#chains in the Genus database with same CATH homology
 1K95 A;  2F2P A;  1CDM A;  5B8I B;  4XYN A;  1QVI Y;  2MAZ A;  1RJV A;  3RM1 A;  2E30 A;  4YI9 A;  5HLO A;  4MBE A;  2WCF A;  2KI4 C;  4OCI A;  4HRH A;  3PAL A;  3BUX B;  3EVV A;  1B8C A;  3HCM A;  2K0J A;  3BOW A;  1RWY A;  1AK8 A;  2BL0 B;  3A4U B;  1IG5 A;  2V53 A;  1BOD A;  1FW4 A;  5KU1 A;  1CDL A;  5HKY A;  2Q4U A;  4PAL A;  1GGZ A;  3EVR A;  2GGM A;  1DJY A;  4PHM A;  1PVB A;  3I5H C;  1OQP A;  2P6B B;  2OTG C;  4ZCU A;  2NLN A;  4IL1 A;  1TNP A;  1SPY A;  2K2F A;  1G4Y R;  3BYA A;  2B1U A;  1S3P A;  3AAK A;  2JXC A;  2M49 B;  3JVT C;  2K7D A;  3O4Y A;  2F3Z A;  4YGD B;  1NPQ A;  4GAO A;  2KGR A;  2KAY A;  1BLQ A;  2TN4 A;  1A75 B;  1F4O A;  3VRO A;  4JPZ B;  1PSB A;  1F55 A;  1GGW A;  2BE6 A;  2L5X B;  1LVC D;  3IQQ A;  2CBL A;  4GNK B;  5CPV A;  4FQO A;  1TNW A;  1CTR A;  1QX7 A;  1R6P A;  1EG3 A;  1N65 A;  1FF1 A;  4PE1 A;  4DCK A;  1ALV A;  1Y0V H;  4I5L B;  2H2K A;  1XFX O;  1CM4 A;  3NSL A;  1NP8 A;  2M0R A;  3OP0 A;  3PFV A;  2EGD A;  1UHN A;  2AUC A;  1X02 A;  1PVA A;  1SNL A;  1E8A A;  1IJ5 A;  2IS9 A;  4A4B A;  4ICB A;  4AOM A;  1ZOT B;  3WXA A;  1QS7 A;  3FWC A;  3NSI A;  1UHK A;  5KTY A;  2FCE A;  4PCW A;  1CM1 A;  1KK7 Z;  5AEQ A;  2Y1N A;  1CFF A;  3NSO A;  1F54 A;  2BBN A;  3PLF B;  1U5I B;  5JJG A;  3DVJ A;  1JBA A;  1M46 A;  2LMU A;  2CXJ A;  5DKQ A;  1QTX A;  2JUL A;  3OX6 A;  1N0Y A;  1RFJ A;  2RGI A;  3PN7 B;  2ISD A;  3WHU B;  1WRK A;  3TDI A;  5JOL A;  1AHR A;  1DVI A;  1NCY A;  3LK1 A;  3TS5 B;  2JQ6 A;  4U8D A;  1XYD A;  1ZUZ A;  1SCM C;  4N5X A;  1MF8 B;  1PAL A;  2M7L A;  3CLN A;  2PAL A;  1JWD A;  1KWO B;  4PHK A;  1OZS A;  4WQ2 A;  4GUK A;  1EH2 A;  1B8R A;  2F8P A;  4NDB A;  1Y1U A;  2K8M B;  1OE9 B;  4HSZ A;  3QRX A;  2NCO A;  2A4J A;  2LV7 A;  2AAO A;  2KHN A;  2I18 A;  2LVK A;  4UPG A;  2KGB C;  3FS7 A;  1KK7 Y;  1UHJ A;  5HKZ A;  3HX4 A;  3LK0 A;  4YRU A;  1IJ6 A;  1S6C A;  2KNE A;  3CZT X;  1J55 A;  1YVL A;  1DF0 A;  1YUT A;  3DVE A;  2MHH A;  1WY9 A;  1H4B A;  3CR2 A;  1YVH A;  1WRZ A;  2KI4 B;  1KFX S;  1OZO A;  2JZI A;  2FCD A;  3D0Y A;  1DJH A;  1XVJ A;  4MVF A;  3VRQ A;  2JPT A;  2LLS A;  1PUL A;  1K94 A;  2ZND A;  5CSJ A;  1NX0 A;  2COL B;  1DGV A;  5I2L A;  1YR5 A;  2LUC A;  2O60 A;  5CSF A;  4DIR A;  3KHE A;  1KK8 B;  4GFT A;  5D69 A;  1YUR A;  1H8B A;  3GK2 A;  3I5H B;  1CFD A;  1TCO B;  2I7A A;  3DVM A;  1LXF C;  2OTG B;  3BOW B;  3I5G C;  2JWW A;  3DD4 A;  2ZKM X;  2LMV A;  3PAT A;  1FI6 A;  1YRT B;  1DGU A;  1UUS A;  4N1G A;  3JVT B;  3SG2 A;  2ZRS A;  1UP5 A;  3F45 A;  3M0W A;  2JT0 A;  2LLU A;  2K7C A;  1F70 A;  2LHL A;  4OV2 A;  1IRJ A;  2PRU A;  2SAS A;  2L98 A;  3OB2 B;  2F2O A;  1DJG A;  3CGA A;  1AVS A;  2I2R E;  2K7B A;  4R1E A;  4YGC B;  1M31 A;  4MRX A;  1V1F A;  2M7N A;  1WLM A;  3AKB A;  1KK8 C;  2K2A A;  2ZNE A;  4I5J A;  5ER5 A;  1QV0 A;  5AER A;  2HPS A;  1IWQ A;  1SR6 C;  3NSK A;  5ER4 X;  2F33 A;  2MLF C;  1UHH A;  3LCP C;  1D1O A;  2G2B A;  1YUS A;  2LNK A;  3KF9 A;  1A2X A;  1CFC A;  1QJT A;  2LUX A;  1QV1 A;  4C0J A;  4AQI A;  1V1G A;  3GOF A;  2VRG A;  1QX2 A;  2OS8 C;  1PRW A;  3AKA A;  4YI8 A;  2LM5 A;  2FJU B;  3K21 A;  1AJ5 A;  1M39 A;  5KSZ A;  1EXR A;  4N1F A;  3CWG A;  1OSA A;  1SK6 D;  4CFR A;  1AUI B;  1KQV A;  5I2Q A;  4BY4 A;  3AAJ A;  2M29 A;  1TNQ A;  1DJZ A;  3EVU A;  5FYX A;  1QAT A;  4PE7 A;  1RK9 A;  3SG6 A;  2KFH A;  1BJF A;  1SBJ A;  2LLT A;  2H61 A;  1NX1 A;  2KBM A;  1SCM B;  3WHT B;  1ZFS A;  2LCP A;  1LA3 A;  3OX5 A;  2CT9 A;  1F8H A;  1S6J A;  3O78 A;  1B47 A;  1OMD A;  1FBV A;  2LVV A;  3C1V A;  3CR5 X;  2G9B A;  2LE9 B;  4A4C A;  1ODB A;  2WCE A;  1C7V A;  2JRF A;  2KDH A;  2L4H A;  2H61 C;  4DRW A;  4NQG A;  3BUN B;  3SIB A;  3CS1 A;  1EG4 A;  3A8R A;  1KCY A;  1XA5 A;  4MSP A;  2BBM A;  2GV5 A;  4E68 A;  5I2O A;  3O6B A;  1J1E A;  2PAS A;  3DF0 A;  4BY5 A;  3PM8 A;  1NUB A;  2HQ8 A;  3TDZ A;  1DMO A;  2JC2 A;  2JTZ A;  2MRD A;  3CTN A;  1SYM A;  5IBW A;  1MR8 A;  1G33 A;  2PSR A;  2Q91 A;  1NX2 A;  4M2Q A;  1A75 A;  1FPW A;  3BXK A;  3H4S E;  1CKK A;  4XJK A;  1AP4 A;  1KSM A;  4CFQ A;  3SG7 A;  2LVI A;  1J7R A;  2BCA A;  1IQ5 A;  4GGN A;  1TN4 A;  2WC8 A;  2FOT A;  1QIW A;  1BMO A;  3BUW B;  3SG4 A;  1CLB A;  2AMI A;  2E6W A;  1NCX A;  2WOR A;  1DF0 B;  1MXL C;  1YUU A;  2HF5 A;  4MN0 A;  1MXE A;  2Y4Q A;  4GPL B;  1SKT A;  2KYC A;  1M63 B;  2BKI B;  2L2E A;  3FIA A;  1SY9 A;  4D1E A;  3D0Y B;  3SG5 A;  2KBI A;  3EKH A;  1JUO A;  3OHM B;  4NDC A;  1S26 D;  4OKH A;  3VRR A;  5I8N A;  2O5G A;  3I5G B;  1DT7 B;  3TUY C;  3I5I C;  1REC A;  2ZN8 A;  3O2P A;  1W7I B;  2CCM A;  1TTX A;  1QXP A;  2KFF A;  2MJW B;  1K8U A;  1HQV A;  1PK0 D;  1QLK A;  3D10 A;  2D8N A;  1K9P A;  1CNP A;  3RLZ A;  1NSH A;  1PSR A;  1S6I A;  3VGO A;  1HT9 A;  1NWD A;  1L7Z A;  1B1G A;  2QPT A;  3TZ1 A;  1J7P A;  1DJW A;  3EK7 A;  1BOC A;  4MLW A;  4CID A;  2BKH B;  2M8U A;  2M1U A;  3IF7 A;  3FWB A;  1LIN A;  4QJ5 B;  1TCF A;  5AXI A;  1EJ3 A;  2KAX A;  1KQM C;  1C07 A;  1B9A A;  1B7T Z;  1F4Q A;  1A29 A;  2OPO A;  4MZJ A;  1SR6 B;  1MWN A;  1KFU S;  1K9U A;  1K2H A;  1CDP A;  5HLV A;  1W7J B;  1WDC C;  1Y1A A;  4YGE B;  1YX8 A;  2BCX A;  2OS8 B;  5DKN A;  5G08 A;  2EC6 C;  2CTN A;  2LP3 A;  3SIA A;  1RTP 1;  2LVJ A;  5J3X A;  2JOJ A;  1JFK A;  1SW8 A;  2M3W A;  2WND A;  4TNC A;  1NYA A;  4C0K A;  1DJI A;  2DOQ A;  2ZRT A;  1EL4 A;  1C7W A;  2MLE C;  1KFX L;  2BCB A;  1XK4 A;  3BQ3 A;  2KSP A;  1A4P A;  1QX5 B;  2PMY A;  1JF2 A;  4QJ3 B;  1M45 A;  4MZK A;  1J1D A;  4PDZ A;  5DKR A;  1ALW A;  3DVK A;  4ETO A;  4ZCV A;  1JF0 A;  1UHI A;  1SL8 A;  1BU3 A;  4WQ3 A;  1XK4 C;  4MZL A;  1YRU B;  2M9G A;  1KFU L;  1Y6W A;  1NIW A;  2LAN A;  2CNP A;  1XFY O;  2KI6 C;  2L51 A;  5F6T A;  3I5F C;  1B7T Y;  1BR1 B;  1BR4 B;  2NCP A;  1MQ1 A;  2JNF A;  1S1E A;  3JTD C;  4JWQ A;  4OVN F;  1RRO A;  4I5N B;  1IQ3 A;  1B8L A;  1K9K A;  3ZNI A;  4JQ0 D;  4PHJ A;  3ZWH A;  4CPV A;  2PVB A;  2L4I A;  2JT8 A;  1K90 D;  4YGB B;  1GJY A;  4L9M A;  3EK8 A;  2R2I A;  3E3R A;  4YBH B;  5K89 A;  5CSN A;  2F3Y A;  1L2O C;  3EK4 A;  3SG3 A;  1J7Q A;  3ICB A;  3LL8 B;  3DF0 B;  2L50 A;  1XFU O;  1SRA A;  1UWO A;  2K61 A;  3GK4 X;  3PSR A;  2WCB A;  4OR9 B;  1N2D A;  1F71 A;  1BT6 A;  3TDU A;  1CMG A;  1QAS A;  2M1K B;  1GQM A;  1CFP A;  1TRF A;  3CR4 X;  1NCZ A;  2JNX A;  4USL A;  5HYD A;  2JXL A;  1WLZ A;  4XJK B;  1B4C A;  5TNC A;  2EHB A;  2BL0 C;  2LMT A;  3MSE B;  4HRG A;  2JTT A;  4MRY A;  1A03 A;  1QLS A;  3TUY B;  2LAP A;  2ZFD A;  2KOT A;  1CLM A;  3I5I B;  5AFP A;  1VRK A;  3OB1 B;  2NXQ A;  4YGA A;  3EKJ A;  1CLL A;  1LA0 A;  1Y1X A;  1SL7 A;  2KQ6 A;  3KEV A;  2KAV A;  1J7O A;  4M2O A;  2I94 A;  4PE0 A;  1G8I A;  1SCV A;  2KFG A;  5HKW A;  3VRP A;  5GQQ C;  1CMF A;  2GGZ A;  4F0Z B;  1DJX A;  3WNX B;  1XFW O;  3BUM B;  3BUO B;  1KSO A;  5PAL A;  1TIZ A;  3VRN A;  1BF5 A;  1KQM B;  1R2U A;  1BG1 A;  1IKU A;  1MHO A;  4PHN A;  2BE4 A;  2MBX A;  1K93 D;  1QIV A;  1WDC B;  2Y5I A;  2LC5 A;  1YX7 A;  1JC2 A;  1XO5 A;  1S5G Z;  4PE4 A;  1TNX A;  1U5I A;  1DTL A;  1OMR A;  3GK1 A;  1UUR A;  2EC6 B;  2NZ0 A;  4FTG A;  1NX3 A;  5D7F A;  4MEW A;  1XFZ O;  2HET A;  1ZAC A;  1XFV O;  1Q80 A;  4GBA A;  3KPX A;  1QVI Z;  3KO0 A;  2KQY A;  1FI5 A;  4AQJ A;  4ORA B;  4Q04 A;  2KI6 D;  2L0P A;  4HRE E;  2JT3 A;  2JU0 A;  4DUQ A;  1S36 A;  4DS7 A;  4GGF A;  3PN7 C;  1AJ4 A;  2HQW A;  3TS5 C;  3IQO A;  1IH0 A;  2LP2 A;  1JSA A;  1YTZ C;  4C0L A;  1IGV A;  2MA2 A;  1CB1 A;  2K7O A;  2LHI A;  3I5F B;  1KWO C;  4GGF C;  1OOJ A;  3SJS A;  1CDN A;  1ZMZ A;  2KYF A;  3JTD B;  1TOP A;  2SCP A;  4QJ4 B;  4ORC B;  5AAN A;  2ZN9 A;  4NDD A;  4P2Y B;  2M97 A;  1S5G Y;  1K96 A;  1SL9 A;  2BEC A;  4ORB B;  5CSI A;  4P5O E;  1OMV A;  1MUX A;  1WRL A;  2Y1M A;  4M2P A;  1LKJ A;  4I5K A;  1L2O B;  4CLN A;  3NXA A;  1JFJ A;  3LLE A;  2WOS A;  1SMG A;  2QAC A;  5BPJ A;  4WRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...