1J7QA

Solution structure and backbone dynamics of the defunct ef-hand domain of calcium vector protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
AAPKARALGPEEKDECMKIFDIFDRNAENIAPVSDTMDMLTKLGQTYTKRETEAIMKEARGPKGDKKNIGPEEWLTLCSKWVRQDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calcium Vector Protein
publication title Solution structure and backbone dynamics of the defunct domain of calcium vector protein.
pubmed doi rcsb
source organism Branchiostoma lanceolatum
total genus 21
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1j7qA00
1QASA 1QATA 1MQ1A 1RECA 2QPTA 3PM8A 1RJVA 5CSFA 2BBNA 1RWYA 3CR5X 2L2EA 1KFUL 1NPQA 1SMGA 1XK4A 3DF0B 4GAOA 2K7OA 3NXAA 1BODA 4I5NB 1OE9B 1MXEA 2KGBC 3I5FB 4MN0A 1K9UA 3D10A 1QIWA 1K9PA 1OMVA 1CDLA 1SBJA 1ALWA 2LAPA 5PALA 1NX1A 2JT0A 3AKBA 1KSOA 2F3YA 1CNPA 2H61A 4N1GA 5I2OA 4ZCVA 2ZN8A 1ALVA 1XO5A 2BCAA 1DGUA 1OMRA 1PSRA 1OQPA 2M3WA 1G4YR 5AXIA 2AAOA 3NSLA 4WRIA 4ORCB 2Y4QA 3QRXA 3SJSA 4MLWA 1AJ5A 3KF9A 4TNCA 1NP8A 2OTGB 4XJKA 1AK8A 4YGDB 1DF0B 1YVLA 1WY9A 4BY5A 3D0YB 2JULA 1BG1A 1EG4A 1SCVA 1CFFA 2K8MB 1EG3A 1K95A 1U5IA 4MBEA 3DVMA 4CFRA 2H2KA 1C7WA 1MHOA 2KDHA 2MJWB 3DVEA 2M7NA 2I94A 4QJ3B 2P6BB 1KFUS 1IWQA 5DKQA 4M2QA 2LVJA 4A4BA 3TUYC 1S6IA 2NCPA 2JU0A 4PHKA 4PE1A 1SL8A 1J7QA 3JTDC 3O4YA 2JNXA 2OS8B 4WQ3A 4NDCA 4HRGA 1B1GA 1YX7A 1SL7A 3SG7A 1EH2A 2CXJA 3SIAA 3WXAA 1CFCA 2KOTA 3TS5B 2D8NA 2KI6D 2A4JA 2WCEA 4OKHA 2BL0B 2FCDA 5F6TA 4MEWA 2KBMA 1SCMB 1UHIA 3LK0A 3NSIA 1PVAA 2K7BA 2LVKA 4PDZA 2JT8A 1CDMA 2KAVA 1QV0A 4ORBB 3ZNIA 2KFFA 1J1EA 3GK2A 5TNCA 1M63B 1M31A 4I5JA 1L2OC 2FOTA 2LLSA 3JVTB 3PN7C 1A75B 4I5KA 3GOFA 3MSEB 4AOMA 1S26D 2DOQA 1LA3A 5HKZA 5CPVA 1V1FA 2HQ8A 1QLSA 2JOJA 1BR4B 1TTXA 1YUTA 1UHHA 2CNPA 4YI9A 2AUCA 1MF8B 2LANA 1QXPA 4IL1A 3RM1A 1IH0A 3CZTX 2LMUA 4USLA 3EK7A 1BOCA 1PALA 2K2AA 1FI5A 3H4SE 1JWDA 1IG5A 1SNLA 1FF1A 1XFUO 1JF0A 1WRKA 2JXLA 2MBXA 1V1GA 1CMGA 1Y1UA 3I5IC 2E30A 4MRYA 1M45A 1B47A 2OPOA 4P2YB 2FJUB 3TDUA 3OB2B 4DCKA 1Q80A 1TOPA 1G33A 2E6WA 1UHJA 1HT9A 1TIZA 2MHHA 2WC8A 3AAKA 5CSJA 3PSRA 5I2QA 5IBWA 4PHJA 2M49B 1S36A 1SL9A 2M1KB 2PSRA 1KQVA 2BBMA 1N2DA 3BYAA 3ZWHA 1DJGA 5HYDA 1AP4A 4C0LA 3K21A 1XA5A 1YVHA 2L4IA 5BPJA 2GGMA 5JOLA 3HCMA 1K94A 3TUYB 2KQYA 1PRWA 2EHBA 2MLEC 2KYCA 4AQJA 3JTDB 5AEQA 3EVVA 1J55A 1B7TZ 1IKUA 1BLQA 1S1EA 1CM4A 4CIDA 1KSMA 4AQIA 1DMOA 1JUOA 2ZNEA 3BOWB 1RFJA 5AANA 4CFQA 4NQGA 2O60A 1LINA 1UHNA 2JTZA 4HSZA 4JQ0D 4GPLB 2ZKMX 1G8IA 1NYAA 3PFVA 1XFWO 2JPTA 1LVCD 1JC2A 1DF0A 1TN4A 1NWDA 3OB1B 1B9AA 1PK0D 1GQMA 5DKNA 5HKYA 1F71A 2JTTA 2Y5IA 1ZUZA 3DVJA 1KK7Y 5DKRA 4MZLA 1IQ3A 1F70A 3RLZA 1ZOTB 1L2OB 3SG2A 1RTP1 2KI4C 1GGWA 1S6JA 3PN7B 4FTGA 3CR2A 1WRLA 4GGFC 4CLNA 1QJTA 2GGZA 1NCYA 2L50A 2LVVA 2M1UA 2LLUA 2I2RE 4PE7A 3EKHA 3CWGA 1XYDA 1DGVA 1TNWA 1F54A 2GV5A 4I5LB 1CKKA 1CLBA 1C07A 2F2PA 4YBHB 1A29A 2I18A 4OVNF 1IJ6A 1PSBA 1A03A 1CLMA 2LV7A 2PVBA 1OSAA 1RROA 1YTZC 2LUXA 2KQ6A 5D69A 2M29A 1IRJA 1B8LA 4YGEB 3I5IB 2BCXA 4OR9B 2HPSA 1CFPA 5K89A 2R2IA 2LP2A 2V53A 1A75A 3PLFB 2LUCA 2SCPA 1BMOA 5KTYA 1W7IB 1WRZA 3WHTB 2PALA 2CTNA 3KHEA 2SASA 1NUBA 4PHNA 5ER5A 1OZOA 2L98A 1B7TY 2O5GA 4YGBB 4C0JA 3AAJA 1DJYA 1SKTA 1GJYA 1WDCC 2LMVA 1PVBA 3KPXA 2G2BA 3VRQA 2KBIA 2KYFA 1YURA 5HKWA 1Y6WA 1EXRA 2JRFA 1UUSA 1IQ5A 4NDBA 4Q04A 2ZRSA 2BKIB 1KK7Z 1R6PA 4PHMA 1ZMZA 1EJ3A 2PASA 2VRGA 4R1EA 2NXQA 1KWOC 1JBAA 1F4OA 1TRFA 2CBLA 3C1VA 2WORA 1AHRA 4GNKB 3CLNA 1KK8C 1W7JB 1TNPA 2MAZA 4M2PA 1C7VA 1XK4C 1HQVA 2L5XB 2FCEA 2CT9A 2F33A 2G9BA 3M0WA 1MWNA 2HQWA 1F55A 2RGIA 2K0JA 3PALA 1B8CA 3EKJA 1L7ZA 4PCWA 3TDIA 1XVJA 2KAYA 1IJ5A 1XFZO 2K7CA 1X02A 2K2FA 3HX4A 1A2XA 1TCOB 1ZFSA 2H61C 3O6BA 3VRNA 1YUSA 4GGNA 1Y0VH 1AVSA 1JFKA 2PMYA 2M7LA 1YUUA 2KI4B 1E8AA 1NX0A 3SG5A 1JFJA 1SK6D 1BJFA 1B8RA 1YX8A 4HREE 1CFDA 1DJHA 1LKJA 2WNDA 3KEVA 2ISDA 1NX3A 1H4BA 4ZCUA 2JT3A 3OX5A 3BUNB 3DF0A 1VRKA 1JSAA 2NZ0A 4C0KA 5AERA 1QTXA 1ZACA 1KFXL 2NLNA 4M2OA 1YRUB 3I5HB 3FWCA 1CTRA 2LHIA 1DVIA 1S5GZ 3CR4X 2KHNA 4UPGA 3AKAA 4P5OE 3VGOA 2HETA 3I5GC 2LMTA 1SY9A 3DD4A 4MRXA 4HRHA 1N0YA 3GK1A 1XFYO 1SRAA 3LLEA 4DRWA 4BY4A 1NCZA 1NCXA 1UHKA 2BCBA 1KQMC 3FS7A 1SR6B 1SW8A 3D0YA 3WNXB 4YRUA 1QX7A 1DJZA 1J7RA 1K96A 2F8PA 4FQOA 1CMFA 1FW4A 1M39A 5CSNA 4U8DA 4DUQA 3WHUB 4ETOA 1AUIB 1K93D 1TNQA 1WDCB 2KNEA 2L4HA 2M9GA 1KFXS 1YRTB 3LL8B 1Y1XA 1F8HA 1F4QA 1K90D 1BT6A 1FBVA 1QX5B 2EGDA 2LHLA 3O2PA 3A8RA 1KCYA 2HF5A 2JWWA 4L9MA 2F2OA 1KWOB 1FI6A 4E68A 1JF2A 1QVIZ 3I5HC 1KK8B 1NX2A 2K61A 1QV1A 4WQ2A 3ICBA 2COLB 1OOJA 2Q4UA 3CS1A 5JJGA 1B4CA 1QX2A 1R2UA 1MR8A 3DVKA 5CSIA 2ZFDA 1CDNA 2JNFA 3BQ3A 3FWBA 2CCMA 1PULA 1CM1A 4MZJA 2NCOA 3FIAA 3IQOA 1DJWA 1NIWA 2EC6B 2LNKA 1K9KA 4YGCB 3BXKA 1WLMA 1SR6C 1XFVO 2KFGA 2KI6C 1DJXA 1K2HA 1TCFA 5HLVA 3IF7A 2BE4A 2LVIA 2PRUA 2ZRTA 2LCPA 1S5GY 4XJKB 4MZKA 2M0RA 1BF5A 1NSHA 2Y1MA 2K7DA 3CGAA 4ORAB 2F3ZA 4GBAA 1U5IB 1CB1A 4QJ4B 3E3RA 3LCPC 1H8BA 3BUWB 1RK9A 2LE9B 2IS9A 1OZSA 3I5FC 4QJ5B 1EL4A 1BR1B 1OMDA 3EVRA 3IQQA 5HLOA 1IGVA 2JZIA 1GGZA 2JQ6A 3LK1A 3SG6A 2JXCA 2I7AA 3VROA 2LM5A 1FPWA 4PE0A 2L51A 1DTLA 3I5GB 1XFXO 4A4CA 5ER4X 2MRDA 1A4PA 4N1FA 5FYXA 1TNXA 1J7OA 3VRRA 3TDZA 1KQMB 3OX6A 2BE6A 4CPVA 1Y1AA 4GGFA 2OTGC 2BKHB 1SPYA 2MA2A 5AFPA 2TN4A 3SG3A 4GUKA 3SIBA 2QACA 3EK8A 2LC5A 3KO0A 3OP0A 3A4UB 4GFTA 5D7FA 1YR5A 1CDPA 2EC6C 2Q91A 5I8NA 4PE4A 3NSKA 1J7PA 1QVIY 1QS7A 1MXLC 2M8UA 2MLFC 3OHMB 2WOSA 4N5XA 3EVUA 1LA0A 4ICBA 2KSPA 2M97A 2KAXA 4MVFA 5I2LA 4OV2A 4F0ZB 2KGRA 3BOWA 2OS8C 1J1DA 2BECA 2KFHA 1WLZA 2WCBA 1AJ4A 2Y1NA 4PALA 4DS7A 1S6CA 5J3XA 4DIRA 1SYMA 2ZN9A 1D1OA 2AMIA 3BUMB 3CTNA 5GQQC 1QIVA 3TS5C 3SG4A 3NSOA 1BU3A 4XYNA 2BL0C 1UURA 3PATA 1UWOA 4OCIA 1CLLA 1SCMC 1DT7B 2LP3A 1UP5A 2JC2A 5KSZA 3BUXB 3O78A 4MSPA 1ODBA 2WCFA 4JPZB 3VRPA 5B8IB 4D1EA 1DJIA 4YGAA 1N65A 1M46A 2LLTA 3GK4X 5G08A 1LXFC 2B1UA 2ZNDA 1S3PA 3JVTC 1K8UA 1QLKA 5KU1A 4NDDA 3TZ1A 2L0PA 1MUXA 3BUOB 3F45A 4YI8A 4JWQA 3EK4A
chains in the Genus database with same CATH superfamily
1QASA 1QATA 4JKTA 1MQ1A 1RECA 2QPTA 3PM8A 1RJVA 3R1OA 5CSFA 2BBNA 1RWYA 1Z2CB 2L2EA 3CR5X 1KFUL 1NPQA 1SMGA 1XK4A 3DF0B 4GAOA 2K7OA 3NXAA 1BODA 4I5NB 1OE9B 1MXEA 2KGBC 3I5FB 4MN0A 1K9UA 3D10A 3R1VA 1QIWA 1K9PA 1OMVA 1CDLA 1DQEA 1ALWA 1SBJA 2LAPA 5PALA 3R1PA 1NX1A 2JT0A 3AKBA 1KSOA 2F3YA 1CNPA 1OOHA 2H61A 4N1GA 5I2OA 4ZCVA 2ZN8A 1ALVA 1XO5A 2BCAA 1DGUA 1OMRA 1PSRA 1OQPA 2M3WA 1G4YR 5AXIA 2AAOA 3NSLA 1DELA 4WRIA 4ORCB 2Y4QA 3QRXA 3SJSA 4MLWA 1OOFA 1AJ5A 3KF9A 4TNCA 1NP8A 2OTGB 2FJYA 4XJKA 4YGDB 5DICA 1DF0B 1AK8A 1YVLA 1WY9A 4BY5A 3D0YB 2JULA 1BG1A 1EG4A 1SCVA 1CFFA 3OBVA 2K8MB 1EG3A 1K95A 1U5IA 4MBEA 3DVMA 3SS3A 4CFRA 2H2KA 1C7WA 1MHOA 2KDHA 5FI6A 2MJWB 4F7FA 3DVEA 2M7NA 3L4AA 2I94A 1IIOA 4QJ3B 2P6BB 1KFUS 1IWQA 5DKQA 4M2QA 2LVJA 4A4BA 3TUYC 1S6IA 2NCPA 2JU0A 2P70A 4PHKA 4PE1A 1SL8A 1J7QA 3JTDC 3O4YA 1TUJA 2JNXA 2OS8B 4WQ3A 3D78A 4NDCA 4HRGA 1B1GA 1YX7A 3R72A 1SL7A 3SG7A 1EH2A 2CXJA 1T14A 3SIAA 3WXAA 1CFCA 2KOTA 3TS5B 2D8NA 2KI6D 3D76A 2A4JA 2WCEA 4OKHA 1TWOA 2BL0B 2FCDA 5F6TA 4MEWA 2KBMA 1SCMB 1UHIA 3LK0A 3NSIA 1PVAA 2K7BA 2LVKA 4PDZA 2JT8A 1CDMA 2KAVA 3B7AA 1QV0A 4ORBB 3ZNIA 3UO9A 2KFFA 1J1EA 3GK2A 4JD9A 5TNCA 3DYEA 1M63B 1M31A 4I5JA 1L2OC 2FOTA 2LLSA 3JVTB 3PN7C 1A75B 4I5KA 3GOFA 3MSEB 4AOMA 1S26D 2DOQA 1LA3A 2QEVA 5HKZA 5CPVA 1V1FA 2HQ8A 1QLSA 2JOJA 1BR4B 1TTXA 1YUTA 1UHHA 2CNPA 3PJIA 4YI9A 2AUCA 1MF8B 2LANA 1QXPA 4IL1A 2P71A 3RM1A 1IH0A 3CZTX 2LMUA 4USLA 3EK4A 3EK7A 1BOCA 1PALA 3NHIA 2K2AA 1FI5A 2BNXA 3H4SE 3K1EA 3BJHA 1JWDA 1IG5A 1SNLA 1FF1A 1XFUO 1JF0A 3CABA 1WRKA 2JXLA 3D74A 2MBXA 1V1GA 1CMGA 1Y1UA 3I5IC 2E30A 4MRYA 1M45A 1B47A 4OZDA 2OPOA 4P2YB 2FJUB 2GTEA 3TDUA 3OB2B 4DCKA 1Q80A 1TOPA 1G33A 2E6WA 1UHJA 1HT9A 1TIZA 2MHHA 2WC8A 3AAKA 5CSJA 3PSRA 5D3OA 5I2QA 5IBWA 2WCKA 4PHJA 2M49B 1GM0A 1S36A 1SL9A 2M1KB 2PSRA 3PM2A 1KQVA 2BBMA 1N2DA 3BYAA 3ZWHA 1DJGA 5HYDA 1AP4A 4C0LA 3K21A 1XA5A 1YVHA 2L4IA 5BPJA 2GGMA 5JOLA 3HCMA 1K94A 3TUYB 2KQYA 1PRWA 2EHBA 2MLEC 2KYCA 4AQJA 3JTDB 4FQTA 3EVVA 5AEQA 1J55A 1DEKA 1B7TZ 1IKUA 1BLQA 1S1EA 1CM4A 4CIDA 1KSMA 4AQIA 1DMOA 1JUOA 2ZNEA 3BOWB 1RFJA 3IVTA 5AANA 4CFQA 4NQGA 2O60A 1LINA 1UHNA 2JTZA 2QEOA 4HSZA 4JQ0D 4KYNA 4GPLB 2ZKMX 1G8IA 1NYAA 3PFVA 5FI7A 1XFWO 2JPTA 1LVCD 1JC2A 1DF0A 1TN4A 1NWDA 3OB1B 1B9AA 3O4XA 1PK0D 4YI8A 1GQMA 5DKNA 5HKYA 1F71A 3SS5A 2JTTA 2Y5IA 1ZUZA 3DVJA 1KK7Y 5DKRA 4MZLA 1IQ3A 1F70A 3RLZA 1ZOTB 2WCLA 1L2OB 3SG2A 1RTP1 2KI4C 1GGWA 1S6JA 3PN7B 4FTGA 3CR2A 1WRLA 4GGFC 4CLNA 1QJTA 2GGZA 1NCYA 2QEBA 2L50A 2LVVA 2M1UA 2LLUA 2I2RE 4PE7A 3EKHA 2KPHA 2PQLA 1XYDA 2QEHA 3CDNA 3CWGA 1DC1A 1DGVA 1TNWA 1F54A 1ORGA 2GV5A 4I5LB 3S0AA 1CKKA 1CLBA 2BAPA 2F2PA 1C07A 3NHTA 4YBHB 1A29A 2I18A 4OVNF 1IJ6A 1PSBA 1A03A 1CLMA 2LV7A 2PVBA 1OSAA 1RROA 1YTZC 2LUXA 2KQ6A 5D69A 2M29A 1IRJA 1B8LA 4YGEB 3I5IB 2BCXA 4OR9B 2HPSA 1CFPA 5K89A 2R2IA 1LS8A 2LP2A 2V53A 1A75A 3PLFB 2LUCA 2SCPA 1BMOA 5KTYA 1W7IB 1WRZA 3WHTB 2PALA 2CTNA 3KHEA 2SASA 1NUBA 3DXLA 4PHNA 5ER5A 1OZOA 2L98A 1B7TY 2O5GA 4YGBB 4C0JA 3AAJA 1DJYA 1SKTA 1GJYA 1WDCC 2LMVA 1PVBA 3KPXA 2G2BA 2K60A 3VRQA 2KBIA 2KYFA 3RZSA 1YURA 3DZTA 5HKWA 1Y6WA 1EXRA 2JRFA 1UUSA 1IQ5A 4NDBA 4Q04A 2ZRSA 2BKIB 1KK7Z 1R6PA 4PHMA 1ZMZA 1EJ3A 2PASA 2VRGA 4R1EA 1Z4HA 2NXQA 1KWOC 1JBAA 1F4OA 1TRFA 2CBLA 3C1VA 2WORA 1AHRA 4GNKB 3CLNA 1KK8C 1W7JB 1TNPA 2MAZA 4M2PA 4INXA 1XK4C 1C7VA 1HQVA 2L5XB 2FCEA 2CT9A 2F33A 2G9BA 3M0WA 1MWNA 2HQWA 1F55A 2RGIA 2K0JA 3PALA 1B8CA 3EKJA 1L7ZA 4PCWA 3TDIA 1XVJA 2KAYA 1IJ5A 1XFZO 2ERBA 2K7CA 1X02A 2K2FA 3HX4A 1A2XA 1TCOB 1ZFSA 2H61C 5FI2A 1JFJA 2YGUA 3O6BA 3VRNA 1YUSA 4GGNA 1Y0VH 3FE8A 1AVSA 1JFKA 2PMYA 2M7LA 1YUUA 2KI4B 3S0DA 1E8AA 1NX0A 3FE9A 1OW4A 3SG5A 3V2LA 1SK6D 1BJFA 1YX8A 1B8RA 4HREE 1CFDA 1DJHA 1LKJA 2WNDA 3KEVA 2ISDA 2KLEA 5HL1A 1NX3A 4IJ7A 1H4BA 4ZCUA 2JT3A 3OX5A 3BUNB 3DF0A 1VRKA 1JSAA 2NZ0A 4C0KA 5AERA 1QTXA 1ZACA 1KFXL 2NLNA 4M2OA 1YRUB 3I5HB 3FWCA 1CTRA 2LHIA 1DVIA 2PYQA 1S5GZ 3CR4X 2KHNA 4UPGA 3AKAA 4P5OE 3VGOA 2HETA 3I5GC 2LMTA 1SY9A 3DD4A 1OOGA 4MRXA 4HRHA 1N0YA 3GK1A 1XFYO 1SRAA 3LLEA 3VB1A 3L47A 4DRWA 4BY4A 1NCZA 1NCXA 1UHKA 2BCBA 1KQMC 3FS7A 1SR6B 1SW8A 3D0YA 1CDNA 3WNXB 4YRUA 1QX7A 1DJZA 1J7RA 1K96A 3SS4A 2F8PA 4FQOA 1CMFA 1FW4A 1M39A 1OOIX 5CSNA 4U8DA 4DUQA 3WHUB 4ETOA 1AUIB 1K93D 1TNQA 1WDCB 2KNEA 2L4HA 2M9GA 1KFXS 1YRTB 3LL8B 1Y1XA 1C3ZA 1F8HA 1F4QA 2WCHA 1SSEB 1K90D 1BT6A 1FBVA 1QX5B 2EGDA 2LHLA 3FE6A 3O2PA 3A8RA 1KCYA 2HF5A 2JWWA 4L9MA 2F2OA 1KWOB 1FI6A 4E68A 1JF2A 1QVIZ 3I5HC 1KK8B 1NX2A 2K61A 1C3YA 2WCJA 1QV1A 4WQ2A 3ICBA 3NGVA 2COLB 5EL2A 1OOJA 2Q4UA 3CS1A 5JJGA 1B4CA 1QX2A 1R2UA 1MR8A 3DVKA 5CSIA 2ZFDA 3S0BA 2JNFA 3BQ3A 3FWBA 3S0GA 2CCMA 1PULA 1CM1A 4MZJA 2KLDA 2NCOA 2WCMA 3FIAA 3IQOA 1DJWA 1NIWA 2EC6B 2LNKA 1K9KA 4YGCB 3BXKA 1WLMA 1SR6C 1XFVO 2KFGA 2KI6C 1DJXA 2QDIA 3S0FA 1K2HA 1TCFA 2WC6A 3BFBA 3IF7A 1P28A 2BE4A 2LVIA 2PRUA 2ZRTA 2LCPA 5HLVA 1S5GY 4XJKB 4MZKA 2M0RA 1BF5A 1NSHA 3BFAA 2Y1MA 2K7DA 3CGAA 4ORAB 2F3ZA 4GBAA 3N7HA 1U5IB 1CB1A 4QJ4B 3E3RA 3LCPC 1H8BA 3QMEA 3BUWB 1W9ZA 1RK9A 2LE9B 2IS9A 1OZSA 3I5FC 4QJ5B 1EL4A 1BR1B 1OMDA 3EVRA 3IQQA 5HLOA 3CZ2A 1IGVA 2JZIA 1GGZA 2JQ6A 3LK1A 3SG6A 2JXCA 2I7AA 3VROA 2LM5A 1FPWA 4PE0A 2L51A 1DTLA 3D77A 3I5GB 3CZ1A 1XFXO 4A4CA 5ER4X 3CZ0A 2MRDA 1A4PA 3S0EA 4N1FA 1QWVA 1TNXA 2L5YA 3DY9A 5FYXA 1J7OA 3VRRA 3TDZA 1KQMB 3OX6A 2BE6A 4CPVA 1Y1AA 3CYZA 4GGFA 2OTGC 2BKHB 1SPYA 2MA2A 5AFPA 2TN4A 1TUZA 3D75A 3SG3A 3L4LA 4GUKA 5I94A 3SIBA 2QACA 3EK8A 2LC5A 3KO0A 3OP0A 3A4UB 4GFTA 5D7FA 1YR5A 1CDPA 2EC6C 2Q91A 5I8NA 4PE4A 3NSKA 1J7PA 1QVIY 1QS7A 1MXLC 2M8UA 3OGNA 2MLFC 3OHMB 2WOSA 4N5XA 3EVUA 1LA0A 4ICBA 2KSPA 2M97A 2KAXA 4MVFA 5I2LA 4OV2A 4F0ZB 2KGRA 3BOWA 2OS8C 3EG5B 1J1DA 2BECA 2WC5A 2KFHA 1WLZA 2WCBA 1AJ4A 2Y1NA 3B88A 4PALA 1S6CA 5J3XA 4DIRA 4DS7A 1SYMA 2ZN9A 1D1OA 2AMIA 3BUMB 3B86A 3CTNA 1XFRA 5GQQC 1QIVA 3TS5C 3SG4A 3NSOA 1BU3A 4XYNA 2BL0C 1UURA 3PATA 3Q8IA 1UWOA 4OCIA 1CLLA 3B6XA 1SCMC 4PT1A 1DT7B 2LP3A 2L2CA 1UP5A 2JC2A 3D73A 4INWA 5KSZA 3BUXB 3O78A 4MSPA 1ODBA 2WCFA 4JPZB 3VRPA 5B8IB 4D1EA 1DJIA 4YGAA 1N65A 1M46A 2LLTA 3GK4X 5G08A 1LXFC 3UNWA 2B1UA 2ZNDA 1S3PA 3JVTC 1K8UA 1QLKA 5KU1A 3BFHA 4NDDA 3TZ1A 2L0PA 1MUXA 3BUOB 3F45A 2H8VA 3B87A 4JWQA 2JPOA
chains in the Genus database with same CATH topology
1QASA 1QATA 1MQ1A 1RECA 2QPTA 3PM8A 1RJVA 5CSFA 2BBNA 1RWYA 3CR5X 2L2EA 1KFUL 1NPQA 1SMGA 1XK4A 3DF0B 4GAOA 2K7OA 3NXAA 1BODA 4I5NB 1OE9B 1MXEA 2KGBC 3I5FB 4MN0A 1K9UA 3D10A 1QIWA 1K9PA 1OMVA 1CDLA 1SBJA 1ALWA 2LAPA 5PALA 1NX1A 2JT0A 3AKBA 1KSOA 2F3YA 1CNPA 2H61A 4N1GA 5I2OA 4ZCVA 2ZN8A 1ALVA 1XO5A 2BCAA 1DGUA 1OMRA 1PSRA 1OQPA 2M3WA 1G4YR 5AXIA 2AAOA 3NSLA 4WRIA 4ORCB 2Y4QA 3QRXA 3SJSA 4MLWA 1AJ5A 3KF9A 4TNCA 1NP8A 2OTGB 4XJKA 1AK8A 4YGDB 1DF0B 1YVLA 1WY9A 4BY5A 3D0YB 2JULA 1BG1A 1EG4A 1SCVA 1CFFA 2K8MB 1EG3A 1K95A 1U5IA 4MBEA 3DVMA 4CFRA 2H2KA 1C7WA 1MHOA 2KDHA 2MJWB 3DVEA 2M7NA 2I94A 4QJ3B 2P6BB 1KFUS 1IWQA 5DKQA 4M2QA 2LVJA 4A4BA 3TUYC 1S6IA 2NCPA 2JU0A 4PHKA 4PE1A 1SL8A 1J7QA 3JTDC 3O4YA 2JNXA 2OS8B 4WQ3A 4NDCA 4HRGA 1B1GA 1YX7A 1SL7A 3SG7A 1EH2A 2CXJA 3SIAA 3WXAA 1CFCA 2KOTA 3TS5B 2D8NA 2KI6D 2A4JA 2WCEA 4OKHA 2BL0B 2FCDA 5F6TA 4MEWA 2KBMA 1SCMB 1UHIA 3LK0A 3NSIA 1PVAA 2K7BA 2LVKA 4PDZA 2JT8A 1CDMA 2KAVA 1QV0A 4ORBB 3ZNIA 2KFFA 1J1EA 3GK2A 5TNCA 1M63B 1M31A 4I5JA 1L2OC 2FOTA 2LLSA 3JVTB 3PN7C 1A75B 4I5KA 3GOFA 3MSEB 4AOMA 1S26D 2DOQA 1LA3A 5HKZA 5CPVA 1V1FA 2HQ8A 1QLSA 2JOJA 1BR4B 1TTXA 1YUTA 1UHHA 2CNPA 4YI9A 2AUCA 1MF8B 2LANA 1QXPA 4IL1A 3RM1A 1IH0A 3CZTX 2LMUA 4USLA 3EK7A 1BOCA 1PALA 2K2AA 1FI5A 3H4SE 1JWDA 1IG5A 1SNLA 1FF1A 1XFUO 1JF0A 1WRKA 2JXLA 2MBXA 1V1GA 1CMGA 1Y1UA 3I5IC 2E30A 4MRYA 1M45A 1B47A 2OPOA 4P2YB 2FJUB 3TDUA 3OB2B 4DCKA 1Q80A 1TOPA 1G33A 2E6WA 1UHJA 1HT9A 1TIZA 2MHHA 2WC8A 3AAKA 5CSJA 3PSRA 5I2QA 5IBWA 4PHJA 2M49B 1S36A 1SL9A 2M1KB 2PSRA 1KQVA 2BBMA 1N2DA 3BYAA 3ZWHA 1DJGA 5HYDA 1AP4A 4C0LA 3K21A 1XA5A 1YVHA 2L4IA 5BPJA 2GGMA 5JOLA 3HCMA 1K94A 3TUYB 2KQYA 1PRWA 2EHBA 2MLEC 2KYCA 4AQJA 3JTDB 5AEQA 3EVVA 1J55A 1B7TZ 1IKUA 1BLQA 1S1EA 1CM4A 4CIDA 1KSMA 4AQIA 1DMOA 1JUOA 2ZNEA 3BOWB 1RFJA 5AANA 4CFQA 4NQGA 2O60A 1LINA 1UHNA 2JTZA 4HSZA 4JQ0D 4GPLB 2ZKMX 1G8IA 1NYAA 3PFVA 1XFWO 2JPTA 1LVCD 1JC2A 1DF0A 1TN4A 1NWDA 3OB1B 1B9AA 1PK0D 1GQMA 5DKNA 5HKYA 1F71A 2JTTA 2Y5IA 1ZUZA 3DVJA 1KK7Y 5DKRA 4MZLA 1IQ3A 1F70A 3RLZA 1ZOTB 1L2OB 3SG2A 1RTP1 2KI4C 1GGWA 1S6JA 3PN7B 4FTGA 3CR2A 1WRLA 4GGFC 4CLNA 1QJTA 2GGZA 1NCYA 2L50A 2LVVA 2M1UA 2LLUA 2I2RE 4PE7A 3EKHA 3CWGA 1XYDA 1DGVA 1TNWA 1F54A 2GV5A 4I5LB 1CKKA 1CLBA 1C07A 2F2PA 4YBHB 1A29A 2I18A 4OVNF 1IJ6A 1PSBA 1A03A 1CLMA 2LV7A 2PVBA 1OSAA 1RROA 1YTZC 2LUXA 2KQ6A 5D69A 2M29A 1IRJA 1B8LA 4YGEB 3I5IB 2BCXA 4OR9B 2HPSA 1CFPA 5K89A 2R2IA 2LP2A 2V53A 1A75A 3PLFB 2LUCA 2SCPA 1BMOA 5KTYA 1W7IB 1WRZA 3WHTB 2PALA 2CTNA 3KHEA 2SASA 1NUBA 4PHNA 5ER5A 1OZOA 2L98A 1B7TY 2O5GA 4YGBB 4C0JA 3AAJA 1DJYA 1SKTA 1GJYA 1WDCC 2LMVA 1PVBA 3KPXA 2G2BA 3VRQA 2KBIA 2KYFA 1YURA 5HKWA 1Y6WA 1EXRA 2JRFA 1UUSA 1IQ5A 4NDBA 4Q04A 2ZRSA 2BKIB 1KK7Z 1R6PA 4PHMA 1ZMZA 1EJ3A 2PASA 2VRGA 4R1EA 2NXQA 1KWOC 1JBAA 1F4OA 1TRFA 2CBLA 3C1VA 2WORA 1AHRA 4GNKB 3CLNA 1KK8C 1W7JB 1TNPA 2MAZA 4M2PA 1C7VA 1XK4C 1HQVA 2L5XB 2FCEA 2CT9A 2F33A 2G9BA 3M0WA 1MWNA 2HQWA 1F55A 2RGIA 2K0JA 3PALA 1B8CA 3EKJA 1L7ZA 4PCWA 3TDIA 1XVJA 2KAYA 1IJ5A 1XFZO 2K7CA 1X02A 2K2FA 3HX4A 1A2XA 1TCOB 1ZFSA 2H61C 3O6BA 3VRNA 1YUSA 4GGNA 1Y0VH 1AVSA 1JFKA 2PMYA 2M7LA 1YUUA 2KI4B 1E8AA 1NX0A 3SG5A 1JFJA 1SK6D 1BJFA 1B8RA 1YX8A 4HREE 1CFDA 1DJHA 1LKJA 2WNDA 3KEVA 2ISDA 1NX3A 1H4BA 4ZCUA 2JT3A 3OX5A 3BUNB 3DF0A 1VRKA 1JSAA 2NZ0A 4C0KA 5AERA 1QTXA 1ZACA 1KFXL 2NLNA 4M2OA 1YRUB 3I5HB 3FWCA 1CTRA 2LHIA 1DVIA 1S5GZ 3CR4X 2KHNA 4UPGA 3AKAA 4P5OE 3VGOA 2HETA 3I5GC 2LMTA 1SY9A 3DD4A 4MRXA 4HRHA 1N0YA 3GK1A 1XFYO 1SRAA 3LLEA 4DRWA 4BY4A 1NCZA 1NCXA 1UHKA 2BCBA 1KQMC 3FS7A 1SR6B 1SW8A 3D0YA 3WNXB 4YRUA 1QX7A 1DJZA 1J7RA 1K96A 2F8PA 4FQOA 1CMFA 1FW4A 1M39A 5CSNA 4U8DA 4DUQA 3WHUB 4ETOA 1AUIB 1K93D 1TNQA 1WDCB 2KNEA 2L4HA 2M9GA 1KFXS 1YRTB 3LL8B 1Y1XA 1F8HA 1F4QA 1K90D 1BT6A 1FBVA 1QX5B 2EGDA 2LHLA 3O2PA 3A8RA 1KCYA 2HF5A 2JWWA 4L9MA 2F2OA 1KWOB 1FI6A 4E68A 1JF2A 1QVIZ 3I5HC 1KK8B 1NX2A 2K61A 1QV1A 4WQ2A 3ICBA 2COLB 1OOJA 2Q4UA 3CS1A 5JJGA 1B4CA 1QX2A 1R2UA 1MR8A 3DVKA 5CSIA 2ZFDA 1CDNA 2JNFA 3BQ3A 3FWBA 2CCMA 1PULA 1CM1A 4MZJA 2NCOA 3FIAA 3IQOA 1DJWA 1NIWA 2EC6B 2LNKA 1K9KA 4YGCB 3BXKA 1WLMA 1SR6C 1XFVO 2KFGA 2KI6C 1DJXA 1K2HA 1TCFA 5HLVA 3IF7A 2BE4A 2LVIA 2PRUA 2ZRTA 2LCPA 1S5GY 4XJKB 4MZKA 2M0RA 1BF5A 1NSHA 2Y1MA 2K7DA 3CGAA 4ORAB 2F3ZA 4GBAA 1U5IB 1CB1A 4QJ4B 3E3RA 3LCPC 1H8BA 3BUWB 1RK9A 2LE9B 2IS9A 1OZSA 3I5FC 4QJ5B 1EL4A 1BR1B 1OMDA 3EVRA 3IQQA 5HLOA 1IGVA 2JZIA 1GGZA 2JQ6A 3LK1A 3SG6A 2JXCA 2I7AA 3VROA 2LM5A 1FPWA 4PE0A 2L51A 1DTLA 3I5GB 1XFXO 4A4CA 5ER4X 2MRDA 1A4PA 4N1FA 5FYXA 1TNXA 1J7OA 3VRRA 3TDZA 1KQMB 3OX6A 2BE6A 4CPVA 1Y1AA 4GGFA 2OTGC 2BKHB 1SPYA 2MA2A 5AFPA 2TN4A 3SG3A 4GUKA 3SIBA 2QACA 3EK8A 2LC5A 3KO0A 3OP0A 3A4UB 4GFTA 5D7FA 1YR5A 1CDPA 2EC6C 2Q91A 5I8NA 4PE4A 3NSKA 1J7PA 1QVIY 1QS7A 1MXLC 2M8UA 2MLFC 3OHMB 2WOSA 4N5XA 3EVUA 1LA0A 4ICBA 2KSPA 2M97A 2KAXA 4MVFA 5I2LA 4OV2A 4F0ZB 2KGRA 3BOWA 2OS8C 1J1DA 2BECA 2KFHA 1WLZA 2WCBA 1AJ4A 2Y1NA 4PALA 4DS7A 1S6CA 5J3XA 4DIRA 1SYMA 2ZN9A 1D1OA 2AMIA 3BUMB 3CTNA 5GQQC 1QIVA 3TS5C 3SG4A 3NSOA 1BU3A 4XYNA 2BL0C 1UURA 3PATA 1UWOA 4OCIA 1CLLA 1SCMC 1DT7B 2LP3A 1UP5A 2JC2A 5KSZA 3BUXB 3O78A 4MSPA 1ODBA 2WCFA 4JPZB 3VRPA 5B8IB 4D1EA 1DJIA 4YGAA 1N65A 1M46A 2LLTA 3GK4X 5G08A 1LXFC 2B1UA 2ZNDA 1S3PA 3JVTC 1K8UA 1QLKA 5KU1A 4NDDA 3TZ1A 2L0PA 1MUXA 3BUOB 3F45A 4YI8A 4JWQA 3EK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAS A;  1QAT A;  1MQ1 A;  1REC A;  2QPT A;  3PM8 A;  1RJV A;  5CSF A;  2BBN A;  1RWY A;  3CR5 X;  2L2E A;  1KFU L;  1NPQ A;  1SMG A;  1XK4 A;  3DF0 B;  4GAO A;  2K7O A;  3NXA A;  1BOD A;  4I5N B;  1OE9 B;  1MXE A;  2KGB C;  3I5F B;  4MN0 A;  1K9U A;  3D10 A;  1QIW A;  1K9P A;  1OMV A;  1CDL A;  1SBJ A;  1ALW A;  2LAP A;  5PAL A;  1NX1 A;  2JT0 A;  3AKB A;  1KSO A;  2F3Y A;  1CNP A;  2H61 A;  4N1G A;  5I2O A;  4ZCV A;  2ZN8 A;  1ALV A;  1XO5 A;  2BCA A;  1DGU A;  1OMR A;  1PSR A;  1OQP A;  2M3W A;  1G4Y R;  5AXI A;  2AAO A;  3NSL A;  4WRI A;  4ORC B;  2Y4Q A;  3QRX A;  3SJS A;  4MLW A;  1AJ5 A;  3KF9 A;  4TNC A;  1NP8 A;  2OTG B;  4XJK A;  1AK8 A;  4YGD B;  1DF0 B;  1YVL A;  1WY9 A;  4BY5 A;  3D0Y B;  2JUL A;  1BG1 A;  1EG4 A;  1SCV A;  1CFF A;  2K8M B;  1EG3 A;  1K95 A;  1U5I A;  4MBE A;  3DVM A;  4CFR A;  2H2K A;  1C7W A;  1MHO A;  2KDH A;  2MJW B;  3DVE A;  2M7N A;  2I94 A;  4QJ3 B;  2P6B B;  1KFU S;  1IWQ A;  5DKQ A;  4M2Q A;  2LVJ A;  4A4B A;  3TUY C;  1S6I A;  2NCP A;  2JU0 A;  4PHK A;  4PE1 A;  1SL8 A;  1J7Q A;  3JTD C;  3O4Y A;  2JNX A;  2OS8 B;  4WQ3 A;  4NDC A;  4HRG A;  1B1G A;  1YX7 A;  1SL7 A;  3SG7 A;  1EH2 A;  2CXJ A;  3SIA A;  3WXA A;  1CFC A;  2KOT A;  3TS5 B;  2D8N A;  2KI6 D;  2A4J A;  2WCE A;  4OKH A;  2BL0 B;  2FCD A;  5F6T A;  4MEW A;  2KBM A;  1SCM B;  1UHI A;  3LK0 A;  3NSI A;  1PVA A;  2K7B A;  2LVK A;  4PDZ A;  2JT8 A;  1CDM A;  2KAV A;  1QV0 A;  4ORB B;  3ZNI A;  2KFF A;  1J1E A;  3GK2 A;  5TNC A;  1M63 B;  1M31 A;  4I5J A;  1L2O C;  2FOT A;  2LLS A;  3JVT B;  3PN7 C;  1A75 B;  4I5K A;  3GOF A;  3MSE B;  4AOM A;  1S26 D;  2DOQ A;  1LA3 A;  5HKZ A;  5CPV A;  1V1F A;  2HQ8 A;  1QLS A;  2JOJ A;  1BR4 B;  1TTX A;  1YUT A;  1UHH A;  2CNP A;  4YI9 A;  2AUC A;  1MF8 B;  2LAN A;  1QXP A;  4IL1 A;  3RM1 A;  1IH0 A;  3CZT X;  2LMU A;  4USL A;  3EK7 A;  1BOC A;  1PAL A;  2K2A A;  1FI5 A;  3H4S E;  1JWD A;  1IG5 A;  1SNL A;  1FF1 A;  1XFU O;  1JF0 A;  1WRK A;  2JXL A;  2MBX A;  1V1G A;  1CMG A;  1Y1U A;  3I5I C;  2E30 A;  4MRY A;  1M45 A;  1B47 A;  2OPO A;  4P2Y B;  2FJU B;  3TDU A;  3OB2 B;  4DCK A;  1Q80 A;  1TOP A;  1G33 A;  2E6W A;  1UHJ A;  1HT9 A;  1TIZ A;  2MHH A;  2WC8 A;  3AAK A;  5CSJ A;  3PSR A;  5I2Q A;  5IBW A;  4PHJ A;  2M49 B;  1S36 A;  1SL9 A;  2M1K B;  2PSR A;  1KQV A;  2BBM A;  1N2D A;  3BYA A;  3ZWH A;  1DJG A;  5HYD A;  1AP4 A;  4C0L A;  3K21 A;  1XA5 A;  1YVH A;  2L4I A;  5BPJ A;  2GGM A;  5JOL A;  3HCM A;  1K94 A;  3TUY B;  2KQY A;  1PRW A;  2EHB A;  2MLE C;  2KYC A;  4AQJ A;  3JTD B;  5AEQ A;  3EVV A;  1J55 A;  1B7T Z;  1IKU A;  1BLQ A;  1S1E A;  1CM4 A;  4CID A;  1KSM A;  4AQI A;  1DMO A;  1JUO A;  2ZNE A;  3BOW B;  1RFJ A;  5AAN A;  4CFQ A;  4NQG A;  2O60 A;  1LIN A;  1UHN A;  2JTZ A;  4HSZ A;  4JQ0 D;  4GPL B;  2ZKM X;  1G8I A;  1NYA A;  3PFV A;  1XFW O;  2JPT A;  1LVC D;  1JC2 A;  1DF0 A;  1TN4 A;  1NWD A;  3OB1 B;  1B9A A;  1PK0 D;  1GQM A;  5DKN A;  5HKY A;  1F71 A;  2JTT A;  2Y5I A;  1ZUZ A;  3DVJ A;  1KK7 Y;  5DKR A;  4MZL A;  1IQ3 A;  1F70 A;  3RLZ A;  1ZOT B;  1L2O B;  3SG2 A;  1RTP 1;  2KI4 C;  1GGW A;  1S6J A;  3PN7 B;  4FTG A;  3CR2 A;  1WRL A;  4GGF C;  4CLN A;  1QJT A;  2GGZ A;  1NCY A;  2L50 A;  2LVV A;  2M1U A;  2LLU A;  2I2R E;  4PE7 A;  3EKH A;  3CWG A;  1XYD A;  1DGV A;  1TNW A;  1F54 A;  2GV5 A;  4I5L B;  1CKK A;  1CLB A;  1C07 A;  2F2P A;  4YBH B;  1A29 A;  2I18 A;  4OVN F;  1IJ6 A;  1PSB A;  1A03 A;  1CLM A;  2LV7 A;  2PVB A;  1OSA A;  1RRO A;  1YTZ C;  2LUX A;  2KQ6 A;  5D69 A;  2M29 A;  1IRJ A;  1B8L A;  4YGE B;  3I5I B;  2BCX A;  4OR9 B;  2HPS A;  1CFP A;  5K89 A;  2R2I A;  2LP2 A;  2V53 A;  1A75 A;  3PLF B;  2LUC A;  2SCP A;  1BMO A;  5KTY A;  1W7I B;  1WRZ A;  3WHT B;  2PAL A;  2CTN A;  3KHE A;  2SAS A;  1NUB A;  4PHN A;  5ER5 A;  1OZO A;  2L98 A;  1B7T Y;  2O5G A;  4YGB B;  4C0J A;  3AAJ A;  1DJY A;  1SKT A;  1GJY A;  1WDC C;  2LMV A;  1PVB A;  3KPX A;  2G2B A;  3VRQ A;  2KBI A;  2KYF A;  1YUR A;  5HKW A;  1Y6W A;  1EXR A;  2JRF A;  1UUS A;  1IQ5 A;  4NDB A;  4Q04 A;  2ZRS A;  2BKI B;  1KK7 Z;  1R6P A;  4PHM A;  1ZMZ A;  1EJ3 A;  2PAS A;  2VRG A;  4R1E A;  2NXQ A;  1KWO C;  1JBA A;  1F4O A;  1TRF A;  2CBL A;  3C1V A;  2WOR A;  1AHR A;  4GNK B;  3CLN A;  1KK8 C;  1W7J B;  1TNP A;  2MAZ A;  4M2P A;  1C7V A;  1XK4 C;  1HQV A;  2L5X B;  2FCE A;  2CT9 A;  2F33 A;  2G9B A;  3M0W A;  1MWN A;  2HQW A;  1F55 A;  2RGI A;  2K0J A;  3PAL A;  1B8C A;  3EKJ A;  1L7Z A;  4PCW A;  3TDI A;  1XVJ A;  2KAY A;  1IJ5 A;  1XFZ O;  2K7C A;  1X02 A;  2K2F A;  3HX4 A;  1A2X A;  1TCO B;  1ZFS A;  2H61 C;  3O6B A;  3VRN A;  1YUS A;  4GGN A;  1Y0V H;  1AVS A;  1JFK A;  2PMY A;  2M7L A;  1YUU A;  2KI4 B;  1E8A A;  1NX0 A;  3SG5 A;  1JFJ A;  1SK6 D;  1BJF A;  1B8R A;  1YX8 A;  4HRE E;  1CFD A;  1DJH A;  1LKJ A;  2WND A;  3KEV A;  2ISD A;  1NX3 A;  1H4B A;  4ZCU A;  2JT3 A;  3OX5 A;  3BUN B;  3DF0 A;  1VRK A;  1JSA A;  2NZ0 A;  4C0K A;  5AER A;  1QTX A;  1ZAC A;  1KFX L;  2NLN A;  4M2O A;  1YRU B;  3I5H B;  3FWC A;  1CTR A;  2LHI A;  1DVI A;  1S5G Z;  3CR4 X;  2KHN A;  4UPG A;  3AKA A;  4P5O E;  3VGO A;  2HET A;  3I5G C;  2LMT A;  1SY9 A;  3DD4 A;  4MRX A;  4HRH A;  1N0Y A;  3GK1 A;  1XFY O;  1SRA A;  3LLE A;  4DRW A;  4BY4 A;  1NCZ A;  1NCX A;  1UHK A;  2BCB A;  1KQM C;  3FS7 A;  1SR6 B;  1SW8 A;  3D0Y A;  3WNX B;  4YRU A;  1QX7 A;  1DJZ A;  1J7R A;  1K96 A;  2F8P A;  4FQO A;  1CMF A;  1FW4 A;  1M39 A;  5CSN A;  4U8D A;  4DUQ A;  3WHU B;  4ETO A;  1AUI B;  1K93 D;  1TNQ A;  1WDC B;  2KNE A;  2L4H A;  2M9G A;  1KFX S;  1YRT B;  3LL8 B;  1Y1X A;  1F8H A;  1F4Q A;  1K90 D;  1BT6 A;  1FBV A;  1QX5 B;  2EGD A;  2LHL A;  3O2P A;  3A8R A;  1KCY A;  2HF5 A;  2JWW A;  4L9M A;  2F2O A;  1KWO B;  1FI6 A;  4E68 A;  1JF2 A;  1QVI Z;  3I5H C;  1KK8 B;  1NX2 A;  2K61 A;  1QV1 A;  4WQ2 A;  3ICB A;  2COL B;  1OOJ A;  2Q4U A;  3CS1 A;  5JJG A;  1B4C A;  1QX2 A;  1R2U A;  1MR8 A;  3DVK A;  5CSI A;  2ZFD A;  1CDN A;  2JNF A;  3BQ3 A;  3FWB A;  2CCM A;  1PUL A;  1CM1 A;  4MZJ A;  2NCO A;  3FIA A;  3IQO A;  1DJW A;  1NIW A;  2EC6 B;  2LNK A;  1K9K A;  4YGC B;  3BXK A;  1WLM A;  1SR6 C;  1XFV O;  2KFG A;  2KI6 C;  1DJX A;  1K2H A;  1TCF A;  5HLV A;  3IF7 A;  2BE4 A;  2LVI A;  2PRU A;  2ZRT A;  2LCP A;  1S5G Y;  4XJK B;  4MZK A;  2M0R A;  1BF5 A;  1NSH A;  2Y1M A;  2K7D A;  3CGA A;  4ORA B;  2F3Z A;  4GBA A;  1U5I B;  1CB1 A;  4QJ4 B;  3E3R A;  3LCP C;  1H8B A;  3BUW B;  1RK9 A;  2LE9 B;  2IS9 A;  1OZS A;  3I5F C;  4QJ5 B;  1EL4 A;  1BR1 B;  1OMD A;  3EVR A;  3IQQ A;  5HLO A;  1IGV A;  2JZI A;  1GGZ A;  2JQ6 A;  3LK1 A;  3SG6 A;  2JXC A;  2I7A A;  3VRO A;  2LM5 A;  1FPW A;  4PE0 A;  2L51 A;  1DTL A;  3I5G B;  1XFX O;  4A4C A;  5ER4 X;  2MRD A;  1A4P A;  4N1F A;  5FYX A;  1TNX A;  1J7O A;  3VRR A;  3TDZ A;  1KQM B;  3OX6 A;  2BE6 A;  4CPV A;  1Y1A A;  4GGF A;  2OTG C;  2BKH B;  1SPY A;  2MA2 A;  5AFP A;  2TN4 A;  3SG3 A;  4GUK A;  3SIB A;  2QAC A;  3EK8 A;  2LC5 A;  3KO0 A;  3OP0 A;  3A4U B;  4GFT A;  5D7F A;  1YR5 A;  1CDP A;  2EC6 C;  2Q91 A;  5I8N A;  4PE4 A;  3NSK A;  1J7P A;  1QVI Y;  1QS7 A;  1MXL C;  2M8U A;  2MLF C;  3OHM B;  2WOS A;  4N5X A;  3EVU A;  1LA0 A;  4ICB A;  2KSP A;  2M97 A;  2KAX A;  4MVF A;  5I2L A;  4OV2 A;  4F0Z B;  2KGR A;  3BOW A;  2OS8 C;  1J1D A;  2BEC A;  2KFH A;  1WLZ A;  2WCB A;  1AJ4 A;  2Y1N A;  4PAL A;  4DS7 A;  1S6C A;  5J3X A;  4DIR A;  1SYM A;  2ZN9 A;  1D1O A;  2AMI A;  3BUM B;  3CTN A;  5GQQ C;  1QIV A;  3TS5 C;  3SG4 A;  3NSO A;  1BU3 A;  4XYN A;  2BL0 C;  1UUR A;  3PAT A;  1UWO A;  4OCI A;  1CLL A;  1SCM C;  1DT7 B;  2LP3 A;  1UP5 A;  2JC2 A;  5KSZ A;  3BUX B;  3O78 A;  4MSP A;  1ODB A;  2WCF A;  4JPZ B;  3VRP A;  5B8I B;  4D1E A;  1DJI A;  4YGA A;  1N65 A;  1M46 A;  2LLT A;  3GK4 X;  5G08 A;  1LXF C;  2B1U A;  2ZND A;  1S3P A;  3JVT C;  1K8U A;  1QLK A;  5KU1 A;  4NDD A;  3TZ1 A;  2L0P A;  1MUX A;  3BUO B;  3F45 A;  4YI8 A;  4JWQ A;  3EK4 A; 
#chains in the Genus database with same CATH topology
 1QAS A;  1QAT A;  4JKT A;  1MQ1 A;  1REC A;  2QPT A;  3PM8 A;  1RJV A;  3R1O A;  5CSF A;  2BBN A;  1RWY A;  1Z2C B;  2L2E A;  3CR5 X;  1KFU L;  1NPQ A;  1SMG A;  1XK4 A;  3DF0 B;  4GAO A;  2K7O A;  3NXA A;  1BOD A;  4I5N B;  1OE9 B;  1MXE A;  2KGB C;  3I5F B;  4MN0 A;  1K9U A;  3D10 A;  3R1V A;  1QIW A;  1K9P A;  1OMV A;  1CDL A;  1DQE A;  1ALW A;  1SBJ A;  2LAP A;  5PAL A;  3R1P A;  1NX1 A;  2JT0 A;  3AKB A;  1KSO A;  2F3Y A;  1CNP A;  1OOH A;  2H61 A;  4N1G A;  5I2O A;  4ZCV A;  2ZN8 A;  1ALV A;  1XO5 A;  2BCA A;  1DGU A;  1OMR A;  1PSR A;  1OQP A;  2M3W A;  1G4Y R;  5AXI A;  2AAO A;  3NSL A;  1DEL A;  4WRI A;  4ORC B;  2Y4Q A;  3QRX A;  3SJS A;  4MLW A;  1OOF A;  1AJ5 A;  3KF9 A;  4TNC A;  1NP8 A;  2OTG B;  2FJY A;  4XJK A;  4YGD B;  5DIC A;  1DF0 B;  1AK8 A;  1YVL A;  1WY9 A;  4BY5 A;  3D0Y B;  2JUL A;  1BG1 A;  1EG4 A;  1SCV A;  1CFF A;  3OBV A;  2K8M B;  1EG3 A;  1K95 A;  1U5I A;  4MBE A;  3DVM A;  3SS3 A;  4CFR A;  2H2K A;  1C7W A;  1MHO A;  2KDH A;  5FI6 A;  2MJW B;  4F7F A;  3DVE A;  2M7N A;  3L4A A;  2I94 A;  1IIO A;  4QJ3 B;  2P6B B;  1KFU S;  1IWQ A;  5DKQ A;  4M2Q A;  2LVJ A;  4A4B A;  3TUY C;  1S6I A;  2NCP A;  2JU0 A;  2P70 A;  4PHK A;  4PE1 A;  1SL8 A;  1J7Q A;  3JTD C;  3O4Y A;  1TUJ A;  2JNX A;  2OS8 B;  4WQ3 A;  3D78 A;  4NDC A;  4HRG A;  1B1G A;  1YX7 A;  3R72 A;  1SL7 A;  3SG7 A;  1EH2 A;  2CXJ A;  1T14 A;  3SIA A;  3WXA A;  1CFC A;  2KOT A;  3TS5 B;  2D8N A;  2KI6 D;  3D76 A;  2A4J A;  2WCE A;  4OKH A;  1TWO A;  2BL0 B;  2FCD A;  5F6T A;  4MEW A;  2KBM A;  1SCM B;  1UHI A;  3LK0 A;  3NSI A;  1PVA A;  2K7B A;  2LVK A;  4PDZ A;  2JT8 A;  1CDM A;  2KAV A;  3B7A A;  1QV0 A;  4ORB B;  3ZNI A;  3UO9 A;  2KFF A;  1J1E A;  3GK2 A;  4JD9 A;  5TNC A;  3DYE A;  1M63 B;  1M31 A;  4I5J A;  1L2O C;  2FOT A;  2LLS A;  3JVT B;  3PN7 C;  1A75 B;  4I5K A;  3GOF A;  3MSE B;  4AOM A;  1S26 D;  2DOQ A;  1LA3 A;  2QEV A;  5HKZ A;  5CPV A;  1V1F A;  2HQ8 A;  1QLS A;  2JOJ A;  1BR4 B;  1TTX A;  1YUT A;  1UHH A;  2CNP A;  3PJI A;  4YI9 A;  2AUC A;  1MF8 B;  2LAN A;  1QXP A;  4IL1 A;  2P71 A;  3RM1 A;  1IH0 A;  3CZT X;  2LMU A;  4USL A;  3EK4 A;  3EK7 A;  1BOC A;  1PAL A;  3NHI A;  2K2A A;  1FI5 A;  2BNX A;  3H4S E;  3K1E A;  3BJH A;  1JWD A;  1IG5 A;  1SNL A;  1FF1 A;  1XFU O;  1JF0 A;  3CAB A;  1WRK A;  2JXL A;  3D74 A;  2MBX A;  1V1G A;  1CMG A;  1Y1U A;  3I5I C;  2E30 A;  4MRY A;  1M45 A;  1B47 A;  4OZD A;  2OPO A;  4P2Y B;  2FJU B;  2GTE A;  3TDU A;  3OB2 B;  4DCK A;  1Q80 A;  1TOP A;  1G33 A;  2E6W A;  1UHJ A;  1HT9 A;  1TIZ A;  2MHH A;  2WC8 A;  3AAK A;  5CSJ A;  3PSR A;  5D3O A;  5I2Q A;  5IBW A;  2WCK A;  4PHJ A;  2M49 B;  1GM0 A;  1S36 A;  1SL9 A;  2M1K B;  2PSR A;  3PM2 A;  1KQV A;  2BBM A;  1N2D A;  3BYA A;  3ZWH A;  1DJG A;  5HYD A;  1AP4 A;  4C0L A;  3K21 A;  1XA5 A;  1YVH A;  2L4I A;  5BPJ A;  2GGM A;  5JOL A;  3HCM A;  1K94 A;  3TUY B;  2KQY A;  1PRW A;  2EHB A;  2MLE C;  2KYC A;  4AQJ A;  3JTD B;  4FQT A;  3EVV A;  5AEQ A;  1J55 A;  1DEK A;  1B7T Z;  1IKU A;  1BLQ A;  1S1E A;  1CM4 A;  4CID A;  1KSM A;  4AQI A;  1DMO A;  1JUO A;  2ZNE A;  3BOW B;  1RFJ A;  3IVT A;  5AAN A;  4CFQ A;  4NQG A;  2O60 A;  1LIN A;  1UHN A;  2JTZ A;  2QEO A;  4HSZ A;  4JQ0 D;  4KYN A;  4GPL B;  2ZKM X;  1G8I A;  1NYA A;  3PFV A;  5FI7 A;  1XFW O;  2JPT A;  1LVC D;  1JC2 A;  1DF0 A;  1TN4 A;  1NWD A;  3OB1 B;  1B9A A;  3O4X A;  1PK0 D;  4YI8 A;  1GQM A;  5DKN A;  5HKY A;  1F71 A;  3SS5 A;  2JTT A;  2Y5I A;  1ZUZ A;  3DVJ A;  1KK7 Y;  5DKR A;  4MZL A;  1IQ3 A;  1F70 A;  3RLZ A;  1ZOT B;  2WCL A;  1L2O B;  3SG2 A;  1RTP 1;  2KI4 C;  1GGW A;  1S6J A;  3PN7 B;  4FTG A;  3CR2 A;  1WRL A;  4GGF C;  4CLN A;  1QJT A;  2GGZ A;  1NCY A;  2QEB A;  2L50 A;  2LVV A;  2M1U A;  2LLU A;  2I2R E;  4PE7 A;  3EKH A;  2KPH A;  2PQL A;  1XYD A;  2QEH A;  3CDN A;  3CWG A;  1DC1 A;  1DGV A;  1TNW A;  1F54 A;  1ORG A;  2GV5 A;  4I5L B;  3S0A A;  1CKK A;  1CLB A;  2BAP A;  2F2P A;  1C07 A;  3NHT A;  4YBH B;  1A29 A;  2I18 A;  4OVN F;  1IJ6 A;  1PSB A;  1A03 A;  1CLM A;  2LV7 A;  2PVB A;  1OSA A;  1RRO A;  1YTZ C;  2LUX A;  2KQ6 A;  5D69 A;  2M29 A;  1IRJ A;  1B8L A;  4YGE B;  3I5I B;  2BCX A;  4OR9 B;  2HPS A;  1CFP A;  5K89 A;  2R2I A;  1LS8 A;  2LP2 A;  2V53 A;  1A75 A;  3PLF B;  2LUC A;  2SCP A;  1BMO A;  5KTY A;  1W7I B;  1WRZ A;  3WHT B;  2PAL A;  2CTN A;  3KHE A;  2SAS A;  1NUB A;  3DXL A;  4PHN A;  5ER5 A;  1OZO A;  2L98 A;  1B7T Y;  2O5G A;  4YGB B;  4C0J A;  3AAJ A;  1DJY A;  1SKT A;  1GJY A;  1WDC C;  2LMV A;  1PVB A;  3KPX A;  2G2B A;  2K60 A;  3VRQ A;  2KBI A;  2KYF A;  3RZS A;  1YUR A;  3DZT A;  5HKW A;  1Y6W A;  1EXR A;  2JRF A;  1UUS A;  1IQ5 A;  4NDB A;  4Q04 A;  2ZRS A;  2BKI B;  1KK7 Z;  1R6P A;  4PHM A;  1ZMZ A;  1EJ3 A;  2PAS A;  2VRG A;  4R1E A;  1Z4H A;  2NXQ A;  1KWO C;  1JBA A;  1F4O A;  1TRF A;  2CBL A;  3C1V A;  2WOR A;  1AHR A;  4GNK B;  3CLN A;  1KK8 C;  1W7J B;  1TNP A;  2MAZ A;  4M2P A;  4INX A;  1XK4 C;  1C7V A;  1HQV A;  2L5X B;  2FCE A;  2CT9 A;  2F33 A;  2G9B A;  3M0W A;  1MWN A;  2HQW A;  1F55 A;  2RGI A;  2K0J A;  3PAL A;  1B8C A;  3EKJ A;  1L7Z A;  4PCW A;  3TDI A;  1XVJ A;  2KAY A;  1IJ5 A;  1XFZ O;  2ERB A;  2K7C A;  1X02 A;  2K2F A;  3HX4 A;  1A2X A;  1TCO B;  1ZFS A;  2H61 C;  5FI2 A;  1JFJ A;  2YGU A;  3O6B A;  3VRN A;  1YUS A;  4GGN A;  1Y0V H;  3FE8 A;  1AVS A;  1JFK A;  2PMY A;  2M7L A;  1YUU A;  2KI4 B;  3S0D A;  1E8A A;  1NX0 A;  3FE9 A;  1OW4 A;  3SG5 A;  3V2L A;  1SK6 D;  1BJF A;  1YX8 A;  1B8R A;  4HRE E;  1CFD A;  1DJH A;  1LKJ A;  2WND A;  3KEV A;  2ISD A;  2KLE A;  5HL1 A;  1NX3 A;  4IJ7 A;  1H4B A;  4ZCU A;  2JT3 A;  3OX5 A;  3BUN B;  3DF0 A;  1VRK A;  1JSA A;  2NZ0 A;  4C0K A;  5AER A;  1QTX A;  1ZAC A;  1KFX L;  2NLN A;  4M2O A;  1YRU B;  3I5H B;  3FWC A;  1CTR A;  2LHI A;  1DVI A;  2PYQ A;  1S5G Z;  3CR4 X;  2KHN A;  4UPG A;  3AKA A;  4P5O E;  3VGO A;  2HET A;  3I5G C;  2LMT A;  1SY9 A;  3DD4 A;  1OOG A;  4MRX A;  4HRH A;  1N0Y A;  3GK1 A;  1XFY O;  1SRA A;  3LLE A;  3VB1 A;  3L47 A;  4DRW A;  4BY4 A;  1NCZ A;  1NCX A;  1UHK A;  2BCB A;  1KQM C;  3FS7 A;  1SR6 B;  1SW8 A;  3D0Y A;  1CDN A;  3WNX B;  4YRU A;  1QX7 A;  1DJZ A;  1J7R A;  1K96 A;  3SS4 A;  2F8P A;  4FQO A;  1CMF A;  1FW4 A;  1M39 A;  1OOI X;  5CSN A;  4U8D A;  4DUQ A;  3WHU B;  4ETO A;  1AUI B;  1K93 D;  1TNQ A;  1WDC B;  2KNE A;  2L4H A;  2M9G A;  1KFX S;  1YRT B;  3LL8 B;  1Y1X A;  1C3Z A;  1F8H A;  1F4Q A;  2WCH A;  1SSE B;  1K90 D;  1BT6 A;  1FBV A;  1QX5 B;  2EGD A;  2LHL A;  3FE6 A;  3O2P A;  3A8R A;  1KCY A;  2HF5 A;  2JWW A;  4L9M A;  2F2O A;  1KWO B;  1FI6 A;  4E68 A;  1JF2 A;  1QVI Z;  3I5H C;  1KK8 B;  1NX2 A;  2K61 A;  1C3Y A;  2WCJ A;  1QV1 A;  4WQ2 A;  3ICB A;  3NGV A;  2COL B;  5EL2 A;  1OOJ A;  2Q4U A;  3CS1 A;  5JJG A;  1B4C A;  1QX2 A;  1R2U A;  1MR8 A;  3DVK A;  5CSI A;  2ZFD A;  3S0B A;  2JNF A;  3BQ3 A;  3FWB A;  3S0G A;  2CCM A;  1PUL A;  1CM1 A;  4MZJ A;  2KLD A;  2NCO A;  2WCM A;  3FIA A;  3IQO A;  1DJW A;  1NIW A;  2EC6 B;  2LNK A;  1K9K A;  4YGC B;  3BXK A;  1WLM A;  1SR6 C;  1XFV O;  2KFG A;  2KI6 C;  1DJX A;  2QDI A;  3S0F A;  1K2H A;  1TCF A;  2WC6 A;  3BFB A;  3IF7 A;  1P28 A;  2BE4 A;  2LVI A;  2PRU A;  2ZRT A;  2LCP A;  5HLV A;  1S5G Y;  4XJK B;  4MZK A;  2M0R A;  1BF5 A;  1NSH A;  3BFA A;  2Y1M A;  2K7D A;  3CGA A;  4ORA B;  2F3Z A;  4GBA A;  3N7H A;  1U5I B;  1CB1 A;  4QJ4 B;  3E3R A;  3LCP C;  1H8B A;  3QME A;  3BUW B;  1W9Z A;  1RK9 A;  2LE9 B;  2IS9 A;  1OZS A;  3I5F C;  4QJ5 B;  1EL4 A;  1BR1 B;  1OMD A;  3EVR A;  3IQQ A;  5HLO A;  3CZ2 A;  1IGV A;  2JZI A;  1GGZ A;  2JQ6 A;  3LK1 A;  3SG6 A;  2JXC A;  2I7A A;  3VRO A;  2LM5 A;  1FPW A;  4PE0 A;  2L51 A;  1DTL A;  3D77 A;  3I5G B;  3CZ1 A;  1XFX O;  4A4C A;  5ER4 X;  3CZ0 A;  2MRD A;  1A4P A;  3S0E A;  4N1F A;  1QWV A;  1TNX A;  2L5Y A;  3DY9 A;  5FYX A;  1J7O A;  3VRR A;  3TDZ A;  1KQM B;  3OX6 A;  2BE6 A;  4CPV A;  1Y1A A;  3CYZ A;  4GGF A;  2OTG C;  2BKH B;  1SPY A;  2MA2 A;  5AFP A;  2TN4 A;  1TUZ A;  3D75 A;  3SG3 A;  3L4L A;  4GUK A;  5I94 A;  3SIB A;  2QAC A;  3EK8 A;  2LC5 A;  3KO0 A;  3OP0 A;  3A4U B;  4GFT A;  5D7F A;  1YR5 A;  1CDP A;  2EC6 C;  2Q91 A;  5I8N A;  4PE4 A;  3NSK A;  1J7P A;  1QVI Y;  1QS7 A;  1MXL C;  2M8U A;  3OGN A;  2MLF C;  3OHM B;  2WOS A;  4N5X A;  3EVU A;  1LA0 A;  4ICB A;  2KSP A;  2M97 A;  2KAX A;  4MVF A;  5I2L A;  4OV2 A;  4F0Z B;  2KGR A;  3BOW A;  2OS8 C;  3EG5 B;  1J1D A;  2BEC A;  2WC5 A;  2KFH A;  1WLZ A;  2WCB A;  1AJ4 A;  2Y1N A;  3B88 A;  4PAL A;  1S6C A;  5J3X A;  4DIR A;  4DS7 A;  1SYM A;  2ZN9 A;  1D1O A;  2AMI A;  3BUM B;  3B86 A;  3CTN A;  1XFR A;  5GQQ C;  1QIV A;  3TS5 C;  3SG4 A;  3NSO A;  1BU3 A;  4XYN A;  2BL0 C;  1UUR A;  3PAT A;  3Q8I A;  1UWO A;  4OCI A;  1CLL A;  3B6X A;  1SCM C;  4PT1 A;  1DT7 B;  2LP3 A;  2L2C A;  1UP5 A;  2JC2 A;  3D73 A;  4INW A;  5KSZ A;  3BUX B;  3O78 A;  4MSP A;  1ODB A;  2WCF A;  4JPZ B;  3VRP A;  5B8I B;  4D1E A;  1DJI A;  4YGA A;  1N65 A;  1M46 A;  2LLT A;  3GK4 X;  5G08 A;  1LXF C;  3UNW A;  2B1U A;  2ZND A;  1S3P A;  3JVT C;  1K8U A;  1QLK A;  5KU1 A;  3BFH A;  4NDD A;  3TZ1 A;  2L0P A;  1MUX A;  3BUO B;  3F45 A;  2H8V A;  3B87 A;  4JWQ A;  2JPO A; 
#chains in the Genus database with same CATH homology
 1QAS A;  1QAT A;  1MQ1 A;  1REC A;  2QPT A;  3PM8 A;  1RJV A;  5CSF A;  2BBN A;  1RWY A;  3CR5 X;  2L2E A;  1KFU L;  1NPQ A;  1SMG A;  1XK4 A;  3DF0 B;  4GAO A;  2K7O A;  3NXA A;  1BOD A;  4I5N B;  1OE9 B;  1MXE A;  2KGB C;  3I5F B;  4MN0 A;  1K9U A;  3D10 A;  1QIW A;  1K9P A;  1OMV A;  1CDL A;  1SBJ A;  1ALW A;  2LAP A;  5PAL A;  1NX1 A;  2JT0 A;  3AKB A;  1KSO A;  2F3Y A;  1CNP A;  2H61 A;  4N1G A;  5I2O A;  4ZCV A;  2ZN8 A;  1ALV A;  1XO5 A;  2BCA A;  1DGU A;  1OMR A;  1PSR A;  1OQP A;  2M3W A;  1G4Y R;  5AXI A;  2AAO A;  3NSL A;  4WRI A;  4ORC B;  2Y4Q A;  3QRX A;  3SJS A;  4MLW A;  1AJ5 A;  3KF9 A;  4TNC A;  1NP8 A;  2OTG B;  4XJK A;  1AK8 A;  4YGD B;  1DF0 B;  1YVL A;  1WY9 A;  4BY5 A;  3D0Y B;  2JUL A;  1BG1 A;  1EG4 A;  1SCV A;  1CFF A;  2K8M B;  1EG3 A;  1K95 A;  1U5I A;  4MBE A;  3DVM A;  4CFR A;  2H2K A;  1C7W A;  1MHO A;  2KDH A;  2MJW B;  3DVE A;  2M7N A;  2I94 A;  4QJ3 B;  2P6B B;  1KFU S;  1IWQ A;  5DKQ A;  4M2Q A;  2LVJ A;  4A4B A;  3TUY C;  1S6I A;  2NCP A;  2JU0 A;  4PHK A;  4PE1 A;  1SL8 A;  1J7Q A;  3JTD C;  3O4Y A;  2JNX A;  2OS8 B;  4WQ3 A;  4NDC A;  4HRG A;  1B1G A;  1YX7 A;  1SL7 A;  3SG7 A;  1EH2 A;  2CXJ A;  3SIA A;  3WXA A;  1CFC A;  2KOT A;  3TS5 B;  2D8N A;  2KI6 D;  2A4J A;  2WCE A;  4OKH A;  2BL0 B;  2FCD A;  5F6T A;  4MEW A;  2KBM A;  1SCM B;  1UHI A;  3LK0 A;  3NSI A;  1PVA A;  2K7B A;  2LVK A;  4PDZ A;  2JT8 A;  1CDM A;  2KAV A;  1QV0 A;  4ORB B;  3ZNI A;  2KFF A;  1J1E A;  3GK2 A;  5TNC A;  1M63 B;  1M31 A;  4I5J A;  1L2O C;  2FOT A;  2LLS A;  3JVT B;  3PN7 C;  1A75 B;  4I5K A;  3GOF A;  3MSE B;  4AOM A;  1S26 D;  2DOQ A;  1LA3 A;  5HKZ A;  5CPV A;  1V1F A;  2HQ8 A;  1QLS A;  2JOJ A;  1BR4 B;  1TTX A;  1YUT A;  1UHH A;  2CNP A;  4YI9 A;  2AUC A;  1MF8 B;  2LAN A;  1QXP A;  4IL1 A;  3RM1 A;  1IH0 A;  3CZT X;  2LMU A;  4USL A;  3EK7 A;  1BOC A;  1PAL A;  2K2A A;  1FI5 A;  3H4S E;  1JWD A;  1IG5 A;  1SNL A;  1FF1 A;  1XFU O;  1JF0 A;  1WRK A;  2JXL A;  2MBX A;  1V1G A;  1CMG A;  1Y1U A;  3I5I C;  2E30 A;  4MRY A;  1M45 A;  1B47 A;  2OPO A;  4P2Y B;  2FJU B;  3TDU A;  3OB2 B;  4DCK A;  1Q80 A;  1TOP A;  1G33 A;  2E6W A;  1UHJ A;  1HT9 A;  1TIZ A;  2MHH A;  2WC8 A;  3AAK A;  5CSJ A;  3PSR A;  5I2Q A;  5IBW A;  4PHJ A;  2M49 B;  1S36 A;  1SL9 A;  2M1K B;  2PSR A;  1KQV A;  2BBM A;  1N2D A;  3BYA A;  3ZWH A;  1DJG A;  5HYD A;  1AP4 A;  4C0L A;  3K21 A;  1XA5 A;  1YVH A;  2L4I A;  5BPJ A;  2GGM A;  5JOL A;  3HCM A;  1K94 A;  3TUY B;  2KQY A;  1PRW A;  2EHB A;  2MLE C;  2KYC A;  4AQJ A;  3JTD B;  5AEQ A;  3EVV A;  1J55 A;  1B7T Z;  1IKU A;  1BLQ A;  1S1E A;  1CM4 A;  4CID A;  1KSM A;  4AQI A;  1DMO A;  1JUO A;  2ZNE A;  3BOW B;  1RFJ A;  5AAN A;  4CFQ A;  4NQG A;  2O60 A;  1LIN A;  1UHN A;  2JTZ A;  4HSZ A;  4JQ0 D;  4GPL B;  2ZKM X;  1G8I A;  1NYA A;  3PFV A;  1XFW O;  2JPT A;  1LVC D;  1JC2 A;  1DF0 A;  1TN4 A;  1NWD A;  3OB1 B;  1B9A A;  1PK0 D;  1GQM A;  5DKN A;  5HKY A;  1F71 A;  2JTT A;  2Y5I A;  1ZUZ A;  3DVJ A;  1KK7 Y;  5DKR A;  4MZL A;  1IQ3 A;  1F70 A;  3RLZ A;  1ZOT B;  1L2O B;  3SG2 A;  1RTP 1;  2KI4 C;  1GGW A;  1S6J A;  3PN7 B;  4FTG A;  3CR2 A;  1WRL A;  4GGF C;  4CLN A;  1QJT A;  2GGZ A;  1NCY A;  2L50 A;  2LVV A;  2M1U A;  2LLU A;  2I2R E;  4PE7 A;  3EKH A;  3CWG A;  1XYD A;  1DGV A;  1TNW A;  1F54 A;  2GV5 A;  4I5L B;  1CKK A;  1CLB A;  1C07 A;  2F2P A;  4YBH B;  1A29 A;  2I18 A;  4OVN F;  1IJ6 A;  1PSB A;  1A03 A;  1CLM A;  2LV7 A;  2PVB A;  1OSA A;  1RRO A;  1YTZ C;  2LUX A;  2KQ6 A;  5D69 A;  2M29 A;  1IRJ A;  1B8L A;  4YGE B;  3I5I B;  2BCX A;  4OR9 B;  2HPS A;  1CFP A;  5K89 A;  2R2I A;  2LP2 A;  2V53 A;  1A75 A;  3PLF B;  2LUC A;  2SCP A;  1BMO A;  5KTY A;  1W7I B;  1WRZ A;  3WHT B;  2PAL A;  2CTN A;  3KHE A;  2SAS A;  1NUB A;  4PHN A;  5ER5 A;  1OZO A;  2L98 A;  1B7T Y;  2O5G A;  4YGB B;  4C0J A;  3AAJ A;  1DJY A;  1SKT A;  1GJY A;  1WDC C;  2LMV A;  1PVB A;  3KPX A;  2G2B A;  3VRQ A;  2KBI A;  2KYF A;  1YUR A;  5HKW A;  1Y6W A;  1EXR A;  2JRF A;  1UUS A;  1IQ5 A;  4NDB A;  4Q04 A;  2ZRS A;  2BKI B;  1KK7 Z;  1R6P A;  4PHM A;  1ZMZ A;  1EJ3 A;  2PAS A;  2VRG A;  4R1E A;  2NXQ A;  1KWO C;  1JBA A;  1F4O A;  1TRF A;  2CBL A;  3C1V A;  2WOR A;  1AHR A;  4GNK B;  3CLN A;  1KK8 C;  1W7J B;  1TNP A;  2MAZ A;  4M2P A;  1C7V A;  1XK4 C;  1HQV A;  2L5X B;  2FCE A;  2CT9 A;  2F33 A;  2G9B A;  3M0W A;  1MWN A;  2HQW A;  1F55 A;  2RGI A;  2K0J A;  3PAL A;  1B8C A;  3EKJ A;  1L7Z A;  4PCW A;  3TDI A;  1XVJ A;  2KAY A;  1IJ5 A;  1XFZ O;  2K7C A;  1X02 A;  2K2F A;  3HX4 A;  1A2X A;  1TCO B;  1ZFS A;  2H61 C;  3O6B A;  3VRN A;  1YUS A;  4GGN A;  1Y0V H;  1AVS A;  1JFK A;  2PMY A;  2M7L A;  1YUU A;  2KI4 B;  1E8A A;  1NX0 A;  3SG5 A;  1JFJ A;  1SK6 D;  1BJF A;  1B8R A;  1YX8 A;  4HRE E;  1CFD A;  1DJH A;  1LKJ A;  2WND A;  3KEV A;  2ISD A;  1NX3 A;  1H4B A;  4ZCU A;  2JT3 A;  3OX5 A;  3BUN B;  3DF0 A;  1VRK A;  1JSA A;  2NZ0 A;  4C0K A;  5AER A;  1QTX A;  1ZAC A;  1KFX L;  2NLN A;  4M2O A;  1YRU B;  3I5H B;  3FWC A;  1CTR A;  2LHI A;  1DVI A;  1S5G Z;  3CR4 X;  2KHN A;  4UPG A;  3AKA A;  4P5O E;  3VGO A;  2HET A;  3I5G C;  2LMT A;  1SY9 A;  3DD4 A;  4MRX A;  4HRH A;  1N0Y A;  3GK1 A;  1XFY O;  1SRA A;  3LLE A;  4DRW A;  4BY4 A;  1NCZ A;  1NCX A;  1UHK A;  2BCB A;  1KQM C;  3FS7 A;  1SR6 B;  1SW8 A;  3D0Y A;  3WNX B;  4YRU A;  1QX7 A;  1DJZ A;  1J7R A;  1K96 A;  2F8P A;  4FQO A;  1CMF A;  1FW4 A;  1M39 A;  5CSN A;  4U8D A;  4DUQ A;  3WHU B;  4ETO A;  1AUI B;  1K93 D;  1TNQ A;  1WDC B;  2KNE A;  2L4H A;  2M9G A;  1KFX S;  1YRT B;  3LL8 B;  1Y1X A;  1F8H A;  1F4Q A;  1K90 D;  1BT6 A;  1FBV A;  1QX5 B;  2EGD A;  2LHL A;  3O2P A;  3A8R A;  1KCY A;  2HF5 A;  2JWW A;  4L9M A;  2F2O A;  1KWO B;  1FI6 A;  4E68 A;  1JF2 A;  1QVI Z;  3I5H C;  1KK8 B;  1NX2 A;  2K61 A;  1QV1 A;  4WQ2 A;  3ICB A;  2COL B;  1OOJ A;  2Q4U A;  3CS1 A;  5JJG A;  1B4C A;  1QX2 A;  1R2U A;  1MR8 A;  3DVK A;  5CSI A;  2ZFD A;  1CDN A;  2JNF A;  3BQ3 A;  3FWB A;  2CCM A;  1PUL A;  1CM1 A;  4MZJ A;  2NCO A;  3FIA A;  3IQO A;  1DJW A;  1NIW A;  2EC6 B;  2LNK A;  1K9K A;  4YGC B;  3BXK A;  1WLM A;  1SR6 C;  1XFV O;  2KFG A;  2KI6 C;  1DJX A;  1K2H A;  1TCF A;  5HLV A;  3IF7 A;  2BE4 A;  2LVI A;  2PRU A;  2ZRT A;  2LCP A;  1S5G Y;  4XJK B;  4MZK A;  2M0R A;  1BF5 A;  1NSH A;  2Y1M A;  2K7D A;  3CGA A;  4ORA B;  2F3Z A;  4GBA A;  1U5I B;  1CB1 A;  4QJ4 B;  3E3R A;  3LCP C;  1H8B A;  3BUW B;  1RK9 A;  2LE9 B;  2IS9 A;  1OZS A;  3I5F C;  4QJ5 B;  1EL4 A;  1BR1 B;  1OMD A;  3EVR A;  3IQQ A;  5HLO A;  1IGV A;  2JZI A;  1GGZ A;  2JQ6 A;  3LK1 A;  3SG6 A;  2JXC A;  2I7A A;  3VRO A;  2LM5 A;  1FPW A;  4PE0 A;  2L51 A;  1DTL A;  3I5G B;  1XFX O;  4A4C A;  5ER4 X;  2MRD A;  1A4P A;  4N1F A;  5FYX A;  1TNX A;  1J7O A;  3VRR A;  3TDZ A;  1KQM B;  3OX6 A;  2BE6 A;  4CPV A;  1Y1A A;  4GGF A;  2OTG C;  2BKH B;  1SPY A;  2MA2 A;  5AFP A;  2TN4 A;  3SG3 A;  4GUK A;  3SIB A;  2QAC A;  3EK8 A;  2LC5 A;  3KO0 A;  3OP0 A;  3A4U B;  4GFT A;  5D7F A;  1YR5 A;  1CDP A;  2EC6 C;  2Q91 A;  5I8N A;  4PE4 A;  3NSK A;  1J7P A;  1QVI Y;  1QS7 A;  1MXL C;  2M8U A;  2MLF C;  3OHM B;  2WOS A;  4N5X A;  3EVU A;  1LA0 A;  4ICB A;  2KSP A;  2M97 A;  2KAX A;  4MVF A;  5I2L A;  4OV2 A;  4F0Z B;  2KGR A;  3BOW A;  2OS8 C;  1J1D A;  2BEC A;  2KFH A;  1WLZ A;  2WCB A;  1AJ4 A;  2Y1N A;  4PAL A;  4DS7 A;  1S6C A;  5J3X A;  4DIR A;  1SYM A;  2ZN9 A;  1D1O A;  2AMI A;  3BUM B;  3CTN A;  5GQQ C;  1QIV A;  3TS5 C;  3SG4 A;  3NSO A;  1BU3 A;  4XYN A;  2BL0 C;  1UUR A;  3PAT A;  1UWO A;  4OCI A;  1CLL A;  1SCM C;  1DT7 B;  2LP3 A;  1UP5 A;  2JC2 A;  5KSZ A;  3BUX B;  3O78 A;  4MSP A;  1ODB A;  2WCF A;  4JPZ B;  3VRP A;  5B8I B;  4D1E A;  1DJI A;  4YGA A;  1N65 A;  1M46 A;  2LLT A;  3GK4 X;  5G08 A;  1LXF C;  2B1U A;  2ZND A;  1S3P A;  3JVT C;  1K8U A;  1QLK A;  5KU1 A;  4NDD A;  3TZ1 A;  2L0P A;  1MUX A;  3BUO B;  3F45 A;  4YI8 A;  4JWQ A;  3EK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...