1JBAA

Unmyristoylated gcap-2 with three calcium ions bound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
GQQFSWEEAEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQYVEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDIVESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (GUANYLATE CYCLASE ACTIVATING PROTEIN 2)
publication title Three-dimensional structure of guanylyl cyclase activating protein-2, a calcium-sensitive modulator of photoreceptor guanylyl cyclases.
pubmed doi rcsb
source organism Bos taurus
total genus 41
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.2: Guanylate cyclase.
pdb deposition date 1999-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jbaA01
1GJYA 2PVBA 2BECA 1BR1B 1LA0A 1CFCA 3CR4X 1R6PA 3I5GC 1TNXA 4C0KA 4MZJA 3A8RA 2FOTA 3DVJA 4YRUA 5HKYA 1ALVA 2PSRA 3IQOA 1NCXA 4N1GA 1AK8A 1KK8B 1XFUO 3OB2B 2NLNA 1CFDA 3KO0A 3VGOA 3BQ3A 1LKJA 3A4UB 4HRGA 4N1FA 1QJTA 1QV0A 2KGBC 2LUXA 4GGNA 1D1OA 2L4HA 1KK7Y 1E8AA 5AANA 1MF8B 1AP4A 2KSPA 2COLB 5PALA 1KQMB 4BY4A 5I8NA 2JU0A 1QXPA 1ZUZA 2KI6D 1MR8A 4PE7A 1A2XA 4HRHA 1KFXL 4GGFA 1WRLA 4MN0A 1NX0A 1IWQA 3BUMB 1SW8A 2M1UA 3PFVA 4DUQA 1K9KA 2LLTA 1OMDA 2M0RA 4GFTA 2JTZA 1RJVA 1WLMA 2LHLA 1OOJA 1Y1UA 1NCYA 1N0YA 2WOSA 2I7AA 4GUKA 1DJIA 1KCYA 1MXLC 4YGCB 1B8CA 2AMIA 1NYAA 1Y1AA 4HREE 4I5KA 2GGZA 2L0PA 1MQ1A 2FCDA 3CTNA 3MSEB 2JXCA 3RM1A 1BMOA 2JT3A 1KK8C 2LLSA 1BG1A 2KFHA 2F3ZA 1QV1A 1TN4A 1RECA 2LP3A 2JT8A 1K8UA 4MZKA 2F2OA 2ZRSA 1BLQA 1CFPA 2KYCA 1K94A 1DJYA 2DOQA 4NDCA 1K96A 1KQMC 1SL8A 1AJ4A 5F6TA 1XK4C 3TS5B 1A75A 1JWDA 3CGAA 2E30A 4AOMA 1QVIZ 1XVJA 1A29A 2I2RE 2LMVA 2SCPA 3D0YB 2K7CA 1LXFC 2OS8B 3I5IB 1ZACA 2CT9A 3FWCA 3SG5A 1FF1A 4ORAB 5ER4X 2LCPA 2JRFA 1XFWO 1G33A 2HQWA 2I18A 1FI6A 3OX5A 1RROA 2KHNA 3DVKA 3JVTB 4N5XA 3AKAA 1YVLA 2BL0B 2ZN8A 2F8PA 2O5GA 3GK2A 1KFXS 2BE6A 4GNKB 1TNPA 5KU1A 1UHNA 2M29A 2L4IA 4P2YB 1EL4A 5KSZA 3NSLA 5CSFA 4AQJA 4DS7A 1F4QA 3CS1A 1WRKA 2EC6B 1IRJA 2KI6C 1KQVA 1ODBA 1CDMA 5D7FA 1YVHA 5DKRA 1AUIB 2M3WA 3TUYB 2R2IA 4GAOA 1IJ6A 1G8IA 2VRGA 2QPTA 2MLFC 3EK8A 4DIRA 3BOWA 1SR6B 1W7JB 2L2EA 3PM8A 4C0LA 1FI5A 2FCEA 2WCBA 3TS5C 1TNQA 2JNFA 2KYFA 2LMUA 1PSRA 1K93D 3CLNA 3EVVA 3KPXA 3LL8B 2AAOA 2KNEA 3O6BA 2L98A 2OS8C 1U5IA 3I5IC 2FJUB 1DVIA 1JF2A 2ZNEA 2WCFA 1S6JA 2Y5IA 1QX7A 2H61A 3JVTC 3AAJA 1CMFA 1K90D 2KFGA 2Q91A 2BL0C 1J1EA 2M49B 1EXRA 2BCAA 2JQ6A 4IL1A 3TDIA 4CFQA 1S6CA 1CKKA 4ORBB 1SPYA 1V1GA 4WRIA 2F2PA 1PSBA 1DGUA 1RTP1 2KGRA 3TDUA 1CLBA 3EVRA 1FBVA 2LANA 2KQYA 1SKTA 2EC6C 2KBMA 1LVCD 2Y1MA 3EKHA 3NSKA 1ZOTB 1DMOA 3TUYC 1CMGA 1VRKA 4XJKB 1DGVA 1S5GZ 2M7LA 1ZMZA 1GQMA 1JC2A 1B1GA 1SR6C 3HCMA 1PVBA 2JULA 1SY9A 1NPQA 1IQ3A 1Y1XA 2M8UA 4CLNA 4WQ2A 1DJWA 1L2OB 1NCZA 1S36A 4OR9B 5K89A 2GGMA 2KAXA 3O2PA 3VRQA 1IJ5A 2I94A 5HYDA 1F70A 1M63B 2G2BA 2Q4UA 1EG4A 2LLUA 1DJZA 1QTXA 2ZKMX 1K9PA 2KI4B 3CWGA 1LINA 1A4PA 1ZFSA 4WQ3A 1CM1A 1PVAA 1UUSA 1WY9A 1YUSA 2ISDA 4NDBA 2M1KB 2JT0A 4AQIA 1PULA 2KDHA 1OE9B 1Q80A 1SCMB 1K9UA 2A4JA 1QLKA 1CM4A 5AERA 2ZRTA 1A03A 1XYDA 1NP8A 1NIWA 5HLOA 2OTGB 2CCMA 1F54A 1BJFA 2JOJA 3CZTX 1B7TY 1NX2A 3CR5X 3EKJA 3BYAA 3LLEA 1OMVA 2LV7A 1NWDA 2K7DA 2LUCA 1KK7Z 3PLFB 3SG2A 4MEWA 1IKUA 1UWOA 1N65A 4FTGA 1A75B 1ALWA 3EVUA 4GGFC 1F8HA 1S3PA 3BXKA 3I5HB 1AJ5A 3NSIA 1JBAA 1L2OC 3GOFA 2WORA 1RWYA 1XFXO 1OZOA 1YX8A 3TZ1A 2WC8A 2D8NA 4XYNA 4QJ4B 2BCBA 3FWBA 1QS7A 2BE4A 2K2AA 3JTDC 1CFFA 4PE4A 1F55A 1OSAA 1TNWA 2KI4C 1NX3A 1QIWA 1IH0A 4QJ5B 1HT9A 1TCFA 3IF7A 3C1VA 1QIVA 5FYXA 4PHKA 2CNPA 3O4YA 2PRUA 3PN7B 4DRWA 1M31A 1YX7A 1UHJA 4USLA 3DF0B 2H2KA 1CDLA 1SCMC 1TIZA 1KWOC 3GK1A 2KOTA 2JZIA 1BOCA 1CLLA 2CXJA 5D69A 1YURA 2O60A 3KHEA 2OTGC 4L9MA 1HQVA 1PALA 5BPJA 1TRFA 1XA5A 2LVKA 4ICBA 2BBMA 1IGVA 3AKBA 1R2UA 1DJHA 3BOWB 5DKQA 1C07A 3DVMA 2TN4A 3BUOB 1JF0A 2K0JA 4MBEA 4MLWA 1AVSA 4YGEB 1Y6WA 2Y4QA 5I2LA 2K61A 3I5HC 4M2OA 1J1DA 1SNLA 2EHBA 1U5IB 4PHJA 4MSPA 4MRXA 1H8BA 3OP0A 2NZ0A 1TTXA 4ORCB 2JXLA 1XFZO 5CSIA 1NUBA 1MWNA 2KBIA 2JC2A 2M9GA 4UPGA 3WHUB 1RFJA 3PSRA 1QLSA 2BKHB 1SL9A 4OV2A 5CPVA 1M39A 3ZWHA 1YRUB 4Q04A 1K95A 4BY5A 3PN7C 5GQQC 3D10A 1KFUS 2K8MB 2KAYA 5HKZA 4R1EA 2B1UA 1BT6A 1SBJA 2HF5A 2AUCA 2ZNDA 1JSAA 1B47A 4M2PA 3TDZA 2M97A 5KTYA 1QX2A 1J7RA 2LHIA 1DF0A 1WDCC 2LAPA 3WHTB 4DCKA 1CDNA 1B9AA 1BR4B 1C7VA 1DTLA 1XO5A 1YRTB 1J7QA 2EGDA 1S1EA 2GV5A 4NDDA 2MLEC 4D1EA 3EK7A 1TCOB 5JJGA 1YUUA 5B8IB 1KSOA 1S26D 1SK6D 4ETOA 1SL7A 3AAKA 3PATA 1DJXA 2LP2A 2K7OA 3F45A 3VRPA 1WRZA 4PHNA 5CSJA 2H61C 3SIAA 3JTDB 1KSMA 1TOPA 3OHMB 3QRXA 3DD4A 1UURA 4M2QA 1V1FA 2LMTA 4GPLB 4I5JA 4HSZA 4TNCA 5DKNA 1JFJA 1J7OA 4XJKA 2IS9A 5HLVA 1XFVO 2M7NA 2V53A 1SMGA 1MHOA 1AHRA 2BCXA 1YTZC 2PMYA 3LCPC 4PALA 2OPOA 2KFFA 1GGZA 2L5XB 1QX5B 2NCOA 1YUTA 1RK9A 3SG3A 1QVIY 3BUWB 3VRRA 1XK4A 1OZSA 5I2OA 1KWOB 1X02A 1C7WA 1M45A 2E6WA 2QACA 4C0JA 1LA3A 4JWQA 4YGBB 3SG4A 1F4OA 4YGAA 5J3XA 1BF5A 1JFKA 1N2DA 2WNDA 2KAVA 4NQGA 1OQPA 2NXQA 4A4CA 4E68A 4PCWA 1JUOA 1H4BA 1MXEA 2LVVA 4F0ZB 4GBAA 4ZCVA 3FS7A 5JOLA 1J55A 1G4YR 3BUNB 2F33A 2CTNA 2MAZA 4CIDA 2L50A 3I5FB 1B8LA 2CBLA 3HX4A 1SRAA 1GGWA 4MZLA 1KFUL 3EK4A 2JPTA 2ZFDA 4PHMA 4CPVA 1FW4A 4PE0A 2L51A 1EH2A 2PALA 5G08A 5CSNA 1WLZA 1L7ZA 2BKIB 2JWWA 4A4BA 2MRDA 3SG6A 4I5NB 1IQ5A 1UHHA 3BUXB 2JNXA 3K21A 2MJWB 3KF9A 4U8DA 1FPWA 3O78A 3CR2A 3SG7A 5HKWA 1OMRA 1QATA 1CDPA 3IQQA 1PK0D 5ER5A 4MRYA 1QASA 4OVNF 2K7BA 2NCPA 4JPZB 2SASA 2Y1NA 4JQ0D 1CNPA 2LVJA 1BODA 3D0YA 3SIBA 3ICBA 1NSHA 3H4SE 1WDCB 4YGDB 1PRWA 4YI8A 1BU3A 4PDZA 1B7TZ 2KQ6A 2K2FA 4PE1A 3NXAA 4P5OE 1J7PA 2G9BA 2LVIA 4ZCUA 4I5LB 2LE9B 2MHHA 5IBWA 1DT7B 3I5GB 1F71A 2MBXA 1MUXA 1YR5A 5TNCA 4YI9A 2WCEA 3I5FC 1CB1A 1UP5A 1UHKA 3KEVA 3VROA 3DF0A 1CTRA 2HETA 2PASA 4OKHA 2LNKA 3E3RA 4MVFA 1UHIA 1B8RA 3ZNIA 4QJ3B 5AXIA 1EG3A 3VRNA 1S5GY 3WNXB 2JTTA 5AEQA 1SCVA 4FQOA 3SJSA 2RGIA 1B4CA 2P6BB 1Y0VH 3PALA 1S6IA 3OX6A 3RLZA 3LK0A 2HQ8A 1CLMA 2MA2A 3WXAA 1SYMA 2F3YA 1K2HA 1W7IB 3GK4X 2HPSA 3NSOA 4CFRA 2ZN9A 1DF0B 4YBHB 5AFPA 1NX1A 2LC5A 3DVEA 3OB1B 1IG5A 4OCIA 3FIAA 5I2QA 2LM5A 1M46A 2BBNA 3M0WA 1EJ3A 1DJGA 3LK1A 1XFYO
chains in the Genus database with same CATH superfamily
1GJYA 2PVBA 2BECA 1BR1B 1LA0A 1CFCA 3CR4X 1R6PA 3I5GC 1TNXA 3PM2A 4C0KA 4MZJA 3A8RA 2FOTA 3DVJA 4YRUA 5HKYA 1ALVA 2PSRA 3IQOA 1NCXA 2WC6A 4N1GA 1AK8A 1KK8B 1XFUO 2L2CA 3OB2B 2NLNA 1CFDA 3KO0A 3VGOA 3BQ3A 1LKJA 3A4UB 2P71A 4HRGA 4N1FA 1QJTA 1QV0A 2KGBC 1DELA 2FJYA 2LUXA 4GGNA 1D1OA 2L4HA 1KK7Y 1SSEB 3S0DA 1E8AA 5AANA 1IIOA 1MF8B 1AP4A 2KSPA 2COLB 5PALA 1KQMB 5EL2A 3BFHA 4BY4A 5I8NA 2JU0A 1QXPA 1ZUZA 2KI6D 1MR8A 2KLEA 3L4LA 4PE7A 3S0BA 1A2XA 2P70A 4HRHA 1KFXL 4GGFA 3OBVA 1WRLA 4MN0A 4JKTA 1NX0A 1IWQA 3BUMB 1SW8A 2M1UA 3PFVA 3D74A 2KLDA 4DUQA 1K9KA 2LLTA 1OMDA 2M0RA 4GFTA 2JTZA 1RJVA 1WLMA 2LHLA 1OOJA 1Y1UA 1NCYA 1N0YA 2WOSA 2I7AA 4GUKA 1DJIA 1KCYA 1MXLC 4YGCB 1B8CA 2AMIA 3SS4A 1NYAA 1Y1AA 4HREE 4I5KA 2GGZA 2L0PA 3R1OA 1MQ1A 2FCDA 4PT1A 3CTNA 3MSEB 2JXCA 3RM1A 1BMOA 2JT3A 1KK8C 2LLSA 1BG1A 2KFHA 3R72A 2F3ZA 1QV1A 1TN4A 1RECA 2LP3A 2JT8A 1K8UA 4MZKA 2F2OA 2ZRSA 1BLQA 4INWA 1CFPA 2KYCA 1K94A 1OOFA 1DJYA 2DOQA 4NDCA 1K96A 1KQMC 1SL8A 1AJ4A 3EG5B 5F6TA 5DICA 1XK4C 3TS5B 1A75A 1JWDA 3B86A 3CGAA 2E30A 3SS5A 4AOMA 1QVIZ 1W9ZA 1XVJA 1A29A 3CZ2A 2I2RE 2LMVA 2SCPA 3D0YB 2K7CA 1LXFC 2OS8B 3I5IB 1ZACA 2CT9A 3FWCA 3SG5A 1FF1A 4ORAB 5ER4X 2LCPA 1XFRA 2JRFA 1XFWO 1G33A 2HQWA 2I18A 1FI6A 3OX5A 1RROA 2KHNA 3DVKA 3JVTB 3RZSA 4N5XA 3AKAA 1YVLA 2BL0B 2ZN8A 2F8PA 2O5GA 3GK2A 1KFXS 2BE6A 4GNKB 1TNPA 5KU1A 1UHNA 2M29A 3DYEA 2L4IA 4P2YB 1EL4A 5KSZA 3NSLA 5CSFA 4AQJA 4DS7A 3BJHA 1F4QA 3CS1A 1WRKA 2EC6B 1IRJA 2KI6C 1KQVA 2ERBA 1ODBA 1CDMA 5D7FA 1YVHA 5DKRA 1AUIB 2M3WA 3TUYB 2R2IA 4GAOA 3V2LA 1IJ6A 1G8IA 2VRGA 2QPTA 2MLFC 3EK8A 4FQTA 4DIRA 3BOWA 1SR6B 1W7JB 2L2EA 3PM8A 4C0LA 1FI5A 2FCEA 2WCBA 3TS5C 1TNQA 2JNFA 2KYFA 2LMUA 1PSRA 1K93D 3CLNA 3DY9A 3EVVA 3KPXA 3LL8B 2AAOA 2KNEA 2PYQA 2WCHA 3O6BA 2L98A 2OS8C 2QEOA 1U5IA 3I5IC 2FJUB 1DVIA 3L4AA 3R1VA 1JF2A 5HL1A 3OGNA 2ZNEA 3D73A 2WCFA 1S6JA 2Y5IA 1QX7A 2H61A 3JVTC 3AAJA 1CMFA 1K90D 2KFGA 2Q91A 2BL0C 1LS8A 1J1EA 2M49B 1EXRA 2BCAA 5D3OA 2JQ6A 4IL1A 3TDIA 4CFQA 3K1EA 1S6CA 1CKKA 4ORBB 1SPYA 1V1GA 4WRIA 2F2PA 1PSBA 1DGUA 1RTP1 2KGRA 3TDUA 1CLBA 3EVRA 1FBVA 2LANA 2KQYA 1SKTA 2EC6C 2KBMA 1LVCD 2Y1MA 3EKHA 3NSKA 1ZOTB 1DMOA 3D78A 3TUYC 1TUJA 1VRKA 1CMGA 4XJKB 1DGVA 1S5GZ 2M7LA 1ZMZA 1GQMA 1JC2A 1B1GA 2JPOA 1SR6C 3HCMA 1PVBA 2JULA 1SY9A 1NPQA 1IQ3A 1Y1XA 2M8UA 4CLNA 4WQ2A 1DJWA 3S0GA 1L2OB 1NCZA 1S36A 4OR9B 5K89A 2GGMA 2KAXA 3B88A 3O2PA 3VRQA 1IJ5A 2I94A 5HYDA 1F70A 1M63B 2G2BA 2Q4UA 1EG4A 1OOHA 2LLUA 1DJZA 1QTXA 2ZKMX 1K9PA 2KI4B 3CWGA 1LINA 1A4PA 1ZFSA 3CABA 4WQ3A 1CM1A 1PVAA 1UUSA 1WY9A 1YUSA 2ISDA 4NDBA 2M1KB 2JT0A 4AQIA 1PULA 2KDHA 1OE9B 1Q80A 1SCMB 1K9UA 1QLKA 2A4JA 1CM4A 5AERA 4JD9A 2ZRTA 1A03A 1XYDA 1NP8A 3B6XA 1NIWA 5HLOA 2OTGB 2CCMA 1F54A 1BJFA 2JOJA 3CZTX 1B7TY 1NX2A 3CR5X 3EKJA 3BYAA 3LLEA 1OMVA 2LV7A 1NWDA 2K7DA 2LUCA 1KK7Z 3PLFB 3SG2A 4MEWA 1IKUA 1UWOA 1N65A 4FTGA 1A75B 1ALWA 1OW4A 3EVUA 3B87A 4GGFC 1F8HA 1S3PA 4KYNA 3BXKA 2QDIA 3I5HB 1AJ5A 3NSIA 1JBAA 1L2OC 3GOFA 2WORA 1RWYA 1XFXO 1OZOA 1YX8A 3TZ1A 2WC8A 4F7FA 2D8NA 4XYNA 4QJ4B 2BCBA 3IVTA 3FWBA 3SS3A 1QS7A 2BE4A 2K2AA 3JTDC 1CFFA 4PE4A 1F55A 1OSAA 3N7HA 1TNWA 2KI4C 3DXLA 1NX3A 1QIWA 3B7AA 1IH0A 4QJ5B 1HT9A 1TCFA 3IF7A 3C1VA 1QIVA 5FYXA 4PHKA 2CNPA 3O4YA 2PRUA 3PN7B 4DRWA 2WCLA 1M31A 1YX7A 3L47A 1UHJA 4USLA 3DF0B 2H2KA 1CDLA 1SCMC 1TIZA 1KWOC 3GK1A 2KOTA 2JZIA 1BOCA 1CLLA 2CXJA 3FE9A 5D69A 1YURA 2O60A 3KHEA 2OTGC 4L9MA 1HQVA 2GTEA 4INXA 1PALA 3VB1A 5BPJA 1TRFA 1XA5A 2LVKA 4ICBA 2BBMA 1C3ZA 1IGVA 1Z2CB 3AKBA 1R2UA 1DJHA 3BOWB 1TWOA 5DKQA 1C07A 2WCKA 3DVMA 2TN4A 3BUOB 1JF0A 2K0JA 4MBEA 4MLWA 1AVSA 4YGEB 1Y6WA 2Y4QA 5I2LA 2K61A 3I5HC 4M2OA 1J1DA 1SNLA 2EHBA 1U5IB 4PHJA 1ORGA 4MSPA 4MRXA 1H8BA 3OP0A 1DEKA 2NZ0A 1DQEA 1TTXA 4ORCB 2JXLA 1XFZO 2BNXA 1NUBA 1MWNA 3CZ0A 2KBIA 2JC2A 2L5YA 2M9GA 5CSIA 4UPGA 3WHUB 1RFJA 3PSRA 1QLSA 2BKHB 1SL9A 4OV2A 3CYZA 5CPVA 1M39A 3ZWHA 1YRUB 4Q04A 1K95A 4BY5A 3PN7C 5GQQC 3D10A 1KFUS 2K8MB 2KAYA 5HKZA 4R1EA 2B1UA 1BT6A 1SBJA 2HF5A 2AUCA 2ZNDA 1JSAA 1B47A 4M2PA 3TDZA 2M97A 5KTYA 1QX2A 1J7RA 2LHIA 1DF0A 1WDCC 2LAPA 4OZDA 3WHTB 4DCKA 1CDNA 1B9AA 1BR4B 2PQLA 1C7VA 3CZ1A 1DTLA 1XO5A 1YRTB 1J7QA 2EGDA 1S1EA 2BAPA 2GV5A 4NDDA 2MLEC 4D1EA 3EK7A 3FE6A 2K60A 1TCOB 5JJGA 1YUUA 5FI6A 1KSOA 5B8IB 1S26D 1SK6D 1DC1A 4ETOA 3O4XA 1SL7A 3AAKA 3FE8A 3PATA 3UO9A 3Q8IA 1DJXA 2LP2A 2K7OA 3F45A 3VRPA 1WRZA 4PHNA 5CSJA 2H61C 3SIAA 3JTDB 1KSMA 1TOPA 3OHMB 3QRXA 3DD4A 1UURA 4M2QA 1V1FA 2LMTA 4GPLB 4I5JA 4HSZA 4TNCA 5DKNA 1JFJA 1J7OA 1T14A 4XJKA 2QEVA 2IS9A 2WCJA 5HLVA 1XFVO 2M7NA 2V53A 1SMGA 1MHOA 1AHRA 2BCXA 1YTZC 2PMYA 3LCPC 4PALA 2OPOA 2KFFA 1GGZA 2L5XB 1QX5B 2WCMA 2NCOA 1YUTA 1RK9A 3SG3A 1QVIY 3BUWB 3VRRA 1XK4A 1OZSA 5I2OA 1KWOB 1X02A 1C7WA 1M45A 2E6WA 2QACA 3QMEA 1LA3A 2KPHA 4C0JA 4JWQA 4YGBB 3SG4A 1F4OA 4YGAA 5J3XA 1BF5A 1JFKA 1N2DA 2WNDA 3DZTA 5FI7A 2KAVA 4NQGA 1OQPA 2NXQA 3D77A 4A4CA 5I94A 4E68A 4PCWA 1JUOA 1H4BA 1MXEA 1TUZA 2LVVA 1GM0A 4F0ZB 4GBAA 4ZCVA 3D76A 3FS7A 1G4YR 1J55A 3BUNB 2F33A 5JOLA 2CTNA 2MAZA 3NGVA 3CDNA 4CIDA 2L50A 3I5FB 1B8LA 2CBLA 3HX4A 1SRAA 1GGWA 4MZLA 1KFUL 3EK4A 2JPTA 2ZFDA 4PHMA 4CPVA 1FW4A 4PE0A 2L51A 3UNWA 1EH2A 2PALA 5G08A 5CSNA 1OOGA 1WLZA 1L7ZA 2BKIB 2JWWA 3R1PA 4A4BA 3NHIA 2MRDA 3S0FA 3SG6A 4I5NB 1IQ5A 1UHHA 3BUXB 2JNXA 3D75A 2MJWB 3K21A 3KF9A 4U8DA 1FPWA 3O78A 3CR2A 2QEHA 5HKWA 3S0EA 1QWVA 3SG7A 1Z4HA 1OMRA 1QATA 1CDPA 2YGUA 3IQQA 1PK0D 5ER5A 4MRYA 1QASA 4OVNF 2K7BA 2NCPA 4JPZB 2SASA 2Y1NA 4JQ0D 1CNPA 2LVJA 1BODA 3D0YA 3SIBA 3ICBA 1NSHA 3H4SE 1WDCB 4YGDB 1PRWA 4YI8A 1BU3A 4PDZA 1B7TZ 2KQ6A 2K2FA 4PE1A 3NXAA 4P5OE 1J7PA 2G9BA 2LVIA 4ZCUA 4I5LB 2LE9B 4IJ7A 2MHHA 5IBWA 1DT7B 2H8VA 3I5GB 1F71A 2MBXA 1MUXA 1YR5A 5TNCA 4YI9A 2WCEA 3I5FC 1CB1A 1UP5A 1UHKA 3KEVA 3VROA 3DF0A 1CTRA 2HETA 2PASA 4OKHA 1C3YA 2LNKA 3E3RA 4MVFA 1UHIA 1B8RA 3ZNIA 4QJ3B 5AXIA 1EG3A 3VRNA 1S5GY 3WNXB 1P28A 2JTTA 5AEQA 1SCVA 2QEBA 4FQOA 3SJSA 2RGIA 1B4CA 2P6BB 1Y0VH 3PALA 1S6IA 3OX6A 3RLZA 3LK0A 2HQ8A 1CLMA 2MA2A 3WXAA 5FI2A 1SYMA 2F3YA 1K2HA 1W7IB 3GK4X 2HPSA 3NSOA 3PJIA 4CFRA 1OOIX 2ZN9A 1DF0B 4YBHB 5AFPA 1NX1A 2LC5A 3DVEA 3OB1B 1IG5A 4OCIA 3FIAA 5I2QA 3BFAA 2LM5A 1M46A 2BBNA 3BFBA 2WC5A 3M0WA 1EJ3A 3NHTA 3S0AA 1DJGA 3LK1A 1XFYO
chains in the Genus database with same CATH topology
1GJYA 2PVBA 2BECA 1BR1B 1LA0A 1CFCA 3CR4X 1R6PA 3I5GC 1TNXA 4C0KA 4MZJA 3A8RA 2FOTA 3DVJA 4YRUA 5HKYA 1ALVA 2PSRA 3IQOA 1NCXA 4N1GA 1AK8A 1KK8B 1XFUO 3OB2B 2NLNA 1CFDA 3KO0A 3VGOA 3BQ3A 1LKJA 3A4UB 4HRGA 4N1FA 1QJTA 1QV0A 2KGBC 2LUXA 4GGNA 1D1OA 2L4HA 1KK7Y 1E8AA 5AANA 1MF8B 1AP4A 2KSPA 2COLB 5PALA 1KQMB 4BY4A 5I8NA 2JU0A 1QXPA 1ZUZA 2KI6D 1MR8A 4PE7A 1A2XA 4HRHA 1KFXL 4GGFA 1WRLA 4MN0A 1NX0A 1IWQA 3BUMB 1SW8A 2M1UA 3PFVA 4DUQA 1K9KA 2LLTA 1OMDA 2M0RA 4GFTA 2JTZA 1RJVA 1WLMA 2LHLA 1OOJA 1Y1UA 1NCYA 1N0YA 2WOSA 2I7AA 4GUKA 1DJIA 1KCYA 1MXLC 4YGCB 1B8CA 2AMIA 1NYAA 1Y1AA 4HREE 4I5KA 2GGZA 2L0PA 1MQ1A 2FCDA 3CTNA 3MSEB 2JXCA 3RM1A 1BMOA 2JT3A 1KK8C 2LLSA 1BG1A 2KFHA 2F3ZA 1QV1A 1TN4A 1RECA 2LP3A 2JT8A 1K8UA 4MZKA 2F2OA 2ZRSA 1BLQA 1CFPA 2KYCA 1K94A 1DJYA 2DOQA 4NDCA 1K96A 1KQMC 1SL8A 1AJ4A 5F6TA 1XK4C 3TS5B 1A75A 1JWDA 3CGAA 2E30A 4AOMA 1QVIZ 1XVJA 1A29A 2I2RE 2LMVA 2SCPA 3D0YB 2K7CA 1LXFC 2OS8B 3I5IB 1ZACA 2CT9A 3FWCA 3SG5A 1FF1A 4ORAB 5ER4X 2LCPA 2JRFA 1XFWO 1G33A 2HQWA 2I18A 1FI6A 3OX5A 1RROA 2KHNA 3DVKA 3JVTB 4N5XA 3AKAA 1YVLA 2BL0B 2ZN8A 2F8PA 2O5GA 3GK2A 1KFXS 2BE6A 4GNKB 1TNPA 5KU1A 1UHNA 2M29A 2L4IA 4P2YB 1EL4A 5KSZA 3NSLA 5CSFA 4AQJA 4DS7A 1F4QA 3CS1A 1WRKA 2EC6B 1IRJA 2KI6C 1KQVA 1ODBA 1CDMA 5D7FA 1YVHA 5DKRA 1AUIB 2M3WA 3TUYB 2R2IA 4GAOA 1IJ6A 1G8IA 2VRGA 2QPTA 2MLFC 3EK8A 4DIRA 3BOWA 1SR6B 1W7JB 2L2EA 3PM8A 4C0LA 1FI5A 2FCEA 2WCBA 3TS5C 1TNQA 2JNFA 2KYFA 2LMUA 1PSRA 1K93D 3CLNA 3EVVA 3KPXA 3LL8B 2AAOA 2KNEA 3O6BA 2L98A 2OS8C 1U5IA 3I5IC 2FJUB 1DVIA 1JF2A 2ZNEA 2WCFA 1S6JA 2Y5IA 1QX7A 2H61A 3JVTC 3AAJA 1CMFA 1K90D 2KFGA 2Q91A 2BL0C 1J1EA 2M49B 1EXRA 2BCAA 2JQ6A 4IL1A 3TDIA 4CFQA 1S6CA 1CKKA 4ORBB 1SPYA 1V1GA 4WRIA 2F2PA 1PSBA 1DGUA 1RTP1 2KGRA 3TDUA 1CLBA 3EVRA 1FBVA 2LANA 2KQYA 1SKTA 2EC6C 2KBMA 1LVCD 2Y1MA 3EKHA 3NSKA 1ZOTB 1DMOA 3TUYC 1CMGA 1VRKA 4XJKB 1DGVA 1S5GZ 2M7LA 1ZMZA 1GQMA 1JC2A 1B1GA 1SR6C 3HCMA 1PVBA 2JULA 1SY9A 1NPQA 1IQ3A 1Y1XA 2M8UA 4CLNA 4WQ2A 1DJWA 1L2OB 1NCZA 1S36A 4OR9B 5K89A 2GGMA 2KAXA 3O2PA 3VRQA 1IJ5A 2I94A 5HYDA 1F70A 1M63B 2G2BA 2Q4UA 1EG4A 2LLUA 1DJZA 1QTXA 2ZKMX 1K9PA 2KI4B 3CWGA 1LINA 1A4PA 1ZFSA 4WQ3A 1CM1A 1PVAA 1UUSA 1WY9A 1YUSA 2ISDA 4NDBA 2M1KB 2JT0A 4AQIA 1PULA 2KDHA 1OE9B 1Q80A 1SCMB 1K9UA 2A4JA 1QLKA 1CM4A 5AERA 2ZRTA 1A03A 1XYDA 1NP8A 1NIWA 5HLOA 2OTGB 2CCMA 1F54A 1BJFA 2JOJA 3CZTX 1B7TY 1NX2A 3CR5X 3EKJA 3BYAA 3LLEA 1OMVA 2LV7A 1NWDA 2K7DA 2LUCA 1KK7Z 3PLFB 3SG2A 4MEWA 1IKUA 1UWOA 1N65A 4FTGA 1A75B 1ALWA 3EVUA 4GGFC 1F8HA 1S3PA 3BXKA 3I5HB 1AJ5A 3NSIA 1JBAA 1L2OC 3GOFA 2WORA 1RWYA 1XFXO 1OZOA 1YX8A 3TZ1A 2WC8A 2D8NA 4XYNA 4QJ4B 2BCBA 3FWBA 1QS7A 2BE4A 2K2AA 3JTDC 1CFFA 4PE4A 1F55A 1OSAA 1TNWA 2KI4C 1NX3A 1QIWA 1IH0A 4QJ5B 1HT9A 1TCFA 3IF7A 3C1VA 1QIVA 5FYXA 4PHKA 2CNPA 3O4YA 2PRUA 3PN7B 4DRWA 1M31A 1YX7A 1UHJA 4USLA 3DF0B 2H2KA 1CDLA 1SCMC 1TIZA 1KWOC 3GK1A 2KOTA 2JZIA 1BOCA 1CLLA 2CXJA 5D69A 1YURA 2O60A 3KHEA 2OTGC 4L9MA 1HQVA 1PALA 5BPJA 1TRFA 1XA5A 2LVKA 4ICBA 2BBMA 1IGVA 3AKBA 1R2UA 1DJHA 3BOWB 5DKQA 1C07A 3DVMA 2TN4A 3BUOB 1JF0A 2K0JA 4MBEA 4MLWA 1AVSA 4YGEB 1Y6WA 2Y4QA 5I2LA 2K61A 3I5HC 4M2OA 1J1DA 1SNLA 2EHBA 1U5IB 4PHJA 4MSPA 4MRXA 1H8BA 3OP0A 2NZ0A 1TTXA 4ORCB 2JXLA 1XFZO 5CSIA 1NUBA 1MWNA 2KBIA 2JC2A 2M9GA 4UPGA 3WHUB 1RFJA 3PSRA 1QLSA 2BKHB 1SL9A 4OV2A 5CPVA 1M39A 3ZWHA 1YRUB 4Q04A 1K95A 4BY5A 3PN7C 5GQQC 3D10A 1KFUS 2K8MB 2KAYA 5HKZA 4R1EA 2B1UA 1BT6A 1SBJA 2HF5A 2AUCA 2ZNDA 1JSAA 1B47A 4M2PA 3TDZA 2M97A 5KTYA 1QX2A 1J7RA 2LHIA 1DF0A 1WDCC 2LAPA 3WHTB 4DCKA 1CDNA 1B9AA 1BR4B 1C7VA 1DTLA 1XO5A 1YRTB 1J7QA 2EGDA 1S1EA 2GV5A 4NDDA 2MLEC 4D1EA 3EK7A 1TCOB 5JJGA 1YUUA 5B8IB 1KSOA 1S26D 1SK6D 4ETOA 1SL7A 3AAKA 3PATA 1DJXA 2LP2A 2K7OA 3F45A 3VRPA 1WRZA 4PHNA 5CSJA 2H61C 3SIAA 3JTDB 1KSMA 1TOPA 3OHMB 3QRXA 3DD4A 1UURA 4M2QA 1V1FA 2LMTA 4GPLB 4I5JA 4HSZA 4TNCA 5DKNA 1JFJA 1J7OA 4XJKA 2IS9A 5HLVA 1XFVO 2M7NA 2V53A 1SMGA 1MHOA 1AHRA 2BCXA 1YTZC 2PMYA 3LCPC 4PALA 2OPOA 2KFFA 1GGZA 2L5XB 1QX5B 2NCOA 1YUTA 1RK9A 3SG3A 1QVIY 3BUWB 3VRRA 1XK4A 1OZSA 5I2OA 1KWOB 1X02A 1C7WA 1M45A 2E6WA 2QACA 4C0JA 1LA3A 4JWQA 4YGBB 3SG4A 1F4OA 4YGAA 5J3XA 1BF5A 1JFKA 1N2DA 2WNDA 2KAVA 4NQGA 1OQPA 2NXQA 4A4CA 4E68A 4PCWA 1JUOA 1H4BA 1MXEA 2LVVA 4F0ZB 4GBAA 4ZCVA 3FS7A 5JOLA 1J55A 1G4YR 3BUNB 2F33A 2CTNA 2MAZA 4CIDA 2L50A 3I5FB 1B8LA 2CBLA 3HX4A 1SRAA 1GGWA 4MZLA 1KFUL 3EK4A 2JPTA 2ZFDA 4PHMA 4CPVA 1FW4A 4PE0A 2L51A 1EH2A 2PALA 5G08A 5CSNA 1WLZA 1L7ZA 2BKIB 2JWWA 4A4BA 2MRDA 3SG6A 4I5NB 1IQ5A 1UHHA 3BUXB 2JNXA 3K21A 2MJWB 3KF9A 4U8DA 1FPWA 3O78A 3CR2A 3SG7A 5HKWA 1OMRA 1QATA 1CDPA 3IQQA 1PK0D 5ER5A 4MRYA 1QASA 4OVNF 2K7BA 2NCPA 4JPZB 2SASA 2Y1NA 4JQ0D 1CNPA 2LVJA 1BODA 3D0YA 3SIBA 3ICBA 1NSHA 3H4SE 1WDCB 4YGDB 1PRWA 4YI8A 1BU3A 4PDZA 1B7TZ 2KQ6A 2K2FA 4PE1A 3NXAA 4P5OE 1J7PA 2G9BA 2LVIA 4ZCUA 4I5LB 2LE9B 2MHHA 5IBWA 1DT7B 3I5GB 1F71A 2MBXA 1MUXA 1YR5A 5TNCA 4YI9A 2WCEA 3I5FC 1CB1A 1UP5A 1UHKA 3KEVA 3VROA 3DF0A 1CTRA 2HETA 2PASA 4OKHA 2LNKA 3E3RA 4MVFA 1UHIA 1B8RA 3ZNIA 4QJ3B 5AXIA 1EG3A 3VRNA 1S5GY 3WNXB 2JTTA 5AEQA 1SCVA 4FQOA 3SJSA 2RGIA 1B4CA 2P6BB 1Y0VH 3PALA 1S6IA 3OX6A 3RLZA 3LK0A 2HQ8A 1CLMA 2MA2A 3WXAA 1SYMA 2F3YA 1K2HA 1W7IB 3GK4X 2HPSA 3NSOA 4CFRA 2ZN9A 1DF0B 4YBHB 5AFPA 1NX1A 2LC5A 3DVEA 3OB1B 1IG5A 4OCIA 3FIAA 5I2QA 2LM5A 1M46A 2BBNA 3M0WA 1EJ3A 1DJGA 3LK1A 1XFYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJY A;  2PVB A;  2BEC A;  1BR1 B;  1LA0 A;  1CFC A;  3CR4 X;  1R6P A;  3I5G C;  1TNX A;  4C0K A;  4MZJ A;  3A8R A;  2FOT A;  3DVJ A;  4YRU A;  5HKY A;  1ALV A;  2PSR A;  3IQO A;  1NCX A;  4N1G A;  1AK8 A;  1KK8 B;  1XFU O;  3OB2 B;  2NLN A;  1CFD A;  3KO0 A;  3VGO A;  3BQ3 A;  1LKJ A;  3A4U B;  4HRG A;  4N1F A;  1QJT A;  1QV0 A;  2KGB C;  2LUX A;  4GGN A;  1D1O A;  2L4H A;  1KK7 Y;  1E8A A;  5AAN A;  1MF8 B;  1AP4 A;  2KSP A;  2COL B;  5PAL A;  1KQM B;  4BY4 A;  5I8N A;  2JU0 A;  1QXP A;  1ZUZ A;  2KI6 D;  1MR8 A;  4PE7 A;  1A2X A;  4HRH A;  1KFX L;  4GGF A;  1WRL A;  4MN0 A;  1NX0 A;  1IWQ A;  3BUM B;  1SW8 A;  2M1U A;  3PFV A;  4DUQ A;  1K9K A;  2LLT A;  1OMD A;  2M0R A;  4GFT A;  2JTZ A;  1RJV A;  1WLM A;  2LHL A;  1OOJ A;  1Y1U A;  1NCY A;  1N0Y A;  2WOS A;  2I7A A;  4GUK A;  1DJI A;  1KCY A;  1MXL C;  4YGC B;  1B8C A;  2AMI A;  1NYA A;  1Y1A A;  4HRE E;  4I5K A;  2GGZ A;  2L0P A;  1MQ1 A;  2FCD A;  3CTN A;  3MSE B;  2JXC A;  3RM1 A;  1BMO A;  2JT3 A;  1KK8 C;  2LLS A;  1BG1 A;  2KFH A;  2F3Z A;  1QV1 A;  1TN4 A;  1REC A;  2LP3 A;  2JT8 A;  1K8U A;  4MZK A;  2F2O A;  2ZRS A;  1BLQ A;  1CFP A;  2KYC A;  1K94 A;  1DJY A;  2DOQ A;  4NDC A;  1K96 A;  1KQM C;  1SL8 A;  1AJ4 A;  5F6T A;  1XK4 C;  3TS5 B;  1A75 A;  1JWD A;  3CGA A;  2E30 A;  4AOM A;  1QVI Z;  1XVJ A;  1A29 A;  2I2R E;  2LMV A;  2SCP A;  3D0Y B;  2K7C A;  1LXF C;  2OS8 B;  3I5I B;  1ZAC A;  2CT9 A;  3FWC A;  3SG5 A;  1FF1 A;  4ORA B;  5ER4 X;  2LCP A;  2JRF A;  1XFW O;  1G33 A;  2HQW A;  2I18 A;  1FI6 A;  3OX5 A;  1RRO A;  2KHN A;  3DVK A;  3JVT B;  4N5X A;  3AKA A;  1YVL A;  2BL0 B;  2ZN8 A;  2F8P A;  2O5G A;  3GK2 A;  1KFX S;  2BE6 A;  4GNK B;  1TNP A;  5KU1 A;  1UHN A;  2M29 A;  2L4I A;  4P2Y B;  1EL4 A;  5KSZ A;  3NSL A;  5CSF A;  4AQJ A;  4DS7 A;  1F4Q A;  3CS1 A;  1WRK A;  2EC6 B;  1IRJ A;  2KI6 C;  1KQV A;  1ODB A;  1CDM A;  5D7F A;  1YVH A;  5DKR A;  1AUI B;  2M3W A;  3TUY B;  2R2I A;  4GAO A;  1IJ6 A;  1G8I A;  2VRG A;  2QPT A;  2MLF C;  3EK8 A;  4DIR A;  3BOW A;  1SR6 B;  1W7J B;  2L2E A;  3PM8 A;  4C0L A;  1FI5 A;  2FCE A;  2WCB A;  3TS5 C;  1TNQ A;  2JNF A;  2KYF A;  2LMU A;  1PSR A;  1K93 D;  3CLN A;  3EVV A;  3KPX A;  3LL8 B;  2AAO A;  2KNE A;  3O6B A;  2L98 A;  2OS8 C;  1U5I A;  3I5I C;  2FJU B;  1DVI A;  1JF2 A;  2ZNE A;  2WCF A;  1S6J A;  2Y5I A;  1QX7 A;  2H61 A;  3JVT C;  3AAJ A;  1CMF A;  1K90 D;  2KFG A;  2Q91 A;  2BL0 C;  1J1E A;  2M49 B;  1EXR A;  2BCA A;  2JQ6 A;  4IL1 A;  3TDI A;  4CFQ A;  1S6C A;  1CKK A;  4ORB B;  1SPY A;  1V1G A;  4WRI A;  2F2P A;  1PSB A;  1DGU A;  1RTP 1;  2KGR A;  3TDU A;  1CLB A;  3EVR A;  1FBV A;  2LAN A;  2KQY A;  1SKT A;  2EC6 C;  2KBM A;  1LVC D;  2Y1M A;  3EKH A;  3NSK A;  1ZOT B;  1DMO A;  3TUY C;  1CMG A;  1VRK A;  4XJK B;  1DGV A;  1S5G Z;  2M7L A;  1ZMZ A;  1GQM A;  1JC2 A;  1B1G A;  1SR6 C;  3HCM A;  1PVB A;  2JUL A;  1SY9 A;  1NPQ A;  1IQ3 A;  1Y1X A;  2M8U A;  4CLN A;  4WQ2 A;  1DJW A;  1L2O B;  1NCZ A;  1S36 A;  4OR9 B;  5K89 A;  2GGM A;  2KAX A;  3O2P A;  3VRQ A;  1IJ5 A;  2I94 A;  5HYD A;  1F70 A;  1M63 B;  2G2B A;  2Q4U A;  1EG4 A;  2LLU A;  1DJZ A;  1QTX A;  2ZKM X;  1K9P A;  2KI4 B;  3CWG A;  1LIN A;  1A4P A;  1ZFS A;  4WQ3 A;  1CM1 A;  1PVA A;  1UUS A;  1WY9 A;  1YUS A;  2ISD A;  4NDB A;  2M1K B;  2JT0 A;  4AQI A;  1PUL A;  2KDH A;  1OE9 B;  1Q80 A;  1SCM B;  1K9U A;  2A4J A;  1QLK A;  1CM4 A;  5AER A;  2ZRT A;  1A03 A;  1XYD A;  1NP8 A;  1NIW A;  5HLO A;  2OTG B;  2CCM A;  1F54 A;  1BJF A;  2JOJ A;  3CZT X;  1B7T Y;  1NX2 A;  3CR5 X;  3EKJ A;  3BYA A;  3LLE A;  1OMV A;  2LV7 A;  1NWD A;  2K7D A;  2LUC A;  1KK7 Z;  3PLF B;  3SG2 A;  4MEW A;  1IKU A;  1UWO A;  1N65 A;  4FTG A;  1A75 B;  1ALW A;  3EVU A;  4GGF C;  1F8H A;  1S3P A;  3BXK A;  3I5H B;  1AJ5 A;  3NSI A;  1JBA A;  1L2O C;  3GOF A;  2WOR A;  1RWY A;  1XFX O;  1OZO A;  1YX8 A;  3TZ1 A;  2WC8 A;  2D8N A;  4XYN A;  4QJ4 B;  2BCB A;  3FWB A;  1QS7 A;  2BE4 A;  2K2A A;  3JTD C;  1CFF A;  4PE4 A;  1F55 A;  1OSA A;  1TNW A;  2KI4 C;  1NX3 A;  1QIW A;  1IH0 A;  4QJ5 B;  1HT9 A;  1TCF A;  3IF7 A;  3C1V A;  1QIV A;  5FYX A;  4PHK A;  2CNP A;  3O4Y A;  2PRU A;  3PN7 B;  4DRW A;  1M31 A;  1YX7 A;  1UHJ A;  4USL A;  3DF0 B;  2H2K A;  1CDL A;  1SCM C;  1TIZ A;  1KWO C;  3GK1 A;  2KOT A;  2JZI A;  1BOC A;  1CLL A;  2CXJ A;  5D69 A;  1YUR A;  2O60 A;  3KHE A;  2OTG C;  4L9M A;  1HQV A;  1PAL A;  5BPJ A;  1TRF A;  1XA5 A;  2LVK A;  4ICB A;  2BBM A;  1IGV A;  3AKB A;  1R2U A;  1DJH A;  3BOW B;  5DKQ A;  1C07 A;  3DVM A;  2TN4 A;  3BUO B;  1JF0 A;  2K0J A;  4MBE A;  4MLW A;  1AVS A;  4YGE B;  1Y6W A;  2Y4Q A;  5I2L A;  2K61 A;  3I5H C;  4M2O A;  1J1D A;  1SNL A;  2EHB A;  1U5I B;  4PHJ A;  4MSP A;  4MRX A;  1H8B A;  3OP0 A;  2NZ0 A;  1TTX A;  4ORC B;  2JXL A;  1XFZ O;  5CSI A;  1NUB A;  1MWN A;  2KBI A;  2JC2 A;  2M9G A;  4UPG A;  3WHU B;  1RFJ A;  3PSR A;  1QLS A;  2BKH B;  1SL9 A;  4OV2 A;  5CPV A;  1M39 A;  3ZWH A;  1YRU B;  4Q04 A;  1K95 A;  4BY5 A;  3PN7 C;  5GQQ C;  3D10 A;  1KFU S;  2K8M B;  2KAY A;  5HKZ A;  4R1E A;  2B1U A;  1BT6 A;  1SBJ A;  2HF5 A;  2AUC A;  2ZND A;  1JSA A;  1B47 A;  4M2P A;  3TDZ A;  2M97 A;  5KTY A;  1QX2 A;  1J7R A;  2LHI A;  1DF0 A;  1WDC C;  2LAP A;  3WHT B;  4DCK A;  1CDN A;  1B9A A;  1BR4 B;  1C7V A;  1DTL A;  1XO5 A;  1YRT B;  1J7Q A;  2EGD A;  1S1E A;  2GV5 A;  4NDD A;  2MLE C;  4D1E A;  3EK7 A;  1TCO B;  5JJG A;  1YUU A;  5B8I B;  1KSO A;  1S26 D;  1SK6 D;  4ETO A;  1SL7 A;  3AAK A;  3PAT A;  1DJX A;  2LP2 A;  2K7O A;  3F45 A;  3VRP A;  1WRZ A;  4PHN A;  5CSJ A;  2H61 C;  3SIA A;  3JTD B;  1KSM A;  1TOP A;  3OHM B;  3QRX A;  3DD4 A;  1UUR A;  4M2Q A;  1V1F A;  2LMT A;  4GPL B;  4I5J A;  4HSZ A;  4TNC A;  5DKN A;  1JFJ A;  1J7O A;  4XJK A;  2IS9 A;  5HLV A;  1XFV O;  2M7N A;  2V53 A;  1SMG A;  1MHO A;  1AHR A;  2BCX A;  1YTZ C;  2PMY A;  3LCP C;  4PAL A;  2OPO A;  2KFF A;  1GGZ A;  2L5X B;  1QX5 B;  2NCO A;  1YUT A;  1RK9 A;  3SG3 A;  1QVI Y;  3BUW B;  3VRR A;  1XK4 A;  1OZS A;  5I2O A;  1KWO B;  1X02 A;  1C7W A;  1M45 A;  2E6W A;  2QAC A;  4C0J A;  1LA3 A;  4JWQ A;  4YGB B;  3SG4 A;  1F4O A;  4YGA A;  5J3X A;  1BF5 A;  1JFK A;  1N2D A;  2WND A;  2KAV A;  4NQG A;  1OQP A;  2NXQ A;  4A4C A;  4E68 A;  4PCW A;  1JUO A;  1H4B A;  1MXE A;  2LVV A;  4F0Z B;  4GBA A;  4ZCV A;  3FS7 A;  5JOL A;  1J55 A;  1G4Y R;  3BUN B;  2F33 A;  2CTN A;  2MAZ A;  4CID A;  2L50 A;  3I5F B;  1B8L A;  2CBL A;  3HX4 A;  1SRA A;  1GGW A;  4MZL A;  1KFU L;  3EK4 A;  2JPT A;  2ZFD A;  4PHM A;  4CPV A;  1FW4 A;  4PE0 A;  2L51 A;  1EH2 A;  2PAL A;  5G08 A;  5CSN A;  1WLZ A;  1L7Z A;  2BKI B;  2JWW A;  4A4B A;  2MRD A;  3SG6 A;  4I5N B;  1IQ5 A;  1UHH A;  3BUX B;  2JNX A;  3K21 A;  2MJW B;  3KF9 A;  4U8D A;  1FPW A;  3O78 A;  3CR2 A;  3SG7 A;  5HKW A;  1OMR A;  1QAT A;  1CDP A;  3IQQ A;  1PK0 D;  5ER5 A;  4MRY A;  1QAS A;  4OVN F;  2K7B A;  2NCP A;  4JPZ B;  2SAS A;  2Y1N A;  4JQ0 D;  1CNP A;  2LVJ A;  1BOD A;  3D0Y A;  3SIB A;  3ICB A;  1NSH A;  3H4S E;  1WDC B;  4YGD B;  1PRW A;  4YI8 A;  1BU3 A;  4PDZ A;  1B7T Z;  2KQ6 A;  2K2F A;  4PE1 A;  3NXA A;  4P5O E;  1J7P A;  2G9B A;  2LVI A;  4ZCU A;  4I5L B;  2LE9 B;  2MHH A;  5IBW A;  1DT7 B;  3I5G B;  1F71 A;  2MBX A;  1MUX A;  1YR5 A;  5TNC A;  4YI9 A;  2WCE A;  3I5F C;  1CB1 A;  1UP5 A;  1UHK A;  3KEV A;  3VRO A;  3DF0 A;  1CTR A;  2HET A;  2PAS A;  4OKH A;  2LNK A;  3E3R A;  4MVF A;  1UHI A;  1B8R A;  3ZNI A;  4QJ3 B;  5AXI A;  1EG3 A;  3VRN A;  1S5G Y;  3WNX B;  2JTT A;  5AEQ A;  1SCV A;  4FQO A;  3SJS A;  2RGI A;  1B4C A;  2P6B B;  1Y0V H;  3PAL A;  1S6I A;  3OX6 A;  3RLZ A;  3LK0 A;  2HQ8 A;  1CLM A;  2MA2 A;  3WXA A;  1SYM A;  2F3Y A;  1K2H A;  1W7I B;  3GK4 X;  2HPS A;  3NSO A;  4CFR A;  2ZN9 A;  1DF0 B;  4YBH B;  5AFP A;  1NX1 A;  2LC5 A;  3DVE A;  3OB1 B;  1IG5 A;  4OCI A;  3FIA A;  5I2Q A;  2LM5 A;  1M46 A;  2BBN A;  3M0W A;  1EJ3 A;  1DJG A;  3LK1 A;  1XFY O; 
#chains in the Genus database with same CATH topology
 1GJY A;  2PVB A;  2BEC A;  1BR1 B;  1LA0 A;  1CFC A;  3CR4 X;  1R6P A;  3I5G C;  1TNX A;  3PM2 A;  4C0K A;  4MZJ A;  3A8R A;  2FOT A;  3DVJ A;  4YRU A;  5HKY A;  1ALV A;  2PSR A;  3IQO A;  1NCX A;  2WC6 A;  4N1G A;  1AK8 A;  1KK8 B;  1XFU O;  2L2C A;  3OB2 B;  2NLN A;  1CFD A;  3KO0 A;  3VGO A;  3BQ3 A;  1LKJ A;  3A4U B;  2P71 A;  4HRG A;  4N1F A;  1QJT A;  1QV0 A;  2KGB C;  1DEL A;  2FJY A;  2LUX A;  4GGN A;  1D1O A;  2L4H A;  1KK7 Y;  1SSE B;  3S0D A;  1E8A A;  5AAN A;  1IIO A;  1MF8 B;  1AP4 A;  2KSP A;  2COL B;  5PAL A;  1KQM B;  5EL2 A;  3BFH A;  4BY4 A;  5I8N A;  2JU0 A;  1QXP A;  1ZUZ A;  2KI6 D;  1MR8 A;  2KLE A;  3L4L A;  4PE7 A;  3S0B A;  1A2X A;  2P70 A;  4HRH A;  1KFX L;  4GGF A;  3OBV A;  1WRL A;  4MN0 A;  4JKT A;  1NX0 A;  1IWQ A;  3BUM B;  1SW8 A;  2M1U A;  3PFV A;  3D74 A;  2KLD A;  4DUQ A;  1K9K A;  2LLT A;  1OMD A;  2M0R A;  4GFT A;  2JTZ A;  1RJV A;  1WLM A;  2LHL A;  1OOJ A;  1Y1U A;  1NCY A;  1N0Y A;  2WOS A;  2I7A A;  4GUK A;  1DJI A;  1KCY A;  1MXL C;  4YGC B;  1B8C A;  2AMI A;  3SS4 A;  1NYA A;  1Y1A A;  4HRE E;  4I5K A;  2GGZ A;  2L0P A;  3R1O A;  1MQ1 A;  2FCD A;  4PT1 A;  3CTN A;  3MSE B;  2JXC A;  3RM1 A;  1BMO A;  2JT3 A;  1KK8 C;  2LLS A;  1BG1 A;  2KFH A;  3R72 A;  2F3Z A;  1QV1 A;  1TN4 A;  1REC A;  2LP3 A;  2JT8 A;  1K8U A;  4MZK A;  2F2O A;  2ZRS A;  1BLQ A;  4INW A;  1CFP A;  2KYC A;  1K94 A;  1OOF A;  1DJY A;  2DOQ A;  4NDC A;  1K96 A;  1KQM C;  1SL8 A;  1AJ4 A;  3EG5 B;  5F6T A;  5DIC A;  1XK4 C;  3TS5 B;  1A75 A;  1JWD A;  3B86 A;  3CGA A;  2E30 A;  3SS5 A;  4AOM A;  1QVI Z;  1W9Z A;  1XVJ A;  1A29 A;  3CZ2 A;  2I2R E;  2LMV A;  2SCP A;  3D0Y B;  2K7C A;  1LXF C;  2OS8 B;  3I5I B;  1ZAC A;  2CT9 A;  3FWC A;  3SG5 A;  1FF1 A;  4ORA B;  5ER4 X;  2LCP A;  1XFR A;  2JRF A;  1XFW O;  1G33 A;  2HQW A;  2I18 A;  1FI6 A;  3OX5 A;  1RRO A;  2KHN A;  3DVK A;  3JVT B;  3RZS A;  4N5X A;  3AKA A;  1YVL A;  2BL0 B;  2ZN8 A;  2F8P A;  2O5G A;  3GK2 A;  1KFX S;  2BE6 A;  4GNK B;  1TNP A;  5KU1 A;  1UHN A;  2M29 A;  3DYE A;  2L4I A;  4P2Y B;  1EL4 A;  5KSZ A;  3NSL A;  5CSF A;  4AQJ A;  4DS7 A;  3BJH A;  1F4Q A;  3CS1 A;  1WRK A;  2EC6 B;  1IRJ A;  2KI6 C;  1KQV A;  2ERB A;  1ODB A;  1CDM A;  5D7F A;  1YVH A;  5DKR A;  1AUI B;  2M3W A;  3TUY B;  2R2I A;  4GAO A;  3V2L A;  1IJ6 A;  1G8I A;  2VRG A;  2QPT A;  2MLF C;  3EK8 A;  4FQT A;  4DIR A;  3BOW A;  1SR6 B;  1W7J B;  2L2E A;  3PM8 A;  4C0L A;  1FI5 A;  2FCE A;  2WCB A;  3TS5 C;  1TNQ A;  2JNF A;  2KYF A;  2LMU A;  1PSR A;  1K93 D;  3CLN A;  3DY9 A;  3EVV A;  3KPX A;  3LL8 B;  2AAO A;  2KNE A;  2PYQ A;  2WCH A;  3O6B A;  2L98 A;  2OS8 C;  2QEO A;  1U5I A;  3I5I C;  2FJU B;  1DVI A;  3L4A A;  3R1V A;  1JF2 A;  5HL1 A;  3OGN A;  2ZNE A;  3D73 A;  2WCF A;  1S6J A;  2Y5I A;  1QX7 A;  2H61 A;  3JVT C;  3AAJ A;  1CMF A;  1K90 D;  2KFG A;  2Q91 A;  2BL0 C;  1LS8 A;  1J1E A;  2M49 B;  1EXR A;  2BCA A;  5D3O A;  2JQ6 A;  4IL1 A;  3TDI A;  4CFQ A;  3K1E A;  1S6C A;  1CKK A;  4ORB B;  1SPY A;  1V1G A;  4WRI A;  2F2P A;  1PSB A;  1DGU A;  1RTP 1;  2KGR A;  3TDU A;  1CLB A;  3EVR A;  1FBV A;  2LAN A;  2KQY A;  1SKT A;  2EC6 C;  2KBM A;  1LVC D;  2Y1M A;  3EKH A;  3NSK A;  1ZOT B;  1DMO A;  3D78 A;  3TUY C;  1TUJ A;  1VRK A;  1CMG A;  4XJK B;  1DGV A;  1S5G Z;  2M7L A;  1ZMZ A;  1GQM A;  1JC2 A;  1B1G A;  2JPO A;  1SR6 C;  3HCM A;  1PVB A;  2JUL A;  1SY9 A;  1NPQ A;  1IQ3 A;  1Y1X A;  2M8U A;  4CLN A;  4WQ2 A;  1DJW A;  3S0G A;  1L2O B;  1NCZ A;  1S36 A;  4OR9 B;  5K89 A;  2GGM A;  2KAX A;  3B88 A;  3O2P A;  3VRQ A;  1IJ5 A;  2I94 A;  5HYD A;  1F70 A;  1M63 B;  2G2B A;  2Q4U A;  1EG4 A;  1OOH A;  2LLU A;  1DJZ A;  1QTX A;  2ZKM X;  1K9P A;  2KI4 B;  3CWG A;  1LIN A;  1A4P A;  1ZFS A;  3CAB A;  4WQ3 A;  1CM1 A;  1PVA A;  1UUS A;  1WY9 A;  1YUS A;  2ISD A;  4NDB A;  2M1K B;  2JT0 A;  4AQI A;  1PUL A;  2KDH A;  1OE9 B;  1Q80 A;  1SCM B;  1K9U A;  1QLK A;  2A4J A;  1CM4 A;  5AER A;  4JD9 A;  2ZRT A;  1A03 A;  1XYD A;  1NP8 A;  3B6X A;  1NIW A;  5HLO A;  2OTG B;  2CCM A;  1F54 A;  1BJF A;  2JOJ A;  3CZT X;  1B7T Y;  1NX2 A;  3CR5 X;  3EKJ A;  3BYA A;  3LLE A;  1OMV A;  2LV7 A;  1NWD A;  2K7D A;  2LUC A;  1KK7 Z;  3PLF B;  3SG2 A;  4MEW A;  1IKU A;  1UWO A;  1N65 A;  4FTG A;  1A75 B;  1ALW A;  1OW4 A;  3EVU A;  3B87 A;  4GGF C;  1F8H A;  1S3P A;  4KYN A;  3BXK A;  2QDI A;  3I5H B;  1AJ5 A;  3NSI A;  1JBA A;  1L2O C;  3GOF A;  2WOR A;  1RWY A;  1XFX O;  1OZO A;  1YX8 A;  3TZ1 A;  2WC8 A;  4F7F A;  2D8N A;  4XYN A;  4QJ4 B;  2BCB A;  3IVT A;  3FWB A;  3SS3 A;  1QS7 A;  2BE4 A;  2K2A A;  3JTD C;  1CFF A;  4PE4 A;  1F55 A;  1OSA A;  3N7H A;  1TNW A;  2KI4 C;  3DXL A;  1NX3 A;  1QIW A;  3B7A A;  1IH0 A;  4QJ5 B;  1HT9 A;  1TCF A;  3IF7 A;  3C1V A;  1QIV A;  5FYX A;  4PHK A;  2CNP A;  3O4Y A;  2PRU A;  3PN7 B;  4DRW A;  2WCL A;  1M31 A;  1YX7 A;  3L47 A;  1UHJ A;  4USL A;  3DF0 B;  2H2K A;  1CDL A;  1SCM C;  1TIZ A;  1KWO C;  3GK1 A;  2KOT A;  2JZI A;  1BOC A;  1CLL A;  2CXJ A;  3FE9 A;  5D69 A;  1YUR A;  2O60 A;  3KHE A;  2OTG C;  4L9M A;  1HQV A;  2GTE A;  4INX A;  1PAL A;  3VB1 A;  5BPJ A;  1TRF A;  1XA5 A;  2LVK A;  4ICB A;  2BBM A;  1C3Z A;  1IGV A;  1Z2C B;  3AKB A;  1R2U A;  1DJH A;  3BOW B;  1TWO A;  5DKQ A;  1C07 A;  2WCK A;  3DVM A;  2TN4 A;  3BUO B;  1JF0 A;  2K0J A;  4MBE A;  4MLW A;  1AVS A;  4YGE B;  1Y6W A;  2Y4Q A;  5I2L A;  2K61 A;  3I5H C;  4M2O A;  1J1D A;  1SNL A;  2EHB A;  1U5I B;  4PHJ A;  1ORG A;  4MSP A;  4MRX A;  1H8B A;  3OP0 A;  1DEK A;  2NZ0 A;  1DQE A;  1TTX A;  4ORC B;  2JXL A;  1XFZ O;  2BNX A;  1NUB A;  1MWN A;  3CZ0 A;  2KBI A;  2JC2 A;  2L5Y A;  2M9G A;  5CSI A;  4UPG A;  3WHU B;  1RFJ A;  3PSR A;  1QLS A;  2BKH B;  1SL9 A;  4OV2 A;  3CYZ A;  5CPV A;  1M39 A;  3ZWH A;  1YRU B;  4Q04 A;  1K95 A;  4BY5 A;  3PN7 C;  5GQQ C;  3D10 A;  1KFU S;  2K8M B;  2KAY A;  5HKZ A;  4R1E A;  2B1U A;  1BT6 A;  1SBJ A;  2HF5 A;  2AUC A;  2ZND A;  1JSA A;  1B47 A;  4M2P A;  3TDZ A;  2M97 A;  5KTY A;  1QX2 A;  1J7R A;  2LHI A;  1DF0 A;  1WDC C;  2LAP A;  4OZD A;  3WHT B;  4DCK A;  1CDN A;  1B9A A;  1BR4 B;  2PQL A;  1C7V A;  3CZ1 A;  1DTL A;  1XO5 A;  1YRT B;  1J7Q A;  2EGD A;  1S1E A;  2BAP A;  2GV5 A;  4NDD A;  2MLE C;  4D1E A;  3EK7 A;  3FE6 A;  2K60 A;  1TCO B;  5JJG A;  1YUU A;  5FI6 A;  1KSO A;  5B8I B;  1S26 D;  1SK6 D;  1DC1 A;  4ETO A;  3O4X A;  1SL7 A;  3AAK A;  3FE8 A;  3PAT A;  3UO9 A;  3Q8I A;  1DJX A;  2LP2 A;  2K7O A;  3F45 A;  3VRP A;  1WRZ A;  4PHN A;  5CSJ A;  2H61 C;  3SIA A;  3JTD B;  1KSM A;  1TOP A;  3OHM B;  3QRX A;  3DD4 A;  1UUR A;  4M2Q A;  1V1F A;  2LMT A;  4GPL B;  4I5J A;  4HSZ A;  4TNC A;  5DKN A;  1JFJ A;  1J7O A;  1T14 A;  4XJK A;  2QEV A;  2IS9 A;  2WCJ A;  5HLV A;  1XFV O;  2M7N A;  2V53 A;  1SMG A;  1MHO A;  1AHR A;  2BCX A;  1YTZ C;  2PMY A;  3LCP C;  4PAL A;  2OPO A;  2KFF A;  1GGZ A;  2L5X B;  1QX5 B;  2WCM A;  2NCO A;  1YUT A;  1RK9 A;  3SG3 A;  1QVI Y;  3BUW B;  3VRR A;  1XK4 A;  1OZS A;  5I2O A;  1KWO B;  1X02 A;  1C7W A;  1M45 A;  2E6W A;  2QAC A;  3QME A;  1LA3 A;  2KPH A;  4C0J A;  4JWQ A;  4YGB B;  3SG4 A;  1F4O A;  4YGA A;  5J3X A;  1BF5 A;  1JFK A;  1N2D A;  2WND A;  3DZT A;  5FI7 A;  2KAV A;  4NQG A;  1OQP A;  2NXQ A;  3D77 A;  4A4C A;  5I94 A;  4E68 A;  4PCW A;  1JUO A;  1H4B A;  1MXE A;  1TUZ A;  2LVV A;  1GM0 A;  4F0Z B;  4GBA A;  4ZCV A;  3D76 A;  3FS7 A;  1G4Y R;  1J55 A;  3BUN B;  2F33 A;  5JOL A;  2CTN A;  2MAZ A;  3NGV A;  3CDN A;  4CID A;  2L50 A;  3I5F B;  1B8L A;  2CBL A;  3HX4 A;  1SRA A;  1GGW A;  4MZL A;  1KFU L;  3EK4 A;  2JPT A;  2ZFD A;  4PHM A;  4CPV A;  1FW4 A;  4PE0 A;  2L51 A;  3UNW A;  1EH2 A;  2PAL A;  5G08 A;  5CSN A;  1OOG A;  1WLZ A;  1L7Z A;  2BKI B;  2JWW A;  3R1P A;  4A4B A;  3NHI A;  2MRD A;  3S0F A;  3SG6 A;  4I5N B;  1IQ5 A;  1UHH A;  3BUX B;  2JNX A;  3D75 A;  2MJW B;  3K21 A;  3KF9 A;  4U8D A;  1FPW A;  3O78 A;  3CR2 A;  2QEH A;  5HKW A;  3S0E A;  1QWV A;  3SG7 A;  1Z4H A;  1OMR A;  1QAT A;  1CDP A;  2YGU A;  3IQQ A;  1PK0 D;  5ER5 A;  4MRY A;  1QAS A;  4OVN F;  2K7B A;  2NCP A;  4JPZ B;  2SAS A;  2Y1N A;  4JQ0 D;  1CNP A;  2LVJ A;  1BOD A;  3D0Y A;  3SIB A;  3ICB A;  1NSH A;  3H4S E;  1WDC B;  4YGD B;  1PRW A;  4YI8 A;  1BU3 A;  4PDZ A;  1B7T Z;  2KQ6 A;  2K2F A;  4PE1 A;  3NXA A;  4P5O E;  1J7P A;  2G9B A;  2LVI A;  4ZCU A;  4I5L B;  2LE9 B;  4IJ7 A;  2MHH A;  5IBW A;  1DT7 B;  2H8V A;  3I5G B;  1F71 A;  2MBX A;  1MUX A;  1YR5 A;  5TNC A;  4YI9 A;  2WCE A;  3I5F C;  1CB1 A;  1UP5 A;  1UHK A;  3KEV A;  3VRO A;  3DF0 A;  1CTR A;  2HET A;  2PAS A;  4OKH A;  1C3Y A;  2LNK A;  3E3R A;  4MVF A;  1UHI A;  1B8R A;  3ZNI A;  4QJ3 B;  5AXI A;  1EG3 A;  3VRN A;  1S5G Y;  3WNX B;  1P28 A;  2JTT A;  5AEQ A;  1SCV A;  2QEB A;  4FQO A;  3SJS A;  2RGI A;  1B4C A;  2P6B B;  1Y0V H;  3PAL A;  1S6I A;  3OX6 A;  3RLZ A;  3LK0 A;  2HQ8 A;  1CLM A;  2MA2 A;  3WXA A;  5FI2 A;  1SYM A;  2F3Y A;  1K2H A;  1W7I B;  3GK4 X;  2HPS A;  3NSO A;  3PJI A;  4CFR A;  1OOI X;  2ZN9 A;  1DF0 B;  4YBH B;  5AFP A;  1NX1 A;  2LC5 A;  3DVE A;  3OB1 B;  1IG5 A;  4OCI A;  3FIA A;  5I2Q A;  3BFA A;  2LM5 A;  1M46 A;  2BBN A;  3BFB A;  2WC5 A;  3M0W A;  1EJ3 A;  3NHT A;  3S0A A;  1DJG A;  3LK1 A;  1XFY O; 
#chains in the Genus database with same CATH homology
 1GJY A;  2PVB A;  2BEC A;  1BR1 B;  1LA0 A;  1CFC A;  3CR4 X;  1R6P A;  3I5G C;  1TNX A;  4C0K A;  4MZJ A;  3A8R A;  2FOT A;  3DVJ A;  4YRU A;  5HKY A;  1ALV A;  2PSR A;  3IQO A;  1NCX A;  4N1G A;  1AK8 A;  1KK8 B;  1XFU O;  3OB2 B;  2NLN A;  1CFD A;  3KO0 A;  3VGO A;  3BQ3 A;  1LKJ A;  3A4U B;  4HRG A;  4N1F A;  1QJT A;  1QV0 A;  2KGB C;  2LUX A;  4GGN A;  1D1O A;  2L4H A;  1KK7 Y;  1E8A A;  5AAN A;  1MF8 B;  1AP4 A;  2KSP A;  2COL B;  5PAL A;  1KQM B;  4BY4 A;  5I8N A;  2JU0 A;  1QXP A;  1ZUZ A;  2KI6 D;  1MR8 A;  4PE7 A;  1A2X A;  4HRH A;  1KFX L;  4GGF A;  1WRL A;  4MN0 A;  1NX0 A;  1IWQ A;  3BUM B;  1SW8 A;  2M1U A;  3PFV A;  4DUQ A;  1K9K A;  2LLT A;  1OMD A;  2M0R A;  4GFT A;  2JTZ A;  1RJV A;  1WLM A;  2LHL A;  1OOJ A;  1Y1U A;  1NCY A;  1N0Y A;  2WOS A;  2I7A A;  4GUK A;  1DJI A;  1KCY A;  1MXL C;  4YGC B;  1B8C A;  2AMI A;  1NYA A;  1Y1A A;  4HRE E;  4I5K A;  2GGZ A;  2L0P A;  1MQ1 A;  2FCD A;  3CTN A;  3MSE B;  2JXC A;  3RM1 A;  1BMO A;  2JT3 A;  1KK8 C;  2LLS A;  1BG1 A;  2KFH A;  2F3Z A;  1QV1 A;  1TN4 A;  1REC A;  2LP3 A;  2JT8 A;  1K8U A;  4MZK A;  2F2O A;  2ZRS A;  1BLQ A;  1CFP A;  2KYC A;  1K94 A;  1DJY A;  2DOQ A;  4NDC A;  1K96 A;  1KQM C;  1SL8 A;  1AJ4 A;  5F6T A;  1XK4 C;  3TS5 B;  1A75 A;  1JWD A;  3CGA A;  2E30 A;  4AOM A;  1QVI Z;  1XVJ A;  1A29 A;  2I2R E;  2LMV A;  2SCP A;  3D0Y B;  2K7C A;  1LXF C;  2OS8 B;  3I5I B;  1ZAC A;  2CT9 A;  3FWC A;  3SG5 A;  1FF1 A;  4ORA B;  5ER4 X;  2LCP A;  2JRF A;  1XFW O;  1G33 A;  2HQW A;  2I18 A;  1FI6 A;  3OX5 A;  1RRO A;  2KHN A;  3DVK A;  3JVT B;  4N5X A;  3AKA A;  1YVL A;  2BL0 B;  2ZN8 A;  2F8P A;  2O5G A;  3GK2 A;  1KFX S;  2BE6 A;  4GNK B;  1TNP A;  5KU1 A;  1UHN A;  2M29 A;  2L4I A;  4P2Y B;  1EL4 A;  5KSZ A;  3NSL A;  5CSF A;  4AQJ A;  4DS7 A;  1F4Q A;  3CS1 A;  1WRK A;  2EC6 B;  1IRJ A;  2KI6 C;  1KQV A;  1ODB A;  1CDM A;  5D7F A;  1YVH A;  5DKR A;  1AUI B;  2M3W A;  3TUY B;  2R2I A;  4GAO A;  1IJ6 A;  1G8I A;  2VRG A;  2QPT A;  2MLF C;  3EK8 A;  4DIR A;  3BOW A;  1SR6 B;  1W7J B;  2L2E A;  3PM8 A;  4C0L A;  1FI5 A;  2FCE A;  2WCB A;  3TS5 C;  1TNQ A;  2JNF A;  2KYF A;  2LMU A;  1PSR A;  1K93 D;  3CLN A;  3EVV A;  3KPX A;  3LL8 B;  2AAO A;  2KNE A;  3O6B A;  2L98 A;  2OS8 C;  1U5I A;  3I5I C;  2FJU B;  1DVI A;  1JF2 A;  2ZNE A;  2WCF A;  1S6J A;  2Y5I A;  1QX7 A;  2H61 A;  3JVT C;  3AAJ A;  1CMF A;  1K90 D;  2KFG A;  2Q91 A;  2BL0 C;  1J1E A;  2M49 B;  1EXR A;  2BCA A;  2JQ6 A;  4IL1 A;  3TDI A;  4CFQ A;  1S6C A;  1CKK A;  4ORB B;  1SPY A;  1V1G A;  4WRI A;  2F2P A;  1PSB A;  1DGU A;  1RTP 1;  2KGR A;  3TDU A;  1CLB A;  3EVR A;  1FBV A;  2LAN A;  2KQY A;  1SKT A;  2EC6 C;  2KBM A;  1LVC D;  2Y1M A;  3EKH A;  3NSK A;  1ZOT B;  1DMO A;  3TUY C;  1CMG A;  1VRK A;  4XJK B;  1DGV A;  1S5G Z;  2M7L A;  1ZMZ A;  1GQM A;  1JC2 A;  1B1G A;  1SR6 C;  3HCM A;  1PVB A;  2JUL A;  1SY9 A;  1NPQ A;  1IQ3 A;  1Y1X A;  2M8U A;  4CLN A;  4WQ2 A;  1DJW A;  1L2O B;  1NCZ A;  1S36 A;  4OR9 B;  5K89 A;  2GGM A;  2KAX A;  3O2P A;  3VRQ A;  1IJ5 A;  2I94 A;  5HYD A;  1F70 A;  1M63 B;  2G2B A;  2Q4U A;  1EG4 A;  2LLU A;  1DJZ A;  1QTX A;  2ZKM X;  1K9P A;  2KI4 B;  3CWG A;  1LIN A;  1A4P A;  1ZFS A;  4WQ3 A;  1CM1 A;  1PVA A;  1UUS A;  1WY9 A;  1YUS A;  2ISD A;  4NDB A;  2M1K B;  2JT0 A;  4AQI A;  1PUL A;  2KDH A;  1OE9 B;  1Q80 A;  1SCM B;  1K9U A;  2A4J A;  1QLK A;  1CM4 A;  5AER A;  2ZRT A;  1A03 A;  1XYD A;  1NP8 A;  1NIW A;  5HLO A;  2OTG B;  2CCM A;  1F54 A;  1BJF A;  2JOJ A;  3CZT X;  1B7T Y;  1NX2 A;  3CR5 X;  3EKJ A;  3BYA A;  3LLE A;  1OMV A;  2LV7 A;  1NWD A;  2K7D A;  2LUC A;  1KK7 Z;  3PLF B;  3SG2 A;  4MEW A;  1IKU A;  1UWO A;  1N65 A;  4FTG A;  1A75 B;  1ALW A;  3EVU A;  4GGF C;  1F8H A;  1S3P A;  3BXK A;  3I5H B;  1AJ5 A;  3NSI A;  1JBA A;  1L2O C;  3GOF A;  2WOR A;  1RWY A;  1XFX O;  1OZO A;  1YX8 A;  3TZ1 A;  2WC8 A;  2D8N A;  4XYN A;  4QJ4 B;  2BCB A;  3FWB A;  1QS7 A;  2BE4 A;  2K2A A;  3JTD C;  1CFF A;  4PE4 A;  1F55 A;  1OSA A;  1TNW A;  2KI4 C;  1NX3 A;  1QIW A;  1IH0 A;  4QJ5 B;  1HT9 A;  1TCF A;  3IF7 A;  3C1V A;  1QIV A;  5FYX A;  4PHK A;  2CNP A;  3O4Y A;  2PRU A;  3PN7 B;  4DRW A;  1M31 A;  1YX7 A;  1UHJ A;  4USL A;  3DF0 B;  2H2K A;  1CDL A;  1SCM C;  1TIZ A;  1KWO C;  3GK1 A;  2KOT A;  2JZI A;  1BOC A;  1CLL A;  2CXJ A;  5D69 A;  1YUR A;  2O60 A;  3KHE A;  2OTG C;  4L9M A;  1HQV A;  1PAL A;  5BPJ A;  1TRF A;  1XA5 A;  2LVK A;  4ICB A;  2BBM A;  1IGV A;  3AKB A;  1R2U A;  1DJH A;  3BOW B;  5DKQ A;  1C07 A;  3DVM A;  2TN4 A;  3BUO B;  1JF0 A;  2K0J A;  4MBE A;  4MLW A;  1AVS A;  4YGE B;  1Y6W A;  2Y4Q A;  5I2L A;  2K61 A;  3I5H C;  4M2O A;  1J1D A;  1SNL A;  2EHB A;  1U5I B;  4PHJ A;  4MSP A;  4MRX A;  1H8B A;  3OP0 A;  2NZ0 A;  1TTX A;  4ORC B;  2JXL A;  1XFZ O;  5CSI A;  1NUB A;  1MWN A;  2KBI A;  2JC2 A;  2M9G A;  4UPG A;  3WHU B;  1RFJ A;  3PSR A;  1QLS A;  2BKH B;  1SL9 A;  4OV2 A;  5CPV A;  1M39 A;  3ZWH A;  1YRU B;  4Q04 A;  1K95 A;  4BY5 A;  3PN7 C;  5GQQ C;  3D10 A;  1KFU S;  2K8M B;  2KAY A;  5HKZ A;  4R1E A;  2B1U A;  1BT6 A;  1SBJ A;  2HF5 A;  2AUC A;  2ZND A;  1JSA A;  1B47 A;  4M2P A;  3TDZ A;  2M97 A;  5KTY A;  1QX2 A;  1J7R A;  2LHI A;  1DF0 A;  1WDC C;  2LAP A;  3WHT B;  4DCK A;  1CDN A;  1B9A A;  1BR4 B;  1C7V A;  1DTL A;  1XO5 A;  1YRT B;  1J7Q A;  2EGD A;  1S1E A;  2GV5 A;  4NDD A;  2MLE C;  4D1E A;  3EK7 A;  1TCO B;  5JJG A;  1YUU A;  5B8I B;  1KSO A;  1S26 D;  1SK6 D;  4ETO A;  1SL7 A;  3AAK A;  3PAT A;  1DJX A;  2LP2 A;  2K7O A;  3F45 A;  3VRP A;  1WRZ A;  4PHN A;  5CSJ A;  2H61 C;  3SIA A;  3JTD B;  1KSM A;  1TOP A;  3OHM B;  3QRX A;  3DD4 A;  1UUR A;  4M2Q A;  1V1F A;  2LMT A;  4GPL B;  4I5J A;  4HSZ A;  4TNC A;  5DKN A;  1JFJ A;  1J7O A;  4XJK A;  2IS9 A;  5HLV A;  1XFV O;  2M7N A;  2V53 A;  1SMG A;  1MHO A;  1AHR A;  2BCX A;  1YTZ C;  2PMY A;  3LCP C;  4PAL A;  2OPO A;  2KFF A;  1GGZ A;  2L5X B;  1QX5 B;  2NCO A;  1YUT A;  1RK9 A;  3SG3 A;  1QVI Y;  3BUW B;  3VRR A;  1XK4 A;  1OZS A;  5I2O A;  1KWO B;  1X02 A;  1C7W A;  1M45 A;  2E6W A;  2QAC A;  4C0J A;  1LA3 A;  4JWQ A;  4YGB B;  3SG4 A;  1F4O A;  4YGA A;  5J3X A;  1BF5 A;  1JFK A;  1N2D A;  2WND A;  2KAV A;  4NQG A;  1OQP A;  2NXQ A;  4A4C A;  4E68 A;  4PCW A;  1JUO A;  1H4B A;  1MXE A;  2LVV A;  4F0Z B;  4GBA A;  4ZCV A;  3FS7 A;  5JOL A;  1J55 A;  1G4Y R;  3BUN B;  2F33 A;  2CTN A;  2MAZ A;  4CID A;  2L50 A;  3I5F B;  1B8L A;  2CBL A;  3HX4 A;  1SRA A;  1GGW A;  4MZL A;  1KFU L;  3EK4 A;  2JPT A;  2ZFD A;  4PHM A;  4CPV A;  1FW4 A;  4PE0 A;  2L51 A;  1EH2 A;  2PAL A;  5G08 A;  5CSN A;  1WLZ A;  1L7Z A;  2BKI B;  2JWW A;  4A4B A;  2MRD A;  3SG6 A;  4I5N B;  1IQ5 A;  1UHH A;  3BUX B;  2JNX A;  3K21 A;  2MJW B;  3KF9 A;  4U8D A;  1FPW A;  3O78 A;  3CR2 A;  3SG7 A;  5HKW A;  1OMR A;  1QAT A;  1CDP A;  3IQQ A;  1PK0 D;  5ER5 A;  4MRY A;  1QAS A;  4OVN F;  2K7B A;  2NCP A;  4JPZ B;  2SAS A;  2Y1N A;  4JQ0 D;  1CNP A;  2LVJ A;  1BOD A;  3D0Y A;  3SIB A;  3ICB A;  1NSH A;  3H4S E;  1WDC B;  4YGD B;  1PRW A;  4YI8 A;  1BU3 A;  4PDZ A;  1B7T Z;  2KQ6 A;  2K2F A;  4PE1 A;  3NXA A;  4P5O E;  1J7P A;  2G9B A;  2LVI A;  4ZCU A;  4I5L B;  2LE9 B;  2MHH A;  5IBW A;  1DT7 B;  3I5G B;  1F71 A;  2MBX A;  1MUX A;  1YR5 A;  5TNC A;  4YI9 A;  2WCE A;  3I5F C;  1CB1 A;  1UP5 A;  1UHK A;  3KEV A;  3VRO A;  3DF0 A;  1CTR A;  2HET A;  2PAS A;  4OKH A;  2LNK A;  3E3R A;  4MVF A;  1UHI A;  1B8R A;  3ZNI A;  4QJ3 B;  5AXI A;  1EG3 A;  3VRN A;  1S5G Y;  3WNX B;  2JTT A;  5AEQ A;  1SCV A;  4FQO A;  3SJS A;  2RGI A;  1B4C A;  2P6B B;  1Y0V H;  3PAL A;  1S6I A;  3OX6 A;  3RLZ A;  3LK0 A;  2HQ8 A;  1CLM A;  2MA2 A;  3WXA A;  1SYM A;  2F3Y A;  1K2H A;  1W7I B;  3GK4 X;  2HPS A;  3NSO A;  4CFR A;  2ZN9 A;  1DF0 B;  4YBH B;  5AFP A;  1NX1 A;  2LC5 A;  3DVE A;  3OB1 B;  1IG5 A;  4OCI A;  3FIA A;  5I2Q A;  2LM5 A;  1M46 A;  2BBN A;  3M0W A;  1EJ3 A;  1DJG A;  3LK1 A;  1XFY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...