1JSAA

Myristoylated recoverin with two calciums bound, nmr, 24 structures
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
188
structure length
188
Chain Sequence
GNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium binding
molecule keywords RECOVERIN
publication title Molecular mechanics of calcium-myristoyl switches.
pubmed doi rcsb
source organism Bos taurus
total genus 28
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 1997-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA02
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1jsaA01
4GNKB 1DF0B 2JXCA 2EHBA 3EVUA 2MBXA 3EK4A 2K2FA 1YUUA 1MUXA 2BE6A 3JTDB 3KHEA 2MLFC 4YBHB 1NPQA 1HQVA 1JSAA 3DD4A 2JQ6A 1SNLA 3CS1A 2R2IA 3LLEA 5I8NA 2F8PA 3DVKA 4OKHA 2CXJA 1FI6A 1DTLA 2KI4B 1OE9B 3GK4X 1DJYA 3HCMA 3MSEB 2LNKA 3NSLA 3PFVA 4MEWA 4DIRA 4DUQA 4GGFA 2JNXA 2K7OA 4GUKA 1S3PA 1UP5A 3EVRA 2LMVA 1B8RA 2Q91A 2SASA 1NCYA 1QX5B 2FCEA 2LE9B 1DJIA 2GGZA 1EJ3A 1XFUO 2O5GA 4JQ0D 1U5IA 4FTGA 1QIWA 4JWQA 1DJXA 1SYMA 3LK0A 2K0JA 4MZLA 1ZUZA 4GFTA 1CMFA 4MVFA 1S6IA 1V1FA 2BE4A 4GPLB 4MBEA 4ORAB 3OHMB 1K95A 1UHKA 2AAOA 1YX8A 1TTXA 2I94A 3TDZA 3CZTX 3NXAA 1BMOA 1KQMC 5JOLA 1E8AA 4OVNF 1A2XA 2LVVA 1CLMA 2PSRA 1DVIA 1TNPA 1EG4A 2KAYA 2K7BA 3AAJA 1BT6A 1H4BA 1EXRA 1C7WA 2M29A 2NLNA 4MLWA 2K8MB 2LC5A 2DOQA 5G08A 2HQ8A 1AUIB 1SK6D 1Y1UA 2O60A 2TN4A 1LKJA 1WDCC 3PALA 1G8IA 2ZKMX 2BCAA 3ICBA 1OZSA 4C0KA 1K9KA 2LCPA 4MZKA 2A4JA 1ALVA 1BG1A 1Q80A 1KFXS 4ORBB 4NQGA 5CSJA 1DJGA 2JT0A 3I5IC 3CLNA 3I5GB 1WRKA 5AXIA 1KK8B 1F8HA 2KFGA 4CFQA 1UHNA 1PSBA 1NX3A 5AERA 1YRTB 2ZN8A 1SPYA 3KEVA 4WRIA 1XVJA 2H61C 2PVBA 4IL1A 4PHKA 1QLKA 3DF0A 2Q4UA 1YRUB 2NCPA 4MSPA 1NX2A 3DVEA 1Y1XA 1A75B 2LLUA 1RFJA 4GBAA 1SY9A 2BECA 3CR4X 2LLSA 1ODBA 3RM1A 1PALA 3M0WA 1B9AA 5AEQA 1TNXA 1TIZA 3O2PA 5DKNA 1VRKA 1CMGA 1DGUA 2LANA 4P5OE 1KK7Y 1KWOC 2LV7A 3EK8A 2PRUA 1N65A 5ER5A 1BR4B 3DVJA 3TUYC 3JVTB 4PHMA 1PRWA 1B4CA 2IS9A 4I5KA 1NCXA 2LHIA 2WC8A 1Y6WA 4AQJA 2Y1MA 2B1UA 3VRRA 3DVMA 2MHHA 1G4YR 1TNWA 1IH0A 5AFPA 1UHIA 1XYDA 4OV2A 4DRWA 5I2OA 1DJZA 2JZIA 3SG3A 2F3ZA 3IF7A 4PDZA 2KI6C 5AANA 1MQ1A 1MR8A 2I18A 1SCMC 2KSPA 3WNXB 2LLTA 1SR6C 1YURA 2PASA 1RJVA 2PMYA 2Y1NA 3TDUA 3O4YA 3KPXA 1BODA 1KQMB 2RGIA 3OB2B 3KF9A 4MRXA 3D0YB 4USLA 1XFWO 3PN7B 1IG5A 2AMIA 3F45A 1G33A 1DT7B 2BCXA 2ZFDA 1CFPA 1D1OA 1L7ZA 2KI6D 3BOWB 1JBAA 1MXEA 1QVIY 1PSRA 2ZRSA 4N5XA 4ZCVA 2LMTA 1EH2A 5D7FA 1A4PA 5CSNA 3NSKA 1BU3A 1WDCB 2JXLA 3WXAA 5HKWA 1Y0VH 4NDBA 3PLFB 2LP2A 3EVVA 2Y5IA 5DKRA 1SW8A 2JNFA 3I5IB 2ISDA 1JF0A 1AK8A 1IQ3A 1J7RA 1ZOTB 1M39A 4XJKB 1CDNA 1GGWA 1A75A 1S36A 3JVTC 1M31A 2WOSA 3BXKA 4HRGA 2P6BB 1SL9A 1SBJA 1S5GZ 3C1VA 4R1EA 2BL0C 3CTNA 1K93D 1UUSA 1ZFSA 5J3XA 1J7PA 2NZ0A 4TNCA 1QJTA 4HREE 4ZCUA 1K2HA 2FJUB 1CB1A 3I5FC 1CDMA 1ZACA 2JWWA 3SIBA 1NX0A 2GV5A 2KFHA 2M8UA 1A29A 2LUXA 1BR1B 5KTYA 1M46A 4F0ZB 2H2KA 1J7QA 3D10A 1KWOB 1AJ4A 1MHOA 1JF2A 2Y4QA 4YGAA 5IBWA 1CM1A 1PVAA 4OCIA 3TUYB 1B1GA 1BLQA 1X02A 3PN7C 1UHHA 3VGOA 4M2QA 1RTP1 2WCFA 4UPGA 2BBNA 4I5NB 5PALA 2L98A 3QRXA 1RROA 4HSZA 1XFXO 5CSIA 1KCYA 3IQQA 3GK1A 1C7VA 1N0YA 2K2AA 3TZ1A 3FIAA 1TCOB 4CLNA 2M7NA 5K89A 2M1KB 1CLBA 2I7AA 1J1DA 2EC6C 1XFVO 2QACA 3CR2A 3D0YA 1KFXL 1SCMB 1YTZC 2FOTA 1SR6B 1K94A 3K21A 3BOWA 4D1EA 1CM4A 1JC2A 1DF0A 2LUCA 1DGVA 1QX7A 4WQ3A 1RK9A 3CWGA 2LMUA 2JOJA 4ETOA 3SG5A 3AAKA 2K7CA 2JT8A 4I5LB 3VRPA 4AQIA 1V1GA 3VRQA 5FYXA 1WY9A 5JJGA 3HX4A 2I2RE 1NYAA 4CPVA 4N1FA 3EKJA 1IKUA 1DJHA 4ICBA 1RECA 2KYCA 4XJKA 1S6JA 3H4SE 1SMGA 2KDHA 1N2DA 4YGEB 1PK0D 4PE4A 3BUXB 2BKHB 4QJ4B 1L2OC 2MJWB 3TS5C 2H61A 1F54A 1JFKA 1KQVA 4PALA 3OX5A 2BKIB 1WRZA 2OTGC 5D69A 2LVIA 4E68A 2KBMA 1M63B 1GJYA 1AJ5A 3NSIA 4NDCA 3VRNA 2BL0B 2JULA 4GAOA 1K90D 4PE7A 2E6WA 1XFZO 3A8RA 4YGDB 2M0RA 2ZNEA 3WHUB 4GGNA 3GOFA 4MZJA 5ER4X 3CGAA 2F3YA 3PM8A 1B7TZ 4WQ2A 2L51A 3I5FB 2KBIA 5I2QA 3SIAA 4PE1A 2M3WA 1MF8B 2JT3A 1F55A 2HF5A 1JWDA 1CTRA 4MRYA 2V53A 1JFJA 4AOMA 4PHJA 2NCOA 1TN4A 5BPJA 1F4QA 2QPTA 4MN0A 3BUOB 1S1EA 1IRJA 2MAZA 3PATA 1AVSA 2ZRTA 2KFFA 3OB1B 1OMVA 1DMOA 2KHNA 1WLMA 2M7LA 2WCBA 1UHJA 5TNCA 1QS7A 1YUSA 3O78A 4XYNA 3A4UB 4I5JA 3ZWHA 1KSMA 3I5HB 1LA3A 4DS7A 4U8DA 1TRFA 2EC6B 2VRGA 4N1GA 1B8LA 1OMRA 1R6PA 4PHNA 1LA0A 4QJ3B 4YGBB 1FF1A 1BJFA 5CSFA 1UURA 2KAVA 4ORCB 2KAXA 1W7JB 1KSOA 4PCWA 3PSRA 4C0JA 2LP3A 1KFUS 1LXFC 1OMDA 1QATA 1Y1AA 4GGFC 2SCPA 1IJ6A 2BBMA 2EGDA 2JTZA 5HYDA 2LVJA 1YVLA 2COLB 1CDPA 5KSZA 2KGRA 3DF0B 1C07A 1F71A 2LAPA 2AUCA 2JU0A 5HLVA 1J1EA 2ZNDA 1ALWA 1J55A 4PE0A 1K9UA 2OS8C 2HPSA 2M97A 1WRLA 5CPVA 1L2OB 1IQ5A 2D8NA 3TS5B 1PVBA 2CNPA 2M49B 4P2YB 1TCFA 1XK4C 1DJWA 3BYAA 2OTGB 1QTXA 2L2EA 4JPZB 2E30A 1BF5A 1YUTA 1SCVA 1QASA 4BY5A 2M9GA 2KGBC 3OP0A 1WLZA 1XFYO 2KYFA 1OSAA 1SRAA 3SJSA 1CFDA 1GGZA 1K8UA 4NDDA 3E3RA 1S6CA 2KOTA 3BUWB 3I5HC 2WNDA 1XK4A 2L4HA 5I2LA 3SG6A 1CLLA 1S5GY 3BUNB 3NSOA 2L0PA 2K61A 3LCPC 3BUMB 1CNPA 1YVHA 1OZOA 5B8IB 1FI5A 2MLEC 3CR5X 1BOCA 1QV1A 2JRFA 4Q04A 1FPWA 4FQOA 1XO5A 3EKHA 1KK7Z 4BY4A 1TNQA 1MXLC 4HRHA 5HKYA 2CT9A 2G2BA 2PALA 3JTDC 1B47A 3LL8B 2MA2A 1K9PA 2L4IA 3SG7A 1LVCD 1M45A 1A03A 1NX1A 2L5XB 2CTNA 2F2PA 3ZNIA 4M2PA 2KI4C 2HQWA 3FWCA 1NWDA 2JC2A 3GK2A 1F70A 4YRUA 1NP8A 2CCMA 1QV0A 3FS7A 4CFRA 1IGVA 1AP4A 2F33A 3KO0A 3SG2A 3EK7A 1F4OA 1OQPA 2GGMA 1K96A 1NIWA 1PULA 1QLSA 3IQOA 5HKZA 2JPTA 4CIDA 1FBVA 2LM5A 1J7OA 3WHTB 2ZN9A 3SG4A 4YGCB 2OPOA 1CFFA 1OOJA 4M2OA 1QVIZ 3FWBA 1QXPA 1U5IB 4A4BA 2KQYA 1RWYA 1NSHA 2JTTA 2OS8B 1QX2A 1XA5A 4YI9A 3VROA 2F2OA 1SL8A 1NCZA 1SL7A 2G9BA 2LVKA 3TDIA 1S26D 1IJ5A 5GQQC 5F6TA 2FCDA 1YR5A 1NUBA 3AKAA 4C0LA 2LHLA 3AKBA 3RLZA 1W7IB 4OR9B 3O6BA 5KU1A 4QJ5B 2KNEA 3LK1A 1FW4A 1HT9A 1IWQA 4A4CA 1B8CA 1CFCA 2WORA 1R2UA 1LINA 4YI8A 2NXQA 1QIVA 2M1UA 2WCEA 1JUOA 5DKQA 5HLOA 3I5GC 2BCBA 1KK8C 2K7DA 1TOPA 1SKTA 1YX7A 2L50A 2MRDA 1AHRA 1B7TY 1UWOA 4DCKA 1H8BA 1ZMZA 2KQ6A 3BQ3A 1MWNA 1CDLA 1KFUL 1CKKA 1GQMA 2HETA 4L9MA 1EG3A 3OX6A 1EL4A 2CBLA
chains in the Genus database with same CATH superfamily
4GNKB 1DF0B 2JXCA 2EHBA 3EVUA 2MBXA 3EK4A 2K2FA 1YUUA 1MUXA 2BE6A 3JTDB 3KHEA 2MLFC 4JKTA 4YBHB 1NPQA 1HQVA 3CDNA 1JSAA 1IIOA 3DD4A 2JQ6A 1SNLA 3CS1A 2R2IA 1QWVA 3LLEA 2F8PA 3DVKA 4PT1A 5I8NA 4OKHA 2CXJA 3S0AA 1FI6A 1DTLA 3S0DA 3IVTA 2KI4B 1OE9B 3GK4X 1DJYA 3HCMA 3MSEB 2LNKA 3N7HA 3NSLA 3PFVA 4MEWA 4DIRA 4GGFA 2JNXA 2K7OA 4GUKA 1S3PA 1UP5A 3EVRA 2LMVA 1B8RA 1OOGA 2Q91A 2SASA 1NCYA 1QX5B 2FCEA 2LE9B 1DJIA 2GGZA 1EJ3A 1XFUO 2O5GA 4JQ0D 1U5IA 2JPOA 4FTGA 1QIWA 4JWQA 1DJXA 1SYMA 3LK0A 2K0JA 4MZLA 1ZUZA 4GFTA 1Z4HA 1CMFA 4MVFA 1S6IA 1V1FA 2BE4A 4GPLB 4MBEA 4ORAB 3BFHA 1K95A 1UHKA 3OHMB 2AAOA 1YX8A 1TTXA 2I94A 3TDZA 2K60A 3CZTX 3NXAA 1BMOA 1KQMC 5JOLA 3FE8A 1E8AA 3D74A 3NHTA 1A2XA 2LVVA 1CLMA 2PSRA 4OVNF 1DVIA 1TNPA 1EG4A 2KAYA 2K7BA 3AAJA 1BT6A 1H4BA 1EXRA 1C7WA 2M29A 2NLNA 3B87A 4MLWA 4OZDA 2K8MB 2LC5A 2DOQA 5G08A 2HQ8A 1AUIB 3DY9A 1SK6D 1Y1UA 2O60A 3CZ0A 2TN4A 1LKJA 1WDCC 3PALA 1G8IA 3S0BA 2ZKMX 2BCAA 3FE9A 3ICBA 1OZSA 4C0KA 1K9KA 2LCPA 4MZKA 2A4JA 1ALVA 1BG1A 1Q80A 1KFXS 4ORBB 4NQGA 5CSJA 1DJGA 2JT0A 3I5IC 2FJYA 3CLNA 1WRKA 3I5GB 5AXIA 1KK8B 1F8HA 2KFGA 3B7AA 4CFQA 1UHNA 1PSBA 3OGNA 1NX3A 5AERA 1C3YA 1YRTB 2BAPA 2GTEA 2ZN8A 1SPYA 3KEVA 4WRIA 1XVJA 2H61C 2PVBA 4IL1A 4PHKA 1QLKA 3DF0A 2Q4UA 1YRUB 2NCPA 4MSPA 1NX2A 3DVEA 1Y1XA 1A75B 3O4XA 2LLUA 1RFJA 3PJIA 3SS3A 4GBAA 1SY9A 2BECA 3CR4X 2LLSA 1ODBA 2PQLA 3RM1A 1DELA 1PALA 3M0WA 1B9AA 2P71A 5AEQA 1TNXA 1TIZA 3O2PA 5DKNA 1VRKA 1CMGA 1DGUA 2LANA 4P5OE 2BNXA 1KK7Y 1KWOC 2LV7A 3EK8A 2PRUA 1N65A 5ER5A 3R1OA 1BR4B 3DVJA 3TUYC 3JVTB 4PHMA 1PRWA 5I94A 1B4CA 2IS9A 4I5KA 5HL1A 1NCXA 2LHIA 2WC8A 1Y6WA 2L2CA 4AQJA 2Y1MA 2B1UA 4DUQA 1TUJA 3VRRA 4F7FA 5EL2A 3DVMA 2MHHA 1G4YR 1TNWA 1IH0A 5AFPA 1UHIA 1XYDA 4INXA 4OV2A 4DRWA 5I2OA 1DJZA 2JZIA 3SG3A 2F3ZA 3IF7A 4PDZA 2KI6C 5AANA 1MQ1A 1MR8A 2I18A 1SCMC 2KSPA 3WNXB 2LLTA 1SR6C 1YURA 2PASA 1RJVA 3UNWA 2PMYA 2Y1NA 3TDUA 3O4YA 3KPXA 1BODA 1KQMB 1OOIX 2RGIA 3OB2B 2QEHA 3KF9A 4MRXA 3D0YB 4USLA 1XFWO 3PN7B 1IG5A 2AMIA 3F45A 1G33A 1DT7B 2BCXA 2ZFDA 1CFPA 1D1OA 1L7ZA 2KI6D 3BOWB 1JBAA 1MXEA 1QVIY 3CABA 1PSRA 2ZRSA 4N5XA 4ZCVA 2LMTA 1EH2A 5D7FA 1A4PA 5CSNA 3NSKA 1BU3A 1WDCB 3B88A 2JXLA 3WXAA 5HKWA 1Y0VH 4NDBA 3PLFB 2LP2A 3EVVA 2Y5IA 5DKRA 1SW8A 2JNFA 3I5IB 2ISDA 1GM0A 1JF0A 1AK8A 5FI6A 1IQ3A 1J7RA 1ZOTB 1M39A 4XJKB 1CDNA 1GGWA 1A75A 1S36A 2KLDA 1M31A 2WOSA 3JVTC 3BXKA 4HRGA 1OOHA 2P6BB 1SL9A 1SBJA 1S5GZ 3C1VA 4R1EA 2BL0C 3CTNA 1K93D 1UUSA 1ZFSA 5J3XA 1J7PA 2NZ0A 4TNCA 1QJTA 4HREE 4ZCUA 2QEBA 3SS4A 1K2HA 2FJUB 2QDIA 1CB1A 3I5FC 1CDMA 1ZACA 2JWWA 3SIBA 1NX0A 2GV5A 2KFHA 2M8UA 1A29A 2LUXA 1BR1B 5KTYA 3UO9A 1M46A 3SS5A 4F0ZB 2H2KA 1J7QA 3D10A 1KWOB 1AJ4A 1MHOA 1JF2A 2H8VA 2Y4QA 4FQTA 4YGAA 5IBWA 1CM1A 1PVAA 4OCIA 3TUYB 1B1GA 1BLQA 1X02A 3PN7C 1UHHA 3VGOA 4M2QA 1RTP1 3L4LA 2WCFA 1TUZA 4UPGA 2BBNA 4I5NB 5PALA 2L98A 3QRXA 1RROA 4HSZA 1XFXO 5CSIA 1KCYA 3IQQA 3GK1A 1C7VA 1N0YA 2K2AA 3TZ1A 3FIAA 1TCOB 4CLNA 2M7NA 5K89A 2M1KB 1CLBA 1DC1A 2I7AA 1J1DA 2EC6C 1XFVO 2QACA 2CBLA 3CR2A 1KFXL 1LS8A 1SCMB 1YTZC 3D0YA 2FOTA 1SR6B 1SSEB 1K94A 3K21A 3BOWA 4D1EA 1CM4A 1JC2A 1OOFA 1DF0A 2LUCA 1DGVA 1QX7A 4WQ3A 1RK9A 3CWGA 2LMUA 2JOJA 4ETOA 3SG5A 3AAKA 2K7CA 3QMEA 2JT8A 4I5LB 5FI7A 3VRPA 1TWOA 1V1GA 4AQIA 3VRQA 5FYXA 1WY9A 5JJGA 3HX4A 2I2RE 1NYAA 4CPVA 1Z2CB 4N1FA 3EKJA 1IKUA 1DJHA 4ICBA 1RECA 2KYCA 4XJKA 1S6JA 1C3ZA 3H4SE 1SMGA 2KDHA 1N2DA 4YGEB 1DQEA 1PK0D 4PE4A 3BUXB 2BKHB 4QJ4B 1L2OC 2MJWB 2QEVA 3TS5C 2H61A 1F54A 1JFKA 5DICA 4PALA 3OX5A 1KQVA 2BKIB 1WRZA 2OTGC 5D69A 2LVIA 4E68A 2KBMA 1M63B 1GJYA 4NDCA 3NSIA 3VRNA 2BL0B 2YGUA 2JULA 4GAOA 1K90D 4PE7A 2E6WA 1XFZO 3A8RA 1ORGA 2M0RA 2ZNEA 4YGDB 3WHUB 4GGNA 4INWA 3GOFA 4MZJA 5ER4X 3CGAA 2F3YA 3PM8A 1B7TZ 4WQ2A 5D3OA 3DZTA 2L51A 3I5FB 2KBIA 5I2QA 3SIAA 4PE1A 2M3WA 3D77A 1MF8B 3DYEA 2JT3A 3K1EA 1F55A 2HF5A 1JWDA 1CTRA 4MRYA 2V53A 1JFJA 4AOMA 2ERBA 4PHJA 2NCOA 1TN4A 5BPJA 3D75A 1F4QA 2QPTA 4MN0A 2KLEA 3BUOB 1S1EA 3RZSA 1IRJA 2MAZA 3PATA 1AVSA 2ZRTA 2KFFA 3OB1B 1OMVA 1DMOA 2KHNA 1WLMA 2M7LA 2WCBA 1UHJA 5TNCA 1QS7A 1YUSA 3O78A 4XYNA 3A4UB 2L5YA 4I5JA 3ZWHA 2WCLA 1KSMA 4JD9A 3I5HB 1LA3A 2WC6A 4DS7A 4U8DA 1TRFA 2EC6B 2VRGA 3BJHA 1B8LA 1OMRA 4N1GA 1R6PA 4PHNA 1LA0A 4QJ3B 4YGBB 1FF1A 1BJFA 5CSFA 1UURA 1XFRA 2KAVA 4ORCB 2KAXA 1W7JB 1KSOA 4PCWA 1W9ZA 3PSRA 3D76A 4C0JA 2LP3A 1KFUS 1LXFC 2WCKA 1OMDA 1QATA 1Y1AA 4GGFC 3FE6A 2SCPA 1IJ6A 3PM2A 2BBMA 2EGDA 2JTZA 5HYDA 2LVJA 1YVLA 2COLB 1CDPA 5KSZA 2KGRA 2PYQA 3DF0B 1C07A 2LAPA 1F71A 2AUCA 2JU0A 2WCJA 5HLVA 1J1EA 2ZNDA 1ALWA 1J55A 4PE0A 1K9UA 3R1PA 2OS8C 3CZ2A 2HPSA 2M97A 1WRLA 5CPVA 1L2OB 1IQ5A 2D8NA 3TS5B 1PVBA 2CNPA 2M49B 2WCMA 4P2YB 1TCFA 1XK4C 1DJWA 3BYAA 2OTGB 1QTXA 2L2EA 1DEKA 4JPZB 2E30A 1BF5A 1YUTA 1SCVA 1QASA 4BY5A 3S0FA 1P28A 2M9GA 3S0EA 2KGBC 3OP0A 1WLZA 1XFYO 2KYFA 1OSAA 3R1VA 1SRAA 3SJSA 1T14A 1CFDA 4IJ7A 1GGZA 1K8UA 4NDDA 3E3RA 1S6CA 2KOTA 3BUWB 3L4AA 3I5HC 2WNDA 1XK4A 4KYNA 2L4HA 5I2LA 3SG6A 1CLLA 3R72A 1S5GY 3BUNB 3NSOA 2L0PA 2K61A 3LCPC 3BUMB 1CNPA 1YVHA 1OZOA 5B8IB 1FI5A 2MLEC 3CR5X 1BOCA 1QV1A 2JRFA 4Q04A 1FPWA 4FQOA 2QEOA 1XO5A 3EKHA 1KK7Z 4BY4A 1TNQA 1MXLC 4HRHA 5HKYA 2CT9A 2G2BA 2PALA 3B86A 1B47A 3JTDC 2MA2A 1K9PA 2L4IA 3LL8B 3SG7A 1LVCD 1M45A 1A03A 1NX1A 2L5XB 2CTNA 2F2PA 3BFAA 3ZNIA 3EG5B 4M2PA 2KI4C 2HQWA 3FWCA 1NWDA 2JC2A 3GK2A 1F70A 4YRUA 1NP8A 2CCMA 1QV0A 3FS7A 4CFRA 1IGVA 1AP4A 2F33A 3KO0A 3SG2A 3EK7A 1F4OA 1OQPA 2GGMA 1K96A 1NIWA 1PULA 3CYZA 1QLSA 3IQOA 5HKZA 2JPTA 3D78A 1FBVA 2LM5A 4CIDA 3WHTB 2ZN9A 1J7OA 3SG4A 4YGCB 2OPOA 3OBVA 1CFFA 1OOJA 2KPHA 1QVIZ 4M2OA 3FWBA 1QXPA 1U5IB 3S0GA 4A4BA 2KQYA 1RWYA 1NSHA 2WC5A 2JTTA 2OS8B 1QX2A 1XA5A 3B6XA 3BFBA 4YI9A 3VROA 2F2OA 1SL8A 1NCZA 1SL7A 2G9BA 3VB1A 2LVKA 3TDIA 1S26D 1IJ5A 3D73A 5FI2A 5F6TA 5GQQC 2FCDA 3NHIA 1YR5A 1NUBA 3AKAA 2P70A 4C0LA 2LHLA 3AKBA 3DXLA 3RLZA 3V2LA 1W7IB 4OR9B 3O6BA 5KU1A 4QJ5B 2KNEA 3LK1A 1FW4A 1HT9A 1OW4A 1IWQA 4A4CA 1B8CA 3Q8IA 1CFCA 2WORA 1R2UA 1LINA 4YI8A 2NXQA 1QIVA 2WCHA 2M1UA 2WCEA 1JUOA 5DKQA 5HLOA 3I5GC 3CZ1A 2BCBA 1KK8C 2K7DA 1TOPA 1SKTA 3L47A 1YX7A 2L50A 3NGVA 2MRDA 1AHRA 1B7TY 1UWOA 4DCKA 1H8BA 1ZMZA 2KQ6A 3BQ3A 1MWNA 1CDLA 1KFUL 1CKKA 1GQMA 2HETA 4L9MA 1EG3A 3OX6A 1EL4A 1AJ5A
chains in the Genus database with same CATH topology
4GNKB 1DF0B 2JXCA 2EHBA 3EVUA 2MBXA 3EK4A 2K2FA 1YUUA 1MUXA 2BE6A 3JTDB 3KHEA 2MLFC 4YBHB 1NPQA 1HQVA 1JSAA 3DD4A 2JQ6A 1SNLA 3CS1A 2R2IA 3LLEA 5I8NA 2F8PA 3DVKA 4OKHA 2CXJA 1FI6A 1DTLA 2KI4B 1OE9B 3GK4X 1DJYA 3HCMA 3MSEB 2LNKA 3NSLA 3PFVA 4MEWA 4DIRA 4DUQA 4GGFA 2JNXA 2K7OA 4GUKA 1S3PA 1UP5A 3EVRA 2LMVA 1B8RA 2Q91A 2SASA 1NCYA 1QX5B 2FCEA 2LE9B 1DJIA 2GGZA 1EJ3A 1XFUO 2O5GA 4JQ0D 1U5IA 4FTGA 1QIWA 4JWQA 1DJXA 1SYMA 3LK0A 2K0JA 4MZLA 1ZUZA 4GFTA 1CMFA 4MVFA 1S6IA 1V1FA 2BE4A 4GPLB 4MBEA 4ORAB 3OHMB 1K95A 1UHKA 2AAOA 1YX8A 1TTXA 2I94A 3TDZA 3CZTX 3NXAA 1BMOA 1KQMC 5JOLA 1E8AA 4OVNF 1A2XA 2LVVA 1CLMA 2PSRA 1DVIA 1TNPA 1EG4A 2KAYA 2K7BA 3AAJA 1BT6A 1H4BA 1EXRA 1C7WA 2M29A 2NLNA 4MLWA 2K8MB 2LC5A 2DOQA 5G08A 2HQ8A 1AUIB 1SK6D 1Y1UA 2O60A 2TN4A 1LKJA 1WDCC 3PALA 1G8IA 2ZKMX 2BCAA 3ICBA 1OZSA 4C0KA 1K9KA 2LCPA 4MZKA 2A4JA 1ALVA 1BG1A 1Q80A 1KFXS 4ORBB 4NQGA 5CSJA 1DJGA 2JT0A 3I5IC 3CLNA 3I5GB 1WRKA 5AXIA 1KK8B 1F8HA 2KFGA 4CFQA 1UHNA 1PSBA 1NX3A 5AERA 1YRTB 2ZN8A 1SPYA 3KEVA 4WRIA 1XVJA 2H61C 2PVBA 4IL1A 4PHKA 1QLKA 3DF0A 2Q4UA 1YRUB 2NCPA 4MSPA 1NX2A 3DVEA 1Y1XA 1A75B 2LLUA 1RFJA 4GBAA 1SY9A 2BECA 3CR4X 2LLSA 1ODBA 3RM1A 1PALA 3M0WA 1B9AA 5AEQA 1TNXA 1TIZA 3O2PA 5DKNA 1VRKA 1CMGA 1DGUA 2LANA 4P5OE 1KK7Y 1KWOC 2LV7A 3EK8A 2PRUA 1N65A 5ER5A 1BR4B 3DVJA 3TUYC 3JVTB 4PHMA 1PRWA 1B4CA 2IS9A 4I5KA 1NCXA 2LHIA 2WC8A 1Y6WA 4AQJA 2Y1MA 2B1UA 3VRRA 3DVMA 2MHHA 1G4YR 1TNWA 1IH0A 5AFPA 1UHIA 1XYDA 4OV2A 4DRWA 5I2OA 1DJZA 2JZIA 3SG3A 2F3ZA 3IF7A 4PDZA 2KI6C 5AANA 1MQ1A 1MR8A 2I18A 1SCMC 2KSPA 3WNXB 2LLTA 1SR6C 1YURA 2PASA 1RJVA 2PMYA 2Y1NA 3TDUA 3O4YA 3KPXA 1BODA 1KQMB 2RGIA 3OB2B 3KF9A 4MRXA 3D0YB 4USLA 1XFWO 3PN7B 1IG5A 2AMIA 3F45A 1G33A 1DT7B 2BCXA 2ZFDA 1CFPA 1D1OA 1L7ZA 2KI6D 3BOWB 1JBAA 1MXEA 1QVIY 1PSRA 2ZRSA 4N5XA 4ZCVA 2LMTA 1EH2A 5D7FA 1A4PA 5CSNA 3NSKA 1BU3A 1WDCB 2JXLA 3WXAA 5HKWA 1Y0VH 4NDBA 3PLFB 2LP2A 3EVVA 2Y5IA 5DKRA 1SW8A 2JNFA 3I5IB 2ISDA 1JF0A 1AK8A 1IQ3A 1J7RA 1ZOTB 1M39A 4XJKB 1CDNA 1GGWA 1A75A 1S36A 3JVTC 1M31A 2WOSA 3BXKA 4HRGA 2P6BB 1SL9A 1SBJA 1S5GZ 3C1VA 4R1EA 2BL0C 3CTNA 1K93D 1UUSA 1ZFSA 5J3XA 1J7PA 2NZ0A 4TNCA 1QJTA 4HREE 4ZCUA 1K2HA 2FJUB 1CB1A 3I5FC 1CDMA 1ZACA 2JWWA 3SIBA 1NX0A 2GV5A 2KFHA 2M8UA 1A29A 2LUXA 1BR1B 5KTYA 1M46A 4F0ZB 2H2KA 1J7QA 3D10A 1KWOB 1AJ4A 1MHOA 1JF2A 2Y4QA 4YGAA 5IBWA 1CM1A 1PVAA 4OCIA 3TUYB 1B1GA 1BLQA 1X02A 3PN7C 1UHHA 3VGOA 4M2QA 1RTP1 2WCFA 4UPGA 2BBNA 4I5NB 5PALA 2L98A 3QRXA 1RROA 4HSZA 1XFXO 5CSIA 1KCYA 3IQQA 3GK1A 1C7VA 1N0YA 2K2AA 3TZ1A 3FIAA 1TCOB 4CLNA 2M7NA 5K89A 2M1KB 1CLBA 2I7AA 1J1DA 2EC6C 1XFVO 2QACA 3CR2A 3D0YA 1KFXL 1SCMB 1YTZC 2FOTA 1SR6B 1K94A 3K21A 3BOWA 4D1EA 1CM4A 1JC2A 1DF0A 2LUCA 1DGVA 1QX7A 4WQ3A 1RK9A 3CWGA 2LMUA 2JOJA 4ETOA 3SG5A 3AAKA 2K7CA 2JT8A 4I5LB 3VRPA 4AQIA 1V1GA 3VRQA 5FYXA 1WY9A 5JJGA 3HX4A 2I2RE 1NYAA 4CPVA 4N1FA 3EKJA 1IKUA 1DJHA 4ICBA 1RECA 2KYCA 4XJKA 1S6JA 3H4SE 1SMGA 2KDHA 1N2DA 4YGEB 1PK0D 4PE4A 3BUXB 2BKHB 4QJ4B 1L2OC 2MJWB 3TS5C 2H61A 1F54A 1JFKA 1KQVA 4PALA 3OX5A 2BKIB 1WRZA 2OTGC 5D69A 2LVIA 4E68A 2KBMA 1M63B 1GJYA 1AJ5A 3NSIA 4NDCA 3VRNA 2BL0B 2JULA 4GAOA 1K90D 4PE7A 2E6WA 1XFZO 3A8RA 4YGDB 2M0RA 2ZNEA 3WHUB 4GGNA 3GOFA 4MZJA 5ER4X 3CGAA 2F3YA 3PM8A 1B7TZ 4WQ2A 2L51A 3I5FB 2KBIA 5I2QA 3SIAA 4PE1A 2M3WA 1MF8B 2JT3A 1F55A 2HF5A 1JWDA 1CTRA 4MRYA 2V53A 1JFJA 4AOMA 4PHJA 2NCOA 1TN4A 5BPJA 1F4QA 2QPTA 4MN0A 3BUOB 1S1EA 1IRJA 2MAZA 3PATA 1AVSA 2ZRTA 2KFFA 3OB1B 1OMVA 1DMOA 2KHNA 1WLMA 2M7LA 2WCBA 1UHJA 5TNCA 1QS7A 1YUSA 3O78A 4XYNA 3A4UB 4I5JA 3ZWHA 1KSMA 3I5HB 1LA3A 4DS7A 4U8DA 1TRFA 2EC6B 2VRGA 4N1GA 1B8LA 1OMRA 1R6PA 4PHNA 1LA0A 4QJ3B 4YGBB 1FF1A 1BJFA 5CSFA 1UURA 2KAVA 4ORCB 2KAXA 1W7JB 1KSOA 4PCWA 3PSRA 4C0JA 2LP3A 1KFUS 1LXFC 1OMDA 1QATA 1Y1AA 4GGFC 2SCPA 1IJ6A 2BBMA 2EGDA 2JTZA 5HYDA 2LVJA 1YVLA 2COLB 1CDPA 5KSZA 2KGRA 3DF0B 1C07A 1F71A 2LAPA 2AUCA 2JU0A 5HLVA 1J1EA 2ZNDA 1ALWA 1J55A 4PE0A 1K9UA 2OS8C 2HPSA 2M97A 1WRLA 5CPVA 1L2OB 1IQ5A 2D8NA 3TS5B 1PVBA 2CNPA 2M49B 4P2YB 1TCFA 1XK4C 1DJWA 3BYAA 2OTGB 1QTXA 2L2EA 4JPZB 2E30A 1BF5A 1YUTA 1SCVA 1QASA 4BY5A 2M9GA 2KGBC 3OP0A 1WLZA 1XFYO 2KYFA 1OSAA 1SRAA 3SJSA 1CFDA 1GGZA 1K8UA 4NDDA 3E3RA 1S6CA 2KOTA 3BUWB 3I5HC 2WNDA 1XK4A 2L4HA 5I2LA 3SG6A 1CLLA 1S5GY 3BUNB 3NSOA 2L0PA 2K61A 3LCPC 3BUMB 1CNPA 1YVHA 1OZOA 5B8IB 1FI5A 2MLEC 3CR5X 1BOCA 1QV1A 2JRFA 4Q04A 1FPWA 4FQOA 1XO5A 3EKHA 1KK7Z 4BY4A 1TNQA 1MXLC 4HRHA 5HKYA 2CT9A 2G2BA 2PALA 3JTDC 1B47A 3LL8B 2MA2A 1K9PA 2L4IA 3SG7A 1LVCD 1M45A 1A03A 1NX1A 2L5XB 2CTNA 2F2PA 3ZNIA 4M2PA 2KI4C 2HQWA 3FWCA 1NWDA 2JC2A 3GK2A 1F70A 4YRUA 1NP8A 2CCMA 1QV0A 3FS7A 4CFRA 1IGVA 1AP4A 2F33A 3KO0A 3SG2A 3EK7A 1F4OA 1OQPA 2GGMA 1K96A 1NIWA 1PULA 1QLSA 3IQOA 5HKZA 2JPTA 4CIDA 1FBVA 2LM5A 1J7OA 3WHTB 2ZN9A 3SG4A 4YGCB 2OPOA 1CFFA 1OOJA 4M2OA 1QVIZ 3FWBA 1QXPA 1U5IB 4A4BA 2KQYA 1RWYA 1NSHA 2JTTA 2OS8B 1QX2A 1XA5A 4YI9A 3VROA 2F2OA 1SL8A 1NCZA 1SL7A 2G9BA 2LVKA 3TDIA 1S26D 1IJ5A 5GQQC 5F6TA 2FCDA 1YR5A 1NUBA 3AKAA 4C0LA 2LHLA 3AKBA 3RLZA 1W7IB 4OR9B 3O6BA 5KU1A 4QJ5B 2KNEA 3LK1A 1FW4A 1HT9A 1IWQA 4A4CA 1B8CA 1CFCA 2WORA 1R2UA 1LINA 4YI8A 2NXQA 1QIVA 2M1UA 2WCEA 1JUOA 5DKQA 5HLOA 3I5GC 2BCBA 1KK8C 2K7DA 1TOPA 1SKTA 1YX7A 2L50A 2MRDA 1AHRA 1B7TY 1UWOA 4DCKA 1H8BA 1ZMZA 2KQ6A 3BQ3A 1MWNA 1CDLA 1KFUL 1CKKA 1GQMA 2HETA 4L9MA 1EG3A 3OX6A 1EL4A 2CBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNK B;  1DF0 B;  2JXC A;  2EHB A;  3EVU A;  2MBX A;  3EK4 A;  2K2F A;  1YUU A;  1MUX A;  2BE6 A;  3JTD B;  3KHE A;  2MLF C;  4YBH B;  1NPQ A;  1HQV A;  1JSA A;  3DD4 A;  2JQ6 A;  1SNL A;  3CS1 A;  2R2I A;  3LLE A;  5I8N A;  2F8P A;  3DVK A;  4OKH A;  2CXJ A;  1FI6 A;  1DTL A;  2KI4 B;  1OE9 B;  3GK4 X;  1DJY A;  3HCM A;  3MSE B;  2LNK A;  3NSL A;  3PFV A;  4MEW A;  4DIR A;  4DUQ A;  4GGF A;  2JNX A;  2K7O A;  4GUK A;  1S3P A;  1UP5 A;  3EVR A;  2LMV A;  1B8R A;  2Q91 A;  2SAS A;  1NCY A;  1QX5 B;  2FCE A;  2LE9 B;  1DJI A;  2GGZ A;  1EJ3 A;  1XFU O;  2O5G A;  4JQ0 D;  1U5I A;  4FTG A;  1QIW A;  4JWQ A;  1DJX A;  1SYM A;  3LK0 A;  2K0J A;  4MZL A;  1ZUZ A;  4GFT A;  1CMF A;  4MVF A;  1S6I A;  1V1F A;  2BE4 A;  4GPL B;  4MBE A;  4ORA B;  3OHM B;  1K95 A;  1UHK A;  2AAO A;  1YX8 A;  1TTX A;  2I94 A;  3TDZ A;  3CZT X;  3NXA A;  1BMO A;  1KQM C;  5JOL A;  1E8A A;  4OVN F;  1A2X A;  2LVV A;  1CLM A;  2PSR A;  1DVI A;  1TNP A;  1EG4 A;  2KAY A;  2K7B A;  3AAJ A;  1BT6 A;  1H4B A;  1EXR A;  1C7W A;  2M29 A;  2NLN A;  4MLW A;  2K8M B;  2LC5 A;  2DOQ A;  5G08 A;  2HQ8 A;  1AUI B;  1SK6 D;  1Y1U A;  2O60 A;  2TN4 A;  1LKJ A;  1WDC C;  3PAL A;  1G8I A;  2ZKM X;  2BCA A;  3ICB A;  1OZS A;  4C0K A;  1K9K A;  2LCP A;  4MZK A;  2A4J A;  1ALV A;  1BG1 A;  1Q80 A;  1KFX S;  4ORB B;  4NQG A;  5CSJ A;  1DJG A;  2JT0 A;  3I5I C;  3CLN A;  3I5G B;  1WRK A;  5AXI A;  1KK8 B;  1F8H A;  2KFG A;  4CFQ A;  1UHN A;  1PSB A;  1NX3 A;  5AER A;  1YRT B;  2ZN8 A;  1SPY A;  3KEV A;  4WRI A;  1XVJ A;  2H61 C;  2PVB A;  4IL1 A;  4PHK A;  1QLK A;  3DF0 A;  2Q4U A;  1YRU B;  2NCP A;  4MSP A;  1NX2 A;  3DVE A;  1Y1X A;  1A75 B;  2LLU A;  1RFJ A;  4GBA A;  1SY9 A;  2BEC A;  3CR4 X;  2LLS A;  1ODB A;  3RM1 A;  1PAL A;  3M0W A;  1B9A A;  5AEQ A;  1TNX A;  1TIZ A;  3O2P A;  5DKN A;  1VRK A;  1CMG A;  1DGU A;  2LAN A;  4P5O E;  1KK7 Y;  1KWO C;  2LV7 A;  3EK8 A;  2PRU A;  1N65 A;  5ER5 A;  1BR4 B;  3DVJ A;  3TUY C;  3JVT B;  4PHM A;  1PRW A;  1B4C A;  2IS9 A;  4I5K A;  1NCX A;  2LHI A;  2WC8 A;  1Y6W A;  4AQJ A;  2Y1M A;  2B1U A;  3VRR A;  3DVM A;  2MHH A;  1G4Y R;  1TNW A;  1IH0 A;  5AFP A;  1UHI A;  1XYD A;  4OV2 A;  4DRW A;  5I2O A;  1DJZ A;  2JZI A;  3SG3 A;  2F3Z A;  3IF7 A;  4PDZ A;  2KI6 C;  5AAN A;  1MQ1 A;  1MR8 A;  2I18 A;  1SCM C;  2KSP A;  3WNX B;  2LLT A;  1SR6 C;  1YUR A;  2PAS A;  1RJV A;  2PMY A;  2Y1N A;  3TDU A;  3O4Y A;  3KPX A;  1BOD A;  1KQM B;  2RGI A;  3OB2 B;  3KF9 A;  4MRX A;  3D0Y B;  4USL A;  1XFW O;  3PN7 B;  1IG5 A;  2AMI A;  3F45 A;  1G33 A;  1DT7 B;  2BCX A;  2ZFD A;  1CFP A;  1D1O A;  1L7Z A;  2KI6 D;  3BOW B;  1JBA A;  1MXE A;  1QVI Y;  1PSR A;  2ZRS A;  4N5X A;  4ZCV A;  2LMT A;  1EH2 A;  5D7F A;  1A4P A;  5CSN A;  3NSK A;  1BU3 A;  1WDC B;  2JXL A;  3WXA A;  5HKW A;  1Y0V H;  4NDB A;  3PLF B;  2LP2 A;  3EVV A;  2Y5I A;  5DKR A;  1SW8 A;  2JNF A;  3I5I B;  2ISD A;  1JF0 A;  1AK8 A;  1IQ3 A;  1J7R A;  1ZOT B;  1M39 A;  4XJK B;  1CDN A;  1GGW A;  1A75 A;  1S36 A;  3JVT C;  1M31 A;  2WOS A;  3BXK A;  4HRG A;  2P6B B;  1SL9 A;  1SBJ A;  1S5G Z;  3C1V A;  4R1E A;  2BL0 C;  3CTN A;  1K93 D;  1UUS A;  1ZFS A;  5J3X A;  1J7P A;  2NZ0 A;  4TNC A;  1QJT A;  4HRE E;  4ZCU A;  1K2H A;  2FJU B;  1CB1 A;  3I5F C;  1CDM A;  1ZAC A;  2JWW A;  3SIB A;  1NX0 A;  2GV5 A;  2KFH A;  2M8U A;  1A29 A;  2LUX A;  1BR1 B;  5KTY A;  1M46 A;  4F0Z B;  2H2K A;  1J7Q A;  3D10 A;  1KWO B;  1AJ4 A;  1MHO A;  1JF2 A;  2Y4Q A;  4YGA A;  5IBW A;  1CM1 A;  1PVA A;  4OCI A;  3TUY B;  1B1G A;  1BLQ A;  1X02 A;  3PN7 C;  1UHH A;  3VGO A;  4M2Q A;  1RTP 1;  2WCF A;  4UPG A;  2BBN A;  4I5N B;  5PAL A;  2L98 A;  3QRX A;  1RRO A;  4HSZ A;  1XFX O;  5CSI A;  1KCY A;  3IQQ A;  3GK1 A;  1C7V A;  1N0Y A;  2K2A A;  3TZ1 A;  3FIA A;  1TCO B;  4CLN A;  2M7N A;  5K89 A;  2M1K B;  1CLB A;  2I7A A;  1J1D A;  2EC6 C;  1XFV O;  2QAC A;  3CR2 A;  3D0Y A;  1KFX L;  1SCM B;  1YTZ C;  2FOT A;  1SR6 B;  1K94 A;  3K21 A;  3BOW A;  4D1E A;  1CM4 A;  1JC2 A;  1DF0 A;  2LUC A;  1DGV A;  1QX7 A;  4WQ3 A;  1RK9 A;  3CWG A;  2LMU A;  2JOJ A;  4ETO A;  3SG5 A;  3AAK A;  2K7C A;  2JT8 A;  4I5L B;  3VRP A;  4AQI A;  1V1G A;  3VRQ A;  5FYX A;  1WY9 A;  5JJG A;  3HX4 A;  2I2R E;  1NYA A;  4CPV A;  4N1F A;  3EKJ A;  1IKU A;  1DJH A;  4ICB A;  1REC A;  2KYC A;  4XJK A;  1S6J A;  3H4S E;  1SMG A;  2KDH A;  1N2D A;  4YGE B;  1PK0 D;  4PE4 A;  3BUX B;  2BKH B;  4QJ4 B;  1L2O C;  2MJW B;  3TS5 C;  2H61 A;  1F54 A;  1JFK A;  1KQV A;  4PAL A;  3OX5 A;  2BKI B;  1WRZ A;  2OTG C;  5D69 A;  2LVI A;  4E68 A;  2KBM A;  1M63 B;  1GJY A;  1AJ5 A;  3NSI A;  4NDC A;  3VRN A;  2BL0 B;  2JUL A;  4GAO A;  1K90 D;  4PE7 A;  2E6W A;  1XFZ O;  3A8R A;  4YGD B;  2M0R A;  2ZNE A;  3WHU B;  4GGN A;  3GOF A;  4MZJ A;  5ER4 X;  3CGA A;  2F3Y A;  3PM8 A;  1B7T Z;  4WQ2 A;  2L51 A;  3I5F B;  2KBI A;  5I2Q A;  3SIA A;  4PE1 A;  2M3W A;  1MF8 B;  2JT3 A;  1F55 A;  2HF5 A;  1JWD A;  1CTR A;  4MRY A;  2V53 A;  1JFJ A;  4AOM A;  4PHJ A;  2NCO A;  1TN4 A;  5BPJ A;  1F4Q A;  2QPT A;  4MN0 A;  3BUO B;  1S1E A;  1IRJ A;  2MAZ A;  3PAT A;  1AVS A;  2ZRT A;  2KFF A;  3OB1 B;  1OMV A;  1DMO A;  2KHN A;  1WLM A;  2M7L A;  2WCB A;  1UHJ A;  5TNC A;  1QS7 A;  1YUS A;  3O78 A;  4XYN A;  3A4U B;  4I5J A;  3ZWH A;  1KSM A;  3I5H B;  1LA3 A;  4DS7 A;  4U8D A;  1TRF A;  2EC6 B;  2VRG A;  4N1G A;  1B8L A;  1OMR A;  1R6P A;  4PHN A;  1LA0 A;  4QJ3 B;  4YGB B;  1FF1 A;  1BJF A;  5CSF A;  1UUR A;  2KAV A;  4ORC B;  2KAX A;  1W7J B;  1KSO A;  4PCW A;  3PSR A;  4C0J A;  2LP3 A;  1KFU S;  1LXF C;  1OMD A;  1QAT A;  1Y1A A;  4GGF C;  2SCP A;  1IJ6 A;  2BBM A;  2EGD A;  2JTZ A;  5HYD A;  2LVJ A;  1YVL A;  2COL B;  1CDP A;  5KSZ A;  2KGR A;  3DF0 B;  1C07 A;  1F71 A;  2LAP A;  2AUC A;  2JU0 A;  5HLV A;  1J1E A;  2ZND A;  1ALW A;  1J55 A;  4PE0 A;  1K9U A;  2OS8 C;  2HPS A;  2M97 A;  1WRL A;  5CPV A;  1L2O B;  1IQ5 A;  2D8N A;  3TS5 B;  1PVB A;  2CNP A;  2M49 B;  4P2Y B;  1TCF A;  1XK4 C;  1DJW A;  3BYA A;  2OTG B;  1QTX A;  2L2E A;  4JPZ B;  2E30 A;  1BF5 A;  1YUT A;  1SCV A;  1QAS A;  4BY5 A;  2M9G A;  2KGB C;  3OP0 A;  1WLZ A;  1XFY O;  2KYF A;  1OSA A;  1SRA A;  3SJS A;  1CFD A;  1GGZ A;  1K8U A;  4NDD A;  3E3R A;  1S6C A;  2KOT A;  3BUW B;  3I5H C;  2WND A;  1XK4 A;  2L4H A;  5I2L A;  3SG6 A;  1CLL A;  1S5G Y;  3BUN B;  3NSO A;  2L0P A;  2K61 A;  3LCP C;  3BUM B;  1CNP A;  1YVH A;  1OZO A;  5B8I B;  1FI5 A;  2MLE C;  3CR5 X;  1BOC A;  1QV1 A;  2JRF A;  4Q04 A;  1FPW A;  4FQO A;  1XO5 A;  3EKH A;  1KK7 Z;  4BY4 A;  1TNQ A;  1MXL C;  4HRH A;  5HKY A;  2CT9 A;  2G2B A;  2PAL A;  3JTD C;  1B47 A;  3LL8 B;  2MA2 A;  1K9P A;  2L4I A;  3SG7 A;  1LVC D;  1M45 A;  1A03 A;  1NX1 A;  2L5X B;  2CTN A;  2F2P A;  3ZNI A;  4M2P A;  2KI4 C;  2HQW A;  3FWC A;  1NWD A;  2JC2 A;  3GK2 A;  1F70 A;  4YRU A;  1NP8 A;  2CCM A;  1QV0 A;  3FS7 A;  4CFR A;  1IGV A;  1AP4 A;  2F33 A;  3KO0 A;  3SG2 A;  3EK7 A;  1F4O A;  1OQP A;  2GGM A;  1K96 A;  1NIW A;  1PUL A;  1QLS A;  3IQO A;  5HKZ A;  2JPT A;  4CID A;  1FBV A;  2LM5 A;  1J7O A;  3WHT B;  2ZN9 A;  3SG4 A;  4YGC B;  2OPO A;  1CFF A;  1OOJ A;  4M2O A;  1QVI Z;  3FWB A;  1QXP A;  1U5I B;  4A4B A;  2KQY A;  1RWY A;  1NSH A;  2JTT A;  2OS8 B;  1QX2 A;  1XA5 A;  4YI9 A;  3VRO A;  2F2O A;  1SL8 A;  1NCZ A;  1SL7 A;  2G9B A;  2LVK A;  3TDI A;  1S26 D;  1IJ5 A;  5GQQ C;  5F6T A;  2FCD A;  1YR5 A;  1NUB A;  3AKA A;  4C0L A;  2LHL A;  3AKB A;  3RLZ A;  1W7I B;  4OR9 B;  3O6B A;  5KU1 A;  4QJ5 B;  2KNE A;  3LK1 A;  1FW4 A;  1HT9 A;  1IWQ A;  4A4C A;  1B8C A;  1CFC A;  2WOR A;  1R2U A;  1LIN A;  4YI8 A;  2NXQ A;  1QIV A;  2M1U A;  2WCE A;  1JUO A;  5DKQ A;  5HLO A;  3I5G C;  2BCB A;  1KK8 C;  2K7D A;  1TOP A;  1SKT A;  1YX7 A;  2L50 A;  2MRD A;  1AHR A;  1B7T Y;  1UWO A;  4DCK A;  1H8B A;  1ZMZ A;  2KQ6 A;  3BQ3 A;  1MWN A;  1CDL A;  1KFU L;  1CKK A;  1GQM A;  2HET A;  4L9M A;  1EG3 A;  3OX6 A;  1EL4 A;  2CBL A; 
#chains in the Genus database with same CATH topology
 4GNK B;  1DF0 B;  2JXC A;  2EHB A;  3EVU A;  2MBX A;  3EK4 A;  2K2F A;  1YUU A;  1MUX A;  2BE6 A;  3JTD B;  3KHE A;  2MLF C;  4JKT A;  4YBH B;  1NPQ A;  1HQV A;  3CDN A;  1JSA A;  1IIO A;  3DD4 A;  2JQ6 A;  1SNL A;  3CS1 A;  2R2I A;  1QWV A;  3LLE A;  2F8P A;  3DVK A;  4PT1 A;  5I8N A;  4OKH A;  2CXJ A;  3S0A A;  1FI6 A;  1DTL A;  3S0D A;  3IVT A;  2KI4 B;  1OE9 B;  3GK4 X;  1DJY A;  3HCM A;  3MSE B;  2LNK A;  3N7H A;  3NSL A;  3PFV A;  4MEW A;  4DIR A;  4GGF A;  2JNX A;  2K7O A;  4GUK A;  1S3P A;  1UP5 A;  3EVR A;  2LMV A;  1B8R A;  1OOG A;  2Q91 A;  2SAS A;  1NCY A;  1QX5 B;  2FCE A;  2LE9 B;  1DJI A;  2GGZ A;  1EJ3 A;  1XFU O;  2O5G A;  4JQ0 D;  1U5I A;  2JPO A;  4FTG A;  1QIW A;  4JWQ A;  1DJX A;  1SYM A;  3LK0 A;  2K0J A;  4MZL A;  1ZUZ A;  4GFT A;  1Z4H A;  1CMF A;  4MVF A;  1S6I A;  1V1F A;  2BE4 A;  4GPL B;  4MBE A;  4ORA B;  3BFH A;  1K95 A;  1UHK A;  3OHM B;  2AAO A;  1YX8 A;  1TTX A;  2I94 A;  3TDZ A;  2K60 A;  3CZT X;  3NXA A;  1BMO A;  1KQM C;  5JOL A;  3FE8 A;  1E8A A;  3D74 A;  3NHT A;  1A2X A;  2LVV A;  1CLM A;  2PSR A;  4OVN F;  1DVI A;  1TNP A;  1EG4 A;  2KAY A;  2K7B A;  3AAJ A;  1BT6 A;  1H4B A;  1EXR A;  1C7W A;  2M29 A;  2NLN A;  3B87 A;  4MLW A;  4OZD A;  2K8M B;  2LC5 A;  2DOQ A;  5G08 A;  2HQ8 A;  1AUI B;  3DY9 A;  1SK6 D;  1Y1U A;  2O60 A;  3CZ0 A;  2TN4 A;  1LKJ A;  1WDC C;  3PAL A;  1G8I A;  3S0B A;  2ZKM X;  2BCA A;  3FE9 A;  3ICB A;  1OZS A;  4C0K A;  1K9K A;  2LCP A;  4MZK A;  2A4J A;  1ALV A;  1BG1 A;  1Q80 A;  1KFX S;  4ORB B;  4NQG A;  5CSJ A;  1DJG A;  2JT0 A;  3I5I C;  2FJY A;  3CLN A;  1WRK A;  3I5G B;  5AXI A;  1KK8 B;  1F8H A;  2KFG A;  3B7A A;  4CFQ A;  1UHN A;  1PSB A;  3OGN A;  1NX3 A;  5AER A;  1C3Y A;  1YRT B;  2BAP A;  2GTE A;  2ZN8 A;  1SPY A;  3KEV A;  4WRI A;  1XVJ A;  2H61 C;  2PVB A;  4IL1 A;  4PHK A;  1QLK A;  3DF0 A;  2Q4U A;  1YRU B;  2NCP A;  4MSP A;  1NX2 A;  3DVE A;  1Y1X A;  1A75 B;  3O4X A;  2LLU A;  1RFJ A;  3PJI A;  3SS3 A;  4GBA A;  1SY9 A;  2BEC A;  3CR4 X;  2LLS A;  1ODB A;  2PQL A;  3RM1 A;  1DEL A;  1PAL A;  3M0W A;  1B9A A;  2P71 A;  5AEQ A;  1TNX A;  1TIZ A;  3O2P A;  5DKN A;  1VRK A;  1CMG A;  1DGU A;  2LAN A;  4P5O E;  2BNX A;  1KK7 Y;  1KWO C;  2LV7 A;  3EK8 A;  2PRU A;  1N65 A;  5ER5 A;  3R1O A;  1BR4 B;  3DVJ A;  3TUY C;  3JVT B;  4PHM A;  1PRW A;  5I94 A;  1B4C A;  2IS9 A;  4I5K A;  5HL1 A;  1NCX A;  2LHI A;  2WC8 A;  1Y6W A;  2L2C A;  4AQJ A;  2Y1M A;  2B1U A;  4DUQ A;  1TUJ A;  3VRR A;  4F7F A;  5EL2 A;  3DVM A;  2MHH A;  1G4Y R;  1TNW A;  1IH0 A;  5AFP A;  1UHI A;  1XYD A;  4INX A;  4OV2 A;  4DRW A;  5I2O A;  1DJZ A;  2JZI A;  3SG3 A;  2F3Z A;  3IF7 A;  4PDZ A;  2KI6 C;  5AAN A;  1MQ1 A;  1MR8 A;  2I18 A;  1SCM C;  2KSP A;  3WNX B;  2LLT A;  1SR6 C;  1YUR A;  2PAS A;  1RJV A;  3UNW A;  2PMY A;  2Y1N A;  3TDU A;  3O4Y A;  3KPX A;  1BOD A;  1KQM B;  1OOI X;  2RGI A;  3OB2 B;  2QEH A;  3KF9 A;  4MRX A;  3D0Y B;  4USL A;  1XFW O;  3PN7 B;  1IG5 A;  2AMI A;  3F45 A;  1G33 A;  1DT7 B;  2BCX A;  2ZFD A;  1CFP A;  1D1O A;  1L7Z A;  2KI6 D;  3BOW B;  1JBA A;  1MXE A;  1QVI Y;  3CAB A;  1PSR A;  2ZRS A;  4N5X A;  4ZCV A;  2LMT A;  1EH2 A;  5D7F A;  1A4P A;  5CSN A;  3NSK A;  1BU3 A;  1WDC B;  3B88 A;  2JXL A;  3WXA A;  5HKW A;  1Y0V H;  4NDB A;  3PLF B;  2LP2 A;  3EVV A;  2Y5I A;  5DKR A;  1SW8 A;  2JNF A;  3I5I B;  2ISD A;  1GM0 A;  1JF0 A;  1AK8 A;  5FI6 A;  1IQ3 A;  1J7R A;  1ZOT B;  1M39 A;  4XJK B;  1CDN A;  1GGW A;  1A75 A;  1S36 A;  2KLD A;  1M31 A;  2WOS A;  3JVT C;  3BXK A;  4HRG A;  1OOH A;  2P6B B;  1SL9 A;  1SBJ A;  1S5G Z;  3C1V A;  4R1E A;  2BL0 C;  3CTN A;  1K93 D;  1UUS A;  1ZFS A;  5J3X A;  1J7P A;  2NZ0 A;  4TNC A;  1QJT A;  4HRE E;  4ZCU A;  2QEB A;  3SS4 A;  1K2H A;  2FJU B;  2QDI A;  1CB1 A;  3I5F C;  1CDM A;  1ZAC A;  2JWW A;  3SIB A;  1NX0 A;  2GV5 A;  2KFH A;  2M8U A;  1A29 A;  2LUX A;  1BR1 B;  5KTY A;  3UO9 A;  1M46 A;  3SS5 A;  4F0Z B;  2H2K A;  1J7Q A;  3D10 A;  1KWO B;  1AJ4 A;  1MHO A;  1JF2 A;  2H8V A;  2Y4Q A;  4FQT A;  4YGA A;  5IBW A;  1CM1 A;  1PVA A;  4OCI A;  3TUY B;  1B1G A;  1BLQ A;  1X02 A;  3PN7 C;  1UHH A;  3VGO A;  4M2Q A;  1RTP 1;  3L4L A;  2WCF A;  1TUZ A;  4UPG A;  2BBN A;  4I5N B;  5PAL A;  2L98 A;  3QRX A;  1RRO A;  4HSZ A;  1XFX O;  5CSI A;  1KCY A;  3IQQ A;  3GK1 A;  1C7V A;  1N0Y A;  2K2A A;  3TZ1 A;  3FIA A;  1TCO B;  4CLN A;  2M7N A;  5K89 A;  2M1K B;  1CLB A;  1DC1 A;  2I7A A;  1J1D A;  2EC6 C;  1XFV O;  2QAC A;  2CBL A;  3CR2 A;  1KFX L;  1LS8 A;  1SCM B;  1YTZ C;  3D0Y A;  2FOT A;  1SR6 B;  1SSE B;  1K94 A;  3K21 A;  3BOW A;  4D1E A;  1CM4 A;  1JC2 A;  1OOF A;  1DF0 A;  2LUC A;  1DGV A;  1QX7 A;  4WQ3 A;  1RK9 A;  3CWG A;  2LMU A;  2JOJ A;  4ETO A;  3SG5 A;  3AAK A;  2K7C A;  3QME A;  2JT8 A;  4I5L B;  5FI7 A;  3VRP A;  1TWO A;  1V1G A;  4AQI A;  3VRQ A;  5FYX A;  1WY9 A;  5JJG A;  3HX4 A;  2I2R E;  1NYA A;  4CPV A;  1Z2C B;  4N1F A;  3EKJ A;  1IKU A;  1DJH A;  4ICB A;  1REC A;  2KYC A;  4XJK A;  1S6J A;  1C3Z A;  3H4S E;  1SMG A;  2KDH A;  1N2D A;  4YGE B;  1DQE A;  1PK0 D;  4PE4 A;  3BUX B;  2BKH B;  4QJ4 B;  1L2O C;  2MJW B;  2QEV A;  3TS5 C;  2H61 A;  1F54 A;  1JFK A;  5DIC A;  4PAL A;  3OX5 A;  1KQV A;  2BKI B;  1WRZ A;  2OTG C;  5D69 A;  2LVI A;  4E68 A;  2KBM A;  1M63 B;  1GJY A;  4NDC A;  3NSI A;  3VRN A;  2BL0 B;  2YGU A;  2JUL A;  4GAO A;  1K90 D;  4PE7 A;  2E6W A;  1XFZ O;  3A8R A;  1ORG A;  2M0R A;  2ZNE A;  4YGD B;  3WHU B;  4GGN A;  4INW A;  3GOF A;  4MZJ A;  5ER4 X;  3CGA A;  2F3Y A;  3PM8 A;  1B7T Z;  4WQ2 A;  5D3O A;  3DZT A;  2L51 A;  3I5F B;  2KBI A;  5I2Q A;  3SIA A;  4PE1 A;  2M3W A;  3D77 A;  1MF8 B;  3DYE A;  2JT3 A;  3K1E A;  1F55 A;  2HF5 A;  1JWD A;  1CTR A;  4MRY A;  2V53 A;  1JFJ A;  4AOM A;  2ERB A;  4PHJ A;  2NCO A;  1TN4 A;  5BPJ A;  3D75 A;  1F4Q A;  2QPT A;  4MN0 A;  2KLE A;  3BUO B;  1S1E A;  3RZS A;  1IRJ A;  2MAZ A;  3PAT A;  1AVS A;  2ZRT A;  2KFF A;  3OB1 B;  1OMV A;  1DMO A;  2KHN A;  1WLM A;  2M7L A;  2WCB A;  1UHJ A;  5TNC A;  1QS7 A;  1YUS A;  3O78 A;  4XYN A;  3A4U B;  2L5Y A;  4I5J A;  3ZWH A;  2WCL A;  1KSM A;  4JD9 A;  3I5H B;  1LA3 A;  2WC6 A;  4DS7 A;  4U8D A;  1TRF A;  2EC6 B;  2VRG A;  3BJH A;  1B8L A;  1OMR A;  4N1G A;  1R6P A;  4PHN A;  1LA0 A;  4QJ3 B;  4YGB B;  1FF1 A;  1BJF A;  5CSF A;  1UUR A;  1XFR A;  2KAV A;  4ORC B;  2KAX A;  1W7J B;  1KSO A;  4PCW A;  1W9Z A;  3PSR A;  3D76 A;  4C0J A;  2LP3 A;  1KFU S;  1LXF C;  2WCK A;  1OMD A;  1QAT A;  1Y1A A;  4GGF C;  3FE6 A;  2SCP A;  1IJ6 A;  3PM2 A;  2BBM A;  2EGD A;  2JTZ A;  5HYD A;  2LVJ A;  1YVL A;  2COL B;  1CDP A;  5KSZ A;  2KGR A;  2PYQ A;  3DF0 B;  1C07 A;  2LAP A;  1F71 A;  2AUC A;  2JU0 A;  2WCJ A;  5HLV A;  1J1E A;  2ZND A;  1ALW A;  1J55 A;  4PE0 A;  1K9U A;  3R1P A;  2OS8 C;  3CZ2 A;  2HPS A;  2M97 A;  1WRL A;  5CPV A;  1L2O B;  1IQ5 A;  2D8N A;  3TS5 B;  1PVB A;  2CNP A;  2M49 B;  2WCM A;  4P2Y B;  1TCF A;  1XK4 C;  1DJW A;  3BYA A;  2OTG B;  1QTX A;  2L2E A;  1DEK A;  4JPZ B;  2E30 A;  1BF5 A;  1YUT A;  1SCV A;  1QAS A;  4BY5 A;  3S0F A;  1P28 A;  2M9G A;  3S0E A;  2KGB C;  3OP0 A;  1WLZ A;  1XFY O;  2KYF A;  1OSA A;  3R1V A;  1SRA A;  3SJS A;  1T14 A;  1CFD A;  4IJ7 A;  1GGZ A;  1K8U A;  4NDD A;  3E3R A;  1S6C A;  2KOT A;  3BUW B;  3L4A A;  3I5H C;  2WND A;  1XK4 A;  4KYN A;  2L4H A;  5I2L A;  3SG6 A;  1CLL A;  3R72 A;  1S5G Y;  3BUN B;  3NSO A;  2L0P A;  2K61 A;  3LCP C;  3BUM B;  1CNP A;  1YVH A;  1OZO A;  5B8I B;  1FI5 A;  2MLE C;  3CR5 X;  1BOC A;  1QV1 A;  2JRF A;  4Q04 A;  1FPW A;  4FQO A;  2QEO A;  1XO5 A;  3EKH A;  1KK7 Z;  4BY4 A;  1TNQ A;  1MXL C;  4HRH A;  5HKY A;  2CT9 A;  2G2B A;  2PAL A;  3B86 A;  1B47 A;  3JTD C;  2MA2 A;  1K9P A;  2L4I A;  3LL8 B;  3SG7 A;  1LVC D;  1M45 A;  1A03 A;  1NX1 A;  2L5X B;  2CTN A;  2F2P A;  3BFA A;  3ZNI A;  3EG5 B;  4M2P A;  2KI4 C;  2HQW A;  3FWC A;  1NWD A;  2JC2 A;  3GK2 A;  1F70 A;  4YRU A;  1NP8 A;  2CCM A;  1QV0 A;  3FS7 A;  4CFR A;  1IGV A;  1AP4 A;  2F33 A;  3KO0 A;  3SG2 A;  3EK7 A;  1F4O A;  1OQP A;  2GGM A;  1K96 A;  1NIW A;  1PUL A;  3CYZ A;  1QLS A;  3IQO A;  5HKZ A;  2JPT A;  3D78 A;  1FBV A;  2LM5 A;  4CID A;  3WHT B;  2ZN9 A;  1J7O A;  3SG4 A;  4YGC B;  2OPO A;  3OBV A;  1CFF A;  1OOJ A;  2KPH A;  1QVI Z;  4M2O A;  3FWB A;  1QXP A;  1U5I B;  3S0G A;  4A4B A;  2KQY A;  1RWY A;  1NSH A;  2WC5 A;  2JTT A;  2OS8 B;  1QX2 A;  1XA5 A;  3B6X A;  3BFB A;  4YI9 A;  3VRO A;  2F2O A;  1SL8 A;  1NCZ A;  1SL7 A;  2G9B A;  3VB1 A;  2LVK A;  3TDI A;  1S26 D;  1IJ5 A;  3D73 A;  5FI2 A;  5F6T A;  5GQQ C;  2FCD A;  3NHI A;  1YR5 A;  1NUB A;  3AKA A;  2P70 A;  4C0L A;  2LHL A;  3AKB A;  3DXL A;  3RLZ A;  3V2L A;  1W7I B;  4OR9 B;  3O6B A;  5KU1 A;  4QJ5 B;  2KNE A;  3LK1 A;  1FW4 A;  1HT9 A;  1OW4 A;  1IWQ A;  4A4C A;  1B8C A;  3Q8I A;  1CFC A;  2WOR A;  1R2U A;  1LIN A;  4YI8 A;  2NXQ A;  1QIV A;  2WCH A;  2M1U A;  2WCE A;  1JUO A;  5DKQ A;  5HLO A;  3I5G C;  3CZ1 A;  2BCB A;  1KK8 C;  2K7D A;  1TOP A;  1SKT A;  3L47 A;  1YX7 A;  2L50 A;  3NGV A;  2MRD A;  1AHR A;  1B7T Y;  1UWO A;  4DCK A;  1H8B A;  1ZMZ A;  2KQ6 A;  3BQ3 A;  1MWN A;  1CDL A;  1KFU L;  1CKK A;  1GQM A;  2HET A;  4L9M A;  1EG3 A;  3OX6 A;  1EL4 A;  1AJ5 A; 
#chains in the Genus database with same CATH homology
 4GNK B;  1DF0 B;  2JXC A;  2EHB A;  3EVU A;  2MBX A;  3EK4 A;  2K2F A;  1YUU A;  1MUX A;  2BE6 A;  3JTD B;  3KHE A;  2MLF C;  4YBH B;  1NPQ A;  1HQV A;  1JSA A;  3DD4 A;  2JQ6 A;  1SNL A;  3CS1 A;  2R2I A;  3LLE A;  5I8N A;  2F8P A;  3DVK A;  4OKH A;  2CXJ A;  1FI6 A;  1DTL A;  2KI4 B;  1OE9 B;  3GK4 X;  1DJY A;  3HCM A;  3MSE B;  2LNK A;  3NSL A;  3PFV A;  4MEW A;  4DIR A;  4DUQ A;  4GGF A;  2JNX A;  2K7O A;  4GUK A;  1S3P A;  1UP5 A;  3EVR A;  2LMV A;  1B8R A;  2Q91 A;  2SAS A;  1NCY A;  1QX5 B;  2FCE A;  2LE9 B;  1DJI A;  2GGZ A;  1EJ3 A;  1XFU O;  2O5G A;  4JQ0 D;  1U5I A;  4FTG A;  1QIW A;  4JWQ A;  1DJX A;  1SYM A;  3LK0 A;  2K0J A;  4MZL A;  1ZUZ A;  4GFT A;  1CMF A;  4MVF A;  1S6I A;  1V1F A;  2BE4 A;  4GPL B;  4MBE A;  4ORA B;  3OHM B;  1K95 A;  1UHK A;  2AAO A;  1YX8 A;  1TTX A;  2I94 A;  3TDZ A;  3CZT X;  3NXA A;  1BMO A;  1KQM C;  5JOL A;  1E8A A;  4OVN F;  1A2X A;  2LVV A;  1CLM A;  2PSR A;  1DVI A;  1TNP A;  1EG4 A;  2KAY A;  2K7B A;  3AAJ A;  1BT6 A;  1H4B A;  1EXR A;  1C7W A;  2M29 A;  2NLN A;  4MLW A;  2K8M B;  2LC5 A;  2DOQ A;  5G08 A;  2HQ8 A;  1AUI B;  1SK6 D;  1Y1U A;  2O60 A;  2TN4 A;  1LKJ A;  1WDC C;  3PAL A;  1G8I A;  2ZKM X;  2BCA A;  3ICB A;  1OZS A;  4C0K A;  1K9K A;  2LCP A;  4MZK A;  2A4J A;  1ALV A;  1BG1 A;  1Q80 A;  1KFX S;  4ORB B;  4NQG A;  5CSJ A;  1DJG A;  2JT0 A;  3I5I C;  3CLN A;  3I5G B;  1WRK A;  5AXI A;  1KK8 B;  1F8H A;  2KFG A;  4CFQ A;  1UHN A;  1PSB A;  1NX3 A;  5AER A;  1YRT B;  2ZN8 A;  1SPY A;  3KEV A;  4WRI A;  1XVJ A;  2H61 C;  2PVB A;  4IL1 A;  4PHK A;  1QLK A;  3DF0 A;  2Q4U A;  1YRU B;  2NCP A;  4MSP A;  1NX2 A;  3DVE A;  1Y1X A;  1A75 B;  2LLU A;  1RFJ A;  4GBA A;  1SY9 A;  2BEC A;  3CR4 X;  2LLS A;  1ODB A;  3RM1 A;  1PAL A;  3M0W A;  1B9A A;  5AEQ A;  1TNX A;  1TIZ A;  3O2P A;  5DKN A;  1VRK A;  1CMG A;  1DGU A;  2LAN A;  4P5O E;  1KK7 Y;  1KWO C;  2LV7 A;  3EK8 A;  2PRU A;  1N65 A;  5ER5 A;  1BR4 B;  3DVJ A;  3TUY C;  3JVT B;  4PHM A;  1PRW A;  1B4C A;  2IS9 A;  4I5K A;  1NCX A;  2LHI A;  2WC8 A;  1Y6W A;  4AQJ A;  2Y1M A;  2B1U A;  3VRR A;  3DVM A;  2MHH A;  1G4Y R;  1TNW A;  1IH0 A;  5AFP A;  1UHI A;  1XYD A;  4OV2 A;  4DRW A;  5I2O A;  1DJZ A;  2JZI A;  3SG3 A;  2F3Z A;  3IF7 A;  4PDZ A;  2KI6 C;  5AAN A;  1MQ1 A;  1MR8 A;  2I18 A;  1SCM C;  2KSP A;  3WNX B;  2LLT A;  1SR6 C;  1YUR A;  2PAS A;  1RJV A;  2PMY A;  2Y1N A;  3TDU A;  3O4Y A;  3KPX A;  1BOD A;  1KQM B;  2RGI A;  3OB2 B;  3KF9 A;  4MRX A;  3D0Y B;  4USL A;  1XFW O;  3PN7 B;  1IG5 A;  2AMI A;  3F45 A;  1G33 A;  1DT7 B;  2BCX A;  2ZFD A;  1CFP A;  1D1O A;  1L7Z A;  2KI6 D;  3BOW B;  1JBA A;  1MXE A;  1QVI Y;  1PSR A;  2ZRS A;  4N5X A;  4ZCV A;  2LMT A;  1EH2 A;  5D7F A;  1A4P A;  5CSN A;  3NSK A;  1BU3 A;  1WDC B;  2JXL A;  3WXA A;  5HKW A;  1Y0V H;  4NDB A;  3PLF B;  2LP2 A;  3EVV A;  2Y5I A;  5DKR A;  1SW8 A;  2JNF A;  3I5I B;  2ISD A;  1JF0 A;  1AK8 A;  1IQ3 A;  1J7R A;  1ZOT B;  1M39 A;  4XJK B;  1CDN A;  1GGW A;  1A75 A;  1S36 A;  3JVT C;  1M31 A;  2WOS A;  3BXK A;  4HRG A;  2P6B B;  1SL9 A;  1SBJ A;  1S5G Z;  3C1V A;  4R1E A;  2BL0 C;  3CTN A;  1K93 D;  1UUS A;  1ZFS A;  5J3X A;  1J7P A;  2NZ0 A;  4TNC A;  1QJT A;  4HRE E;  4ZCU A;  1K2H A;  2FJU B;  1CB1 A;  3I5F C;  1CDM A;  1ZAC A;  2JWW A;  3SIB A;  1NX0 A;  2GV5 A;  2KFH A;  2M8U A;  1A29 A;  2LUX A;  1BR1 B;  5KTY A;  1M46 A;  4F0Z B;  2H2K A;  1J7Q A;  3D10 A;  1KWO B;  1AJ4 A;  1MHO A;  1JF2 A;  2Y4Q A;  4YGA A;  5IBW A;  1CM1 A;  1PVA A;  4OCI A;  3TUY B;  1B1G A;  1BLQ A;  1X02 A;  3PN7 C;  1UHH A;  3VGO A;  4M2Q A;  1RTP 1;  2WCF A;  4UPG A;  2BBN A;  4I5N B;  5PAL A;  2L98 A;  3QRX A;  1RRO A;  4HSZ A;  1XFX O;  5CSI A;  1KCY A;  3IQQ A;  3GK1 A;  1C7V A;  1N0Y A;  2K2A A;  3TZ1 A;  3FIA A;  1TCO B;  4CLN A;  2M7N A;  5K89 A;  2M1K B;  1CLB A;  2I7A A;  1J1D A;  2EC6 C;  1XFV O;  2QAC A;  3CR2 A;  3D0Y A;  1KFX L;  1SCM B;  1YTZ C;  2FOT A;  1SR6 B;  1K94 A;  3K21 A;  3BOW A;  4D1E A;  1CM4 A;  1JC2 A;  1DF0 A;  2LUC A;  1DGV A;  1QX7 A;  4WQ3 A;  1RK9 A;  3CWG A;  2LMU A;  2JOJ A;  4ETO A;  3SG5 A;  3AAK A;  2K7C A;  2JT8 A;  4I5L B;  3VRP A;  4AQI A;  1V1G A;  3VRQ A;  5FYX A;  1WY9 A;  5JJG A;  3HX4 A;  2I2R E;  1NYA A;  4CPV A;  4N1F A;  3EKJ A;  1IKU A;  1DJH A;  4ICB A;  1REC A;  2KYC A;  4XJK A;  1S6J A;  3H4S E;  1SMG A;  2KDH A;  1N2D A;  4YGE B;  1PK0 D;  4PE4 A;  3BUX B;  2BKH B;  4QJ4 B;  1L2O C;  2MJW B;  3TS5 C;  2H61 A;  1F54 A;  1JFK A;  1KQV A;  4PAL A;  3OX5 A;  2BKI B;  1WRZ A;  2OTG C;  5D69 A;  2LVI A;  4E68 A;  2KBM A;  1M63 B;  1GJY A;  1AJ5 A;  3NSI A;  4NDC A;  3VRN A;  2BL0 B;  2JUL A;  4GAO A;  1K90 D;  4PE7 A;  2E6W A;  1XFZ O;  3A8R A;  4YGD B;  2M0R A;  2ZNE A;  3WHU B;  4GGN A;  3GOF A;  4MZJ A;  5ER4 X;  3CGA A;  2F3Y A;  3PM8 A;  1B7T Z;  4WQ2 A;  2L51 A;  3I5F B;  2KBI A;  5I2Q A;  3SIA A;  4PE1 A;  2M3W A;  1MF8 B;  2JT3 A;  1F55 A;  2HF5 A;  1JWD A;  1CTR A;  4MRY A;  2V53 A;  1JFJ A;  4AOM A;  4PHJ A;  2NCO A;  1TN4 A;  5BPJ A;  1F4Q A;  2QPT A;  4MN0 A;  3BUO B;  1S1E A;  1IRJ A;  2MAZ A;  3PAT A;  1AVS A;  2ZRT A;  2KFF A;  3OB1 B;  1OMV A;  1DMO A;  2KHN A;  1WLM A;  2M7L A;  2WCB A;  1UHJ A;  5TNC A;  1QS7 A;  1YUS A;  3O78 A;  4XYN A;  3A4U B;  4I5J A;  3ZWH A;  1KSM A;  3I5H B;  1LA3 A;  4DS7 A;  4U8D A;  1TRF A;  2EC6 B;  2VRG A;  4N1G A;  1B8L A;  1OMR A;  1R6P A;  4PHN A;  1LA0 A;  4QJ3 B;  4YGB B;  1FF1 A;  1BJF A;  5CSF A;  1UUR A;  2KAV A;  4ORC B;  2KAX A;  1W7J B;  1KSO A;  4PCW A;  3PSR A;  4C0J A;  2LP3 A;  1KFU S;  1LXF C;  1OMD A;  1QAT A;  1Y1A A;  4GGF C;  2SCP A;  1IJ6 A;  2BBM A;  2EGD A;  2JTZ A;  5HYD A;  2LVJ A;  1YVL A;  2COL B;  1CDP A;  5KSZ A;  2KGR A;  3DF0 B;  1C07 A;  1F71 A;  2LAP A;  2AUC A;  2JU0 A;  5HLV A;  1J1E A;  2ZND A;  1ALW A;  1J55 A;  4PE0 A;  1K9U A;  2OS8 C;  2HPS A;  2M97 A;  1WRL A;  5CPV A;  1L2O B;  1IQ5 A;  2D8N A;  3TS5 B;  1PVB A;  2CNP A;  2M49 B;  4P2Y B;  1TCF A;  1XK4 C;  1DJW A;  3BYA A;  2OTG B;  1QTX A;  2L2E A;  4JPZ B;  2E30 A;  1BF5 A;  1YUT A;  1SCV A;  1QAS A;  4BY5 A;  2M9G A;  2KGB C;  3OP0 A;  1WLZ A;  1XFY O;  2KYF A;  1OSA A;  1SRA A;  3SJS A;  1CFD A;  1GGZ A;  1K8U A;  4NDD A;  3E3R A;  1S6C A;  2KOT A;  3BUW B;  3I5H C;  2WND A;  1XK4 A;  2L4H A;  5I2L A;  3SG6 A;  1CLL A;  1S5G Y;  3BUN B;  3NSO A;  2L0P A;  2K61 A;  3LCP C;  3BUM B;  1CNP A;  1YVH A;  1OZO A;  5B8I B;  1FI5 A;  2MLE C;  3CR5 X;  1BOC A;  1QV1 A;  2JRF A;  4Q04 A;  1FPW A;  4FQO A;  1XO5 A;  3EKH A;  1KK7 Z;  4BY4 A;  1TNQ A;  1MXL C;  4HRH A;  5HKY A;  2CT9 A;  2G2B A;  2PAL A;  3JTD C;  1B47 A;  3LL8 B;  2MA2 A;  1K9P A;  2L4I A;  3SG7 A;  1LVC D;  1M45 A;  1A03 A;  1NX1 A;  2L5X B;  2CTN A;  2F2P A;  3ZNI A;  4M2P A;  2KI4 C;  2HQW A;  3FWC A;  1NWD A;  2JC2 A;  3GK2 A;  1F70 A;  4YRU A;  1NP8 A;  2CCM A;  1QV0 A;  3FS7 A;  4CFR A;  1IGV A;  1AP4 A;  2F33 A;  3KO0 A;  3SG2 A;  3EK7 A;  1F4O A;  1OQP A;  2GGM A;  1K96 A;  1NIW A;  1PUL A;  1QLS A;  3IQO A;  5HKZ A;  2JPT A;  4CID A;  1FBV A;  2LM5 A;  1J7O A;  3WHT B;  2ZN9 A;  3SG4 A;  4YGC B;  2OPO A;  1CFF A;  1OOJ A;  4M2O A;  1QVI Z;  3FWB A;  1QXP A;  1U5I B;  4A4B A;  2KQY A;  1RWY A;  1NSH A;  2JTT A;  2OS8 B;  1QX2 A;  1XA5 A;  4YI9 A;  3VRO A;  2F2O A;  1SL8 A;  1NCZ A;  1SL7 A;  2G9B A;  2LVK A;  3TDI A;  1S26 D;  1IJ5 A;  5GQQ C;  5F6T A;  2FCD A;  1YR5 A;  1NUB A;  3AKA A;  4C0L A;  2LHL A;  3AKB A;  3RLZ A;  1W7I B;  4OR9 B;  3O6B A;  5KU1 A;  4QJ5 B;  2KNE A;  3LK1 A;  1FW4 A;  1HT9 A;  1IWQ A;  4A4C A;  1B8C A;  1CFC A;  2WOR A;  1R2U A;  1LIN A;  4YI8 A;  2NXQ A;  1QIV A;  2M1U A;  2WCE A;  1JUO A;  5DKQ A;  5HLO A;  3I5G C;  2BCB A;  1KK8 C;  2K7D A;  1TOP A;  1SKT A;  1YX7 A;  2L50 A;  2MRD A;  1AHR A;  1B7T Y;  1UWO A;  4DCK A;  1H8B A;  1ZMZ A;  2KQ6 A;  3BQ3 A;  1MWN A;  1CDL A;  1KFU L;  1CKK A;  1GQM A;  2HET A;  4L9M A;  1EG3 A;  3OX6 A;  1EL4 A;  2CBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...