1K2HA

Three-dimensional solution structure of apo-s100a1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKDADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords S-100 protein, alpha chain
publication title Three-dimensional solution structure of the calcium-signaling protein apo-S100A1 as determined by NMR.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 24
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1k2hA00
2LP3A 2E6WA 2MA2A 3M0WA 2KYCA 3GK1A 4GFTA 1UHNA 1J1DA 1A75B 5HLOA 1Y0VH 1QV1A 1RROA 2BCBA 1DJWA 4HRHA 5GQQC 3E3RA 1K90D 1KSOA 3SG5A 1QX7A 1F71A 4E68A 3JVTC 5AANA 2M7LA 2Q4UA 1V1FA 1AJ5A 1XFUO 3I5HC 4ICBA 4OV2A 4PHMA 2LVVA 3JVTB 2LC5A 1HT9A 3PFVA 5CSFA 3EK4A 2M1UA 1ZMZA 3CWGA 2EHBA 1N2DA 4MSPA 2BBNA 3NXAA 3D10A 5TNCA 2BKIB 3BQ3A 2K2FA 1L2OC 1LINA 4ETOA 1CFDA 2L5XB 1SY9A 1GJYA 1DJGA 4A4CA 2OS8C 2FCDA 4AOMA 3BYAA 4GBAA 1QASA 4GNKB 5DKQA 2LMTA 2ZFDA 2L0PA 5HLVA 3EVVA 2H61A 1KSMA 3I5FB 4Q04A 4YI9A 1YURA 1DGVA 2LLTA 1IWQA 4PHJA 1ZACA 3TUYB 1TCOB 1SCMC 4DUQA 4DRWA 1RECA 2M9GA 2KFGA 5KSZA 1DTLA 4MLWA 1PSRA 4YGAA 3RM1A 2PVBA 2MHHA 2WOSA 1KFXL 2AAOA 2FOTA 2JT8A 1N0YA 2TN4A 4BY4A 1CFPA 2HPSA 2BE4A 1K9PA 2P6BB 1OSAA 3OHMB 3GK4X 1BLQA 1RJVA 5K89A 1YX8A 3FWCA 2LHLA 1QX5B 1CMGA 1IGVA 4N1FA 1X02A 2GGZA 1F8HA 2K7BA 5ER4X 1YUTA 1MR8A 2DOQA 1A29A 1SW8A 1QV0A 1KK8C 2SASA 2I94A 4GGFA 3CLNA 1SMGA 4TNCA 2LCPA 3CTNA 1DF0A 2LHIA 1KK8B 1F4OA 2KNEA 3SG2A 1S6JA 5BPJA 2JNFA 2PMYA 1F70A 1QXPA 1U5IA 1JF0A 3BUWB 4A4BA 5CPVA 2E30A 1GGWA 1XK4A 1NPQA 1YVHA 1H4BA 1N65A 3F45A 4HRGA 4JQ0D 1DF0B 3OB1B 5I2QA 2CBLA 3PALA 1K9KA 3DF0A 2BL0B 1OOJA 1B7TZ 2ZN9A 4L9MA 1LA0A 1QS7A 4MVFA 2EC6B 1K93D 1KFUS 1U5IB 4I5JA 1KK7Z 4PE1A 4XJKA 2CT9A 1GGZA 3LCPC 1FI5A 1KQMC 3GK2A 1ALWA 3PLFB 5DKNA 3VRQA 4DCKA 1IRJA 2MBXA 3AAKA 3LLEA 1RFJA 1CTRA 3O4YA 5I2LA 4QJ4B 3BUXB 1KQMB 2F3YA 1ZUZA 3KEVA 1Y1XA 1E8AA 2LVIA 3DF0B 4YGBB 1F54A 1R2UA 3PM8A 5DKRA 5JOLA 2NLNA 4XJKB 4I5KA 3VRRA 1CFFA 1QIVA 1YRUB 3O2PA 3VGOA 1IH0A 2R2IA 1MF8B 2G9BA 1DJYA 2D8NA 2M3WA 3CS1A 4CIDA 2BECA 1S5GZ 1WRLA 1MQ1A 1DJXA 2JC2A 2JXLA 1J55A 1SR6C 1ALVA 1PSBA 1S6IA 4ORCB 1UUSA 5B8IB 2HETA 2WORA 4GPLB 1M45A 1BODA 1NX1A 3OP0A 3CR5X 3BXKA 1SR6B 1OMDA 4AQIA 1BF5A 3HCMA 2AUCA 2WCBA 3WNXB 3EVRA 3FWBA 3LL8B 1TRFA 4FQOA 3QRXA 1B8CA 4OCIA 3GOFA 1LA3A 2KI4B 3FIAA 3A4UB 2LANA 1IG5A 1CM1A 1C7VA 2JTZA 1MXEA 1SL8A 1EG3A 1QIWA 2O60A 2SCPA 3I5GB 1AVSA 4JWQA 4N5XA 1FF1A 1CLBA 4IL1A 1UHIA 5CSIA 3PSRA 4PHNA 5AXIA 4GAOA 2ZRSA 3ZNIA 4I5NB 4U8DA 1Y1UA 1B7TY 3I5FC 1XFWO 1TOPA 4NDCA 4OVNF 1KK7Y 2PASA 1CDPA 3O78A 2M0RA 3TDZA 4C0LA 3TUYC 2LLUA 1S3PA 1VRKA 2HQWA 4YI8A 4MBEA 1KFXS 3TZ1A 2ISDA 2H61C 4JPZB 1A03A 3IQQA 1SCVA 4M2QA 3ZWHA 4N1GA 3BUNB 4HSZA 1YVLA 5IBWA 1F4QA 1TNWA 2VRGA 4QJ3B 1HQVA 5HKZA 3D0YA 3SIBA 3DVKA 2LUXA 2LP2A 1M31A 1KCYA 1RK9A 2I18A 1S5GY 1W7IB 1BR4B 3O6BA 1AP4A 3LK1A 1NUBA 2M7NA 1IJ6A 1NX2A 1OMRA 1RWYA 2GGMA 3EK8A 1G4YR 2MRDA 1WRZA 1SL9A 1GQMA 1UHJA 1MHOA 1WLZA 2K2AA 3SG4A 4MN0A 5AERA 3VRNA 1NIWA 1MXLC 2KI6C 2V53A 3BOWA 4FTGA 2LMVA 2JT3A 1CKKA 2JZIA 3WHTB 1JSAA 2KGRA 4MRXA 2WCFA 2KFHA 2F2OA 1WDCB 1YUUA 1S1EA 2F8PA 4GGFC 4ORAB 2BCAA 1C07A 1JWDA 3DVJA 4MEWA 4MZLA 3ICBA 1ODBA 1DT7B 1SL7A 4YGEB 4BY5A 1SNLA 3BOWB 4D1EA 2FCEA 1QTXA 2JQ6A 2BL0C 1PALA 3AAJA 3IF7A 2KAVA 4AQJA 2F33A 2G2BA 1B4CA 2EC6C 2BBMA 2JNXA 2HQ8A 1XVJA 2LMUA 2Q91A 3OX5A 2Y1MA 5D7FA 5F6TA 1AUIB 1XK4C 1NCXA 3KO0A 1K94A 2JULA 4OKHA 2AMIA 1B8LA 2GV5A 1L7ZA 2EGDA 3KPXA 4F0ZB 3DVEA 3CZTX 5I2OA 1S6CA 2LE9B 2NXQA 2LVKA 1BJFA 3BUOB 1S26D 4PCWA 1OZSA 1YX7A 1BOCA 1LXFC 1PRWA 4GGNA 2L50A 1EL4A 1KWOC 2WNDA 4M2PA 3K21A 2K61A 1OZOA 3SG6A 5PALA 3A8RA 2L4IA 3SIAA 1KWOB 2JOJA 1UP5A 1K96A 3OB2B 1YR5A 1F55A 2LM5A 1XFXO 1AHRA 2PSRA 1WLMA 1M63B 1NSHA 1RTP1 1UHHA 4USLA 2NCOA 1BT6A 1NP8A 1JUOA 2B1UA 1IKUA 4YBHB 3OX6A 4DS7A 2K7CA 2ZN8A 1CNPA 1W7JB 3IQOA 4HREE 1H8BA 1CDMA 4MRYA 1YUSA 2CCMA 1M39A 1BU3A 1J7PA 5CSNA 1QX2A 1TIZA 2K7DA 2KI4C 3CGAA 3SG7A 2I2RE 1EH2A 4C0KA 1TN4A 4GUKA 5AEQA 2LNKA 4PDZA 2OTGB 1JF2A 1FI6A 1PVAA 1TTXA 1EG4A 2Y5IA 1J7OA 1XA5A 2F3ZA 4QJ5B 1QJTA 2ZNEA 1OMVA 3I5GC 1IQ3A 2CTNA 4PE7A 1CMFA 2BKHB 1CB1A 2M49B 1QLSA 1B47A 1R6PA 3KHEA 4ORBB 1SKTA 2HF5A 4R1EA 1K9UA 2JRFA 2NCPA 2QACA 1UURA 1JFKA 1CM4A 2FJUB 2KAXA 1NCYA 4DIRA 2L51A 2MLEC 2O5GA 1K8UA 2M29A 1PULA 1UWOA 3EK7A 2K7OA 2L98A 1JBAA 5J3XA 4YGCB 4MZKA 2LLSA 1B9AA 2KGBC 4ZCUA 1Y6WA 1MUXA 2KI6D 2CXJA 3I5IC 2M8UA 3EKHA 2KHNA 1FBVA 1G33A 4MZJA 1OQPA 3EVUA 3I5HB 4M2OA 2F2PA 1Y1AA 1NCZA 2RGIA 3HX4A 2K8MB 3I5IB 2LVJA 1SRAA 2LUCA 1M46A 1NX0A 2KFFA 1YTZC 2I7AA 3JTDC 2ZKMX 1EJ3A 2H2KA 2KSPA 1L2OB 4WQ2A 4NDBA 3VROA 2PRUA 3TDIA 3JTDB 2OS8B 4CPVA 3SJSA 4UPGA 4PE0A 5KU1A 2ZRTA 1CFCA 1NX3A 2BE6A 2K0JA 2KBMA 4YGDB 1C7WA 2JPTA 2NZ0A 4CFQA 1SBJA 3CR2A 3D0YB 5CSJA 2KQYA 2MLFC 2L2EA 1SCMB 1SPYA 2JWWA 1WY9A 5FYXA 1XYDA 3TDUA 4P2YB 3WHUB 1XFZO 1J7QA 2WC8A 5G08A 1S36A 3BUMB 1FW4A 1WDCC 3NSLA 2MAZA 1A4PA 1QVIZ 1B1GA 1DJHA 2KOTA 2MJWB 2A4JA 4NDDA 2KAYA 1DJIA 3AKAA 3CR4X 4NQGA 2QPTA 3TS5C 1QLKA 4ZCVA 1YRTB 3VRPA 2OPOA 1CLMA 1V1GA 1IJ5A 3TS5B 4PALA 1QATA 2JXCA 3WXAA 2BCXA 3FS7A 1TNXA 1CDLA 4C0JA 1G8IA 1LKJA 1NWDA 4PE4A 2PALA 1FPWA 1LVCD 4XYNA 1K2HA 1XO5A 2KYFA 2M97A 2Y1NA 1J1EA 5AFPA 4CLNA 4WQ3A 5HKWA 2WCEA 2COLB 3C1VA 5JJGA 1IQ5A 1CLLA 2KBIA 3MSEB 1DJZA 1NYAA 1PK0D 3PATA 1MWNA 2JTTA 1DGUA 3DVMA 1D1OA 5ER5A 3AKBA 1PVBA 2CNPA 2KQ6A 1KQVA 3PN7C 1J7RA 2L4HA 3H4SE 5D69A 3SG3A 1K95A 1TNQA 2Y4QA 3LK0A 1DVIA 1JC2A 4I5LB 1AK8A 2LAPA 5I8NA 3PN7B 1OE9B 5HYDA 5HKYA 3NSKA 1EXRA 1Q80A 3NSIA 4YRUA 1XFYO 2M1KB 1XFVO 2KDHA 3RLZA 2OTGC 1ZOTB 1KFUL 3DD4A 2IS9A 1BG1A 1BMOA 3EKJA 1CDNA 1A2XA 4WRIA 1SK6D 1B8RA 1UHKA 3NSOA 1BR1B 2JU0A 4PHKA 1TNPA 2JT0A 2ZNDA 1QVIY 1AJ4A 1WRKA 2LV7A 1A75A 1ZFSA 4OR9B 4CFRA 5KTYA 1JFJA 1SYMA 4P5OE 1TCFA 1DMOA 3KF9A
chains in the Genus database with same CATH superfamily
2LP3A 2E6WA 4INWA 2MA2A 3DY9A 3M0WA 2KYCA 3GK1A 4GFTA 1UHNA 1J1DA 1A75B 3CZ2A 3B6XA 5HLOA 1Y0VH 1QV1A 1RROA 2BCBA 1DJWA 4HRHA 5GQQC 3E3RA 3SS4A 1K90D 1KSOA 3SG5A 1QX7A 1F71A 4E68A 3JVTC 1T14A 5AANA 2M7LA 2Q4UA 1V1FA 1AJ5A 1XFUO 3I5HC 4ICBA 4OV2A 4PHMA 2LVVA 3JVTB 2LC5A 1HT9A 3FE9A 3PFVA 3EK4A 2M1UA 5CSFA 1ZMZA 3CWGA 2EHBA 1N2DA 4MSPA 2BBNA 3NXAA 3D10A 5TNCA 4PT1A 3NHTA 2BKIB 3BQ3A 2K2FA 5FI2A 1L2OC 1LINA 4JKTA 4ETOA 1CFDA 2L5XB 1SY9A 1GJYA 1DJGA 3QMEA 4A4CA 2OS8C 2FCDA 4AOMA 3BYAA 4GBAA 1QASA 4GNKB 5DKQA 2LMTA 2ZFDA 2L0PA 5HLVA 3EVVA 1OOIX 2H61A 1KSMA 3I5FB 1P28A 2WCLA 1YURA 1DGVA 4Q04A 4YI9A 2LLTA 3UNWA 1IWQA 4PHJA 1ZACA 3TUYB 1TCOB 1SCMC 4DUQA 4DRWA 1RECA 2M9GA 2KFGA 5KSZA 1DTLA 3B87A 4MLWA 1PSRA 4YGAA 3RM1A 2PVBA 2MHHA 2WOSA 1KFXL 2AAOA 2FOTA 2JT8A 1N0YA 2TN4A 4BY4A 1CFPA 2HPSA 2BE4A 1K9PA 2P6BB 1GM0A 1OSAA 2YGUA 3L47A 5FI7A 3Q8IA 3OHMB 3GK4X 1BLQA 1RJVA 5K89A 3BJHA 1YX8A 3S0BA 3FWCA 3S0GA 2LHLA 1QX5B 1CMGA 1IGVA 4N1FA 1X02A 2GGZA 1F8HA 2K7BA 5ER4X 1YUTA 1MR8A 2QEBA 2DOQA 1A29A 1SW8A 1QV0A 1KK8C 2SASA 2I94A 4GGFA 3CLNA 1SMGA 4TNCA 2LCPA 3CTNA 1DF0A 2LHIA 1KK8B 1F4OA 2KNEA 3SG2A 4KYNA 1S6JA 5BPJA 2JNFA 2PMYA 1F70A 1QXPA 1LS8A 1U5IA 1JF0A 3BUWB 4A4BA 5CPVA 3V2LA 2E30A 1GGWA 1XK4A 1NPQA 1YVHA 1H4BA 1N65A 3F45A 4HRGA 4JQ0D 1DF0B 3OB1B 5I2QA 2CBLA 3PALA 3SS3A 1K9KA 3DF0A 1OOJA 2BL0B 1B7TZ 2ZN9A 4L9MA 1LA0A 1QS7A 4MVFA 2EC6B 1K93D 1KFUS 1OOGA 1U5IB 1KK7Z 4I5JA 4PE1A 2CT9A 4XJKA 1GGZA 3LCPC 1FI5A 1KQMC 3GK2A 1IIOA 1ALWA 3PLFB 5DKNA 3VRQA 4DCKA 1IRJA 2MBXA 3AAKA 3LLEA 1RFJA 1CTRA 3O4YA 5I2LA 4QJ4B 3BUXB 1KQMB 2F3YA 1ZUZA 2PQLA 3KEVA 1Y1XA 1E8AA 2LVIA 3DF0B 4YGBB 1F54A 1R2UA 3PM8A 5DKRA 5JOLA 2NLNA 3OGNA 4I5KA 4XJKB 3VRRA 1QIVA 1YRUB 1CFFA 3O2PA 3DXLA 3VGOA 1IH0A 3FE6A 2R2IA 1MF8B 2G9BA 1DJYA 2D8NA 1DEKA 2M3WA 3CS1A 3IVTA 4CIDA 2BECA 1S5GZ 1WRLA 1MQ1A 2P70A 1DJXA 2JC2A 2JXLA 1J55A 1SR6C 1ALVA 1PSBA 1S6IA 4ORCB 1UUSA 5B8IB 2HETA 2WORA 4GPLB 1M45A 1BODA 1NX1A 3OP0A 1OOFA 3CR5X 3S0FA 3BXKA 1SR6B 1OMDA 2QEHA 4AQIA 1BF5A 3HCMA 2AUCA 1W9ZA 2WCBA 3WNXB 2FJYA 3EG5B 3EVRA 3FWBA 3LL8B 1TRFA 4FQOA 3QRXA 1B8CA 4OCIA 3GOFA 1LA3A 2KI4B 3FIAA 3A4UB 2LANA 1IG5A 1CM1A 1C7VA 2JTZA 1MXEA 1SL8A 3S0EA 3D73A 3D77A 1EG3A 1QIWA 2H8VA 2O60A 2SCPA 3I5GB 1AVSA 4JWQA 4OZDA 4N5XA 1FF1A 1CLBA 4IL1A 3B86A 1UHIA 5CSIA 3PSRA 4PHNA 5AXIA 4GAOA 2ZRSA 3ZNIA 4I5NB 4U8DA 1Y1UA 1B7TY 3I5FC 1XFWO 3L4AA 1TOPA 4NDCA 3B7AA 4OVNF 1KK7Y 2PASA 1CDPA 3O78A 2M0RA 3TDZA 4C0LA 3TUYC 2LLUA 1S3PA 1VRKA 2HQWA 4YI8A 4MBEA 1KFXS 3L4LA 3TZ1A 2ISDA 2H61C 4JPZB 1A03A 3IQQA 4FQTA 1SCVA 4M2QA 3ZWHA 4N1GA 3BUNB 4HSZA 1YVLA 5IBWA 1F4QA 1TNWA 1TWOA 2VRGA 4QJ3B 2PYQA 1HQVA 5HKZA 3D0YA 3SIBA 3DVKA 2LUXA 2LP2A 1M31A 3D78A 1RK9A 3CABA 2I18A 1KCYA 1TUZA 1S5GY 1W7IB 5HL1A 1BR4B 3O6BA 1AP4A 3LK1A 1NUBA 2M7NA 1IJ6A 1NX2A 1OMRA 1RWYA 2GGMA 3EK8A 1G4YR 2MRDA 1WRZA 1SL9A 1GQMA 1UHJA 1MHOA 1WLZA 2K2AA 3SG4A 4MN0A 2QEOA 5AERA 3VRNA 1NIWA 1MXLC 2KI6C 2V53A 3BOWA 3R72A 4FTGA 2LMVA 2JT3A 1CKKA 2JZIA 3WHTB 1JSAA 2KGRA 4MRXA 2WCFA 2KFHA 3CYZA 2F2OA 1WDCB 2K60A 1YUUA 1S1EA 2F8PA 4GGFC 4ORAB 3NHIA 2BCAA 1C07A 1JWDA 3DVJA 4MEWA 4MZLA 3ICBA 1ODBA 1DT7B 1SL7A 4YGEB 4BY5A 1SNLA 3BOWB 4D1EA 2FCEA 1QTXA 2JQ6A 2BL0C 1PALA 3AAJA 3B88A 2KAVA 3IF7A 2F33A 2G2BA 4AQJA 1B4CA 3N7HA 2EC6C 2BBMA 2JNXA 2HQ8A 1XVJA 2LMUA 2Q91A 3OX5A 2Y1MA 5D7FA 5F6TA 1AUIB 1XK4C 1NCXA 3KO0A 1K94A 2JULA 3R1OA 2L5YA 1Z4HA 4OKHA 2AMIA 1B8LA 2GV5A 1L7ZA 2EGDA 3KPXA 4F0ZB 2WCHA 3DVEA 3CZTX 5I2OA 1S6CA 2LE9B 2NXQA 2LVKA 1BJFA 3BUOB 1S26D 4PCWA 1OZSA 1YX7A 3CZ1A 1BOCA 1LXFC 1PRWA 3UO9A 4GGNA 2L50A 1EL4A 1KWOC 2WNDA 2WC5A 4M2PA 3K21A 2K61A 1OZOA 3R1VA 5PALA 2WCKA 3SG6A 3A8RA 2L4IA 2KLDA 3SIAA 1KWOB 2JOJA 4IJ7A 1UP5A 1K96A 3OB2B 1YR5A 1F55A 2LM5A 1XFXO 1AHRA 2PSRA 1SSEB 1XFRA 1WLMA 1M63B 1NSHA 1RTP1 1UHHA 4USLA 2NCOA 3S0DA 1BT6A 1NP8A 5D3OA 1JUOA 2B1UA 1IKUA 4YBHB 3OX6A 4DS7A 2K7CA 2ZN8A 1CNPA 1W7JB 3IQOA 4HREE 1H8BA 1CDMA 4MRYA 1YUSA 2CCMA 1M39A 1BU3A 1J7PA 5CSNA 1QX2A 1TIZA 2K7DA 2KI4C 3CGAA 5EL2A 2I2RE 3SG7A 1EH2A 4C0KA 1TN4A 2GTEA 4GUKA 2LNKA 4PDZA 2OTGB 5AEQA 1JF2A 1FI6A 1PVAA 1TTXA 1EG4A 2Y5IA 1J7OA 1XA5A 2F3ZA 4QJ5B 1QJTA 2ZNEA 1OMVA 3I5GC 1IQ3A 2CTNA 4PE7A 1CMFA 2BKHB 1CB1A 2M49B 1QLSA 2JPOA 1B47A 1R6PA 3KHEA 4ORBB 1SKTA 2HF5A 4R1EA 1K9UA 2JRFA 2NCPA 2QACA 1UURA 1JFKA 1CM4A 2FJUB 2KAXA 1NCYA 4DIRA 2L51A 3NGVA 2MLEC 2O5GA 1K8UA 1TUJA 1PULA 1UWOA 2M29A 3EK7A 2K7OA 4F7FA 2L98A 1JBAA 5J3XA 4YGCB 2KPHA 4MZKA 2LLSA 1B9AA 2KGBC 4ZCUA 1Y6WA 1MUXA 1C3ZA 2KI6D 2CXJA 3I5IC 2M8UA 3EKHA 2KHNA 1DQEA 1FBVA 1G33A 1OQPA 3EVUA 3I5HB 4M2OA 2F2PA 4MZJA 1Y1AA 1NCZA 2RGIA 3HX4A 2K8MB 3I5IB 2LVJA 1SRAA 3BFHA 2LUCA 1M46A 1OOHA 1NX0A 2KFFA 1YTZC 2I7AA 3JTDC 2ZKMX 3BFBA 1EJ3A 2H2KA 2KLEA 2KSPA 1L2OB 3RZSA 4WQ2A 4NDBA 2WC6A 3VROA 2PRUA 3TDIA 3JTDB 2OS8B 4CPVA 3SJSA 2BAPA 3D75A 3PM2A 4UPGA 4PE0A 5KU1A 2BNXA 2ZRTA 1CFCA 3CZ0A 1NX3A 2BE6A 2K0JA 2KBMA 4YGDB 1C7WA 2JPTA 2NZ0A 4CFQA 1SBJA 3CR2A 3D0YB 5CSJA 2KQYA 2MLFC 2L2EA 1SCMB 1SPYA 2QDIA 2JWWA 1WY9A 5FYXA 1XYDA 3K1EA 4P2YB 3TDUA 1XFZO 3WHUB 5I94A 1J7QA 2WC8A 5G08A 4INXA 1S36A 3BUMB 1FW4A 3DYEA 1WDCC 3NSLA 2MAZA 1DELA 1A4PA 4JD9A 1QVIZ 1B1GA 1DC1A 1DJHA 2KOTA 2MJWB 2A4JA 4NDDA 2KAYA 1DJIA 3AKAA 3CR4X 4NQGA 2QPTA 3TS5C 1QLKA 4ZCVA 2P71A 1YRTB 3VRPA 2OPOA 3DZTA 1CLMA 1V1GA 1IJ5A 3TS5B 4PALA 1QATA 2JXCA 5DICA 3WXAA 2BCXA 3FS7A 1TNXA 1CDLA 4C0JA 1G8IA 1LKJA 1NWDA 2QEVA 3S0AA 3O4XA 3FE8A 4PE4A 2PALA 1FPWA 1LVCD 4XYNA 1K2HA 1XO5A 2KYFA 2M97A 2Y1NA 1J1EA 5AFPA 4CLNA 1OW4A 3CDNA 3VB1A 4WQ3A 5HKWA 2WCEA 2COLB 3C1VA 5JJGA 1IQ5A 1CLLA 2KBIA 1Z2CB 3MSEB 1DJZA 1NYAA 1PK0D 3PATA 3PJIA 1MWNA 2JTTA 1DGUA 3DVMA 1D1OA 5ER5A 3AKBA 1PVBA 2CNPA 1ORGA 2KQ6A 1KQVA 3PN7C 1J7RA 2L4HA 3H4SE 5D69A 3SG3A 1K95A 1TNQA 2Y4QA 3LK0A 1DVIA 1JC2A 4I5LB 1AK8A 2LAPA 5I8NA 3PN7B 1OE9B 5HYDA 2WCJA 5HKYA 3NSKA 1EXRA 1Q80A 3NSIA 1QWVA 4YRUA 1XFYO 2M1KB 1XFVO 1C3YA 2KDHA 3RLZA 2WCMA 2OTGC 1ZOTB 1KFUL 3DD4A 2IS9A 1BG1A 1BMOA 2L2CA 3EKJA 1CDNA 1A2XA 4WRIA 1SK6D 3R1PA 1B8RA 1UHKA 3NSOA 1BR1B 2JU0A 4PHKA 3OBVA 1TNPA 3SS5A 2JT0A 2ZNDA 1QVIY 3D74A 1AJ4A 1WRKA 2LV7A 1ZFSA 1A75A 4OR9B 3D76A 5FI6A 4CFRA 5KTYA 1JFJA 1SYMA 4P5OE 1TCFA 1DMOA 3KF9A 3BFAA 2ERBA
chains in the Genus database with same CATH topology
2LP3A 2E6WA 2MA2A 3M0WA 2KYCA 3GK1A 4GFTA 1UHNA 1J1DA 1A75B 5HLOA 1Y0VH 1QV1A 1RROA 2BCBA 1DJWA 4HRHA 5GQQC 3E3RA 1K90D 1KSOA 3SG5A 1QX7A 1F71A 4E68A 3JVTC 5AANA 2M7LA 2Q4UA 1V1FA 1AJ5A 1XFUO 3I5HC 4ICBA 4OV2A 4PHMA 2LVVA 3JVTB 2LC5A 1HT9A 3PFVA 5CSFA 3EK4A 2M1UA 1ZMZA 3CWGA 2EHBA 1N2DA 4MSPA 2BBNA 3NXAA 3D10A 5TNCA 2BKIB 3BQ3A 2K2FA 1L2OC 1LINA 4ETOA 1CFDA 2L5XB 1SY9A 1GJYA 1DJGA 4A4CA 2OS8C 2FCDA 4AOMA 3BYAA 4GBAA 1QASA 4GNKB 5DKQA 2LMTA 2ZFDA 2L0PA 5HLVA 3EVVA 2H61A 1KSMA 3I5FB 4Q04A 4YI9A 1YURA 1DGVA 2LLTA 1IWQA 4PHJA 1ZACA 3TUYB 1TCOB 1SCMC 4DUQA 4DRWA 1RECA 2M9GA 2KFGA 5KSZA 1DTLA 4MLWA 1PSRA 4YGAA 3RM1A 2PVBA 2MHHA 2WOSA 1KFXL 2AAOA 2FOTA 2JT8A 1N0YA 2TN4A 4BY4A 1CFPA 2HPSA 2BE4A 1K9PA 2P6BB 1OSAA 3OHMB 3GK4X 1BLQA 1RJVA 5K89A 1YX8A 3FWCA 2LHLA 1QX5B 1CMGA 1IGVA 4N1FA 1X02A 2GGZA 1F8HA 2K7BA 5ER4X 1YUTA 1MR8A 2DOQA 1A29A 1SW8A 1QV0A 1KK8C 2SASA 2I94A 4GGFA 3CLNA 1SMGA 4TNCA 2LCPA 3CTNA 1DF0A 2LHIA 1KK8B 1F4OA 2KNEA 3SG2A 1S6JA 5BPJA 2JNFA 2PMYA 1F70A 1QXPA 1U5IA 1JF0A 3BUWB 4A4BA 5CPVA 2E30A 1GGWA 1XK4A 1NPQA 1YVHA 1H4BA 1N65A 3F45A 4HRGA 4JQ0D 1DF0B 3OB1B 5I2QA 2CBLA 3PALA 1K9KA 3DF0A 2BL0B 1OOJA 1B7TZ 2ZN9A 4L9MA 1LA0A 1QS7A 4MVFA 2EC6B 1K93D 1KFUS 1U5IB 4I5JA 1KK7Z 4PE1A 4XJKA 2CT9A 1GGZA 3LCPC 1FI5A 1KQMC 3GK2A 1ALWA 3PLFB 5DKNA 3VRQA 4DCKA 1IRJA 2MBXA 3AAKA 3LLEA 1RFJA 1CTRA 3O4YA 5I2LA 4QJ4B 3BUXB 1KQMB 2F3YA 1ZUZA 3KEVA 1Y1XA 1E8AA 2LVIA 3DF0B 4YGBB 1F54A 1R2UA 3PM8A 5DKRA 5JOLA 2NLNA 4XJKB 4I5KA 3VRRA 1CFFA 1QIVA 1YRUB 3O2PA 3VGOA 1IH0A 2R2IA 1MF8B 2G9BA 1DJYA 2D8NA 2M3WA 3CS1A 4CIDA 2BECA 1S5GZ 1WRLA 1MQ1A 1DJXA 2JC2A 2JXLA 1J55A 1SR6C 1ALVA 1PSBA 1S6IA 4ORCB 1UUSA 5B8IB 2HETA 2WORA 4GPLB 1M45A 1BODA 1NX1A 3OP0A 3CR5X 3BXKA 1SR6B 1OMDA 4AQIA 1BF5A 3HCMA 2AUCA 2WCBA 3WNXB 3EVRA 3FWBA 3LL8B 1TRFA 4FQOA 3QRXA 1B8CA 4OCIA 3GOFA 1LA3A 2KI4B 3FIAA 3A4UB 2LANA 1IG5A 1CM1A 1C7VA 2JTZA 1MXEA 1SL8A 1EG3A 1QIWA 2O60A 2SCPA 3I5GB 1AVSA 4JWQA 4N5XA 1FF1A 1CLBA 4IL1A 1UHIA 5CSIA 3PSRA 4PHNA 5AXIA 4GAOA 2ZRSA 3ZNIA 4I5NB 4U8DA 1Y1UA 1B7TY 3I5FC 1XFWO 1TOPA 4NDCA 4OVNF 1KK7Y 2PASA 1CDPA 3O78A 2M0RA 3TDZA 4C0LA 3TUYC 2LLUA 1S3PA 1VRKA 2HQWA 4YI8A 4MBEA 1KFXS 3TZ1A 2ISDA 2H61C 4JPZB 1A03A 3IQQA 1SCVA 4M2QA 3ZWHA 4N1GA 3BUNB 4HSZA 1YVLA 5IBWA 1F4QA 1TNWA 2VRGA 4QJ3B 1HQVA 5HKZA 3D0YA 3SIBA 3DVKA 2LUXA 2LP2A 1M31A 1KCYA 1RK9A 2I18A 1S5GY 1W7IB 1BR4B 3O6BA 1AP4A 3LK1A 1NUBA 2M7NA 1IJ6A 1NX2A 1OMRA 1RWYA 2GGMA 3EK8A 1G4YR 2MRDA 1WRZA 1SL9A 1GQMA 1UHJA 1MHOA 1WLZA 2K2AA 3SG4A 4MN0A 5AERA 3VRNA 1NIWA 1MXLC 2KI6C 2V53A 3BOWA 4FTGA 2LMVA 2JT3A 1CKKA 2JZIA 3WHTB 1JSAA 2KGRA 4MRXA 2WCFA 2KFHA 2F2OA 1WDCB 1YUUA 1S1EA 2F8PA 4GGFC 4ORAB 2BCAA 1C07A 1JWDA 3DVJA 4MEWA 4MZLA 3ICBA 1ODBA 1DT7B 1SL7A 4YGEB 4BY5A 1SNLA 3BOWB 4D1EA 2FCEA 1QTXA 2JQ6A 2BL0C 1PALA 3AAJA 3IF7A 2KAVA 4AQJA 2F33A 2G2BA 1B4CA 2EC6C 2BBMA 2JNXA 2HQ8A 1XVJA 2LMUA 2Q91A 3OX5A 2Y1MA 5D7FA 5F6TA 1AUIB 1XK4C 1NCXA 3KO0A 1K94A 2JULA 4OKHA 2AMIA 1B8LA 2GV5A 1L7ZA 2EGDA 3KPXA 4F0ZB 3DVEA 3CZTX 5I2OA 1S6CA 2LE9B 2NXQA 2LVKA 1BJFA 3BUOB 1S26D 4PCWA 1OZSA 1YX7A 1BOCA 1LXFC 1PRWA 4GGNA 2L50A 1EL4A 1KWOC 2WNDA 4M2PA 3K21A 2K61A 1OZOA 3SG6A 5PALA 3A8RA 2L4IA 3SIAA 1KWOB 2JOJA 1UP5A 1K96A 3OB2B 1YR5A 1F55A 2LM5A 1XFXO 1AHRA 2PSRA 1WLMA 1M63B 1NSHA 1RTP1 1UHHA 4USLA 2NCOA 1BT6A 1NP8A 1JUOA 2B1UA 1IKUA 4YBHB 3OX6A 4DS7A 2K7CA 2ZN8A 1CNPA 1W7JB 3IQOA 4HREE 1H8BA 1CDMA 4MRYA 1YUSA 2CCMA 1M39A 1BU3A 1J7PA 5CSNA 1QX2A 1TIZA 2K7DA 2KI4C 3CGAA 3SG7A 2I2RE 1EH2A 4C0KA 1TN4A 4GUKA 5AEQA 2LNKA 4PDZA 2OTGB 1JF2A 1FI6A 1PVAA 1TTXA 1EG4A 2Y5IA 1J7OA 1XA5A 2F3ZA 4QJ5B 1QJTA 2ZNEA 1OMVA 3I5GC 1IQ3A 2CTNA 4PE7A 1CMFA 2BKHB 1CB1A 2M49B 1QLSA 1B47A 1R6PA 3KHEA 4ORBB 1SKTA 2HF5A 4R1EA 1K9UA 2JRFA 2NCPA 2QACA 1UURA 1JFKA 1CM4A 2FJUB 2KAXA 1NCYA 4DIRA 2L51A 2MLEC 2O5GA 1K8UA 2M29A 1PULA 1UWOA 3EK7A 2K7OA 2L98A 1JBAA 5J3XA 4YGCB 4MZKA 2LLSA 1B9AA 2KGBC 4ZCUA 1Y6WA 1MUXA 2KI6D 2CXJA 3I5IC 2M8UA 3EKHA 2KHNA 1FBVA 1G33A 4MZJA 1OQPA 3EVUA 3I5HB 4M2OA 2F2PA 1Y1AA 1NCZA 2RGIA 3HX4A 2K8MB 3I5IB 2LVJA 1SRAA 2LUCA 1M46A 1NX0A 2KFFA 1YTZC 2I7AA 3JTDC 2ZKMX 1EJ3A 2H2KA 2KSPA 1L2OB 4WQ2A 4NDBA 3VROA 2PRUA 3TDIA 3JTDB 2OS8B 4CPVA 3SJSA 4UPGA 4PE0A 5KU1A 2ZRTA 1CFCA 1NX3A 2BE6A 2K0JA 2KBMA 4YGDB 1C7WA 2JPTA 2NZ0A 4CFQA 1SBJA 3CR2A 3D0YB 5CSJA 2KQYA 2MLFC 2L2EA 1SCMB 1SPYA 2JWWA 1WY9A 5FYXA 1XYDA 3TDUA 4P2YB 3WHUB 1XFZO 1J7QA 2WC8A 5G08A 1S36A 3BUMB 1FW4A 1WDCC 3NSLA 2MAZA 1A4PA 1QVIZ 1B1GA 1DJHA 2KOTA 2MJWB 2A4JA 4NDDA 2KAYA 1DJIA 3AKAA 3CR4X 4NQGA 2QPTA 3TS5C 1QLKA 4ZCVA 1YRTB 3VRPA 2OPOA 1CLMA 1V1GA 1IJ5A 3TS5B 4PALA 1QATA 2JXCA 3WXAA 2BCXA 3FS7A 1TNXA 1CDLA 4C0JA 1G8IA 1LKJA 1NWDA 4PE4A 2PALA 1FPWA 1LVCD 4XYNA 1K2HA 1XO5A 2KYFA 2M97A 2Y1NA 1J1EA 5AFPA 4CLNA 4WQ3A 5HKWA 2WCEA 2COLB 3C1VA 5JJGA 1IQ5A 1CLLA 2KBIA 3MSEB 1DJZA 1NYAA 1PK0D 3PATA 1MWNA 2JTTA 1DGUA 3DVMA 1D1OA 5ER5A 3AKBA 1PVBA 2CNPA 2KQ6A 1KQVA 3PN7C 1J7RA 2L4HA 3H4SE 5D69A 3SG3A 1K95A 1TNQA 2Y4QA 3LK0A 1DVIA 1JC2A 4I5LB 1AK8A 2LAPA 5I8NA 3PN7B 1OE9B 5HYDA 5HKYA 3NSKA 1EXRA 1Q80A 3NSIA 4YRUA 1XFYO 2M1KB 1XFVO 2KDHA 3RLZA 2OTGC 1ZOTB 1KFUL 3DD4A 2IS9A 1BG1A 1BMOA 3EKJA 1CDNA 1A2XA 4WRIA 1SK6D 1B8RA 1UHKA 3NSOA 1BR1B 2JU0A 4PHKA 1TNPA 2JT0A 2ZNDA 1QVIY 1AJ4A 1WRKA 2LV7A 1A75A 1ZFSA 4OR9B 4CFRA 5KTYA 1JFJA 1SYMA 4P5OE 1TCFA 1DMOA 3KF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP3 A;  2E6W A;  2MA2 A;  3M0W A;  2KYC A;  3GK1 A;  4GFT A;  1UHN A;  1J1D A;  1A75 B;  5HLO A;  1Y0V H;  1QV1 A;  1RRO A;  2BCB A;  1DJW A;  4HRH A;  5GQQ C;  3E3R A;  1K90 D;  1KSO A;  3SG5 A;  1QX7 A;  1F71 A;  4E68 A;  3JVT C;  5AAN A;  2M7L A;  2Q4U A;  1V1F A;  1AJ5 A;  1XFU O;  3I5H C;  4ICB A;  4OV2 A;  4PHM A;  2LVV A;  3JVT B;  2LC5 A;  1HT9 A;  3PFV A;  5CSF A;  3EK4 A;  2M1U A;  1ZMZ A;  3CWG A;  2EHB A;  1N2D A;  4MSP A;  2BBN A;  3NXA A;  3D10 A;  5TNC A;  2BKI B;  3BQ3 A;  2K2F A;  1L2O C;  1LIN A;  4ETO A;  1CFD A;  2L5X B;  1SY9 A;  1GJY A;  1DJG A;  4A4C A;  2OS8 C;  2FCD A;  4AOM A;  3BYA A;  4GBA A;  1QAS A;  4GNK B;  5DKQ A;  2LMT A;  2ZFD A;  2L0P A;  5HLV A;  3EVV A;  2H61 A;  1KSM A;  3I5F B;  4Q04 A;  4YI9 A;  1YUR A;  1DGV A;  2LLT A;  1IWQ A;  4PHJ A;  1ZAC A;  3TUY B;  1TCO B;  1SCM C;  4DUQ A;  4DRW A;  1REC A;  2M9G A;  2KFG A;  5KSZ A;  1DTL A;  4MLW A;  1PSR A;  4YGA A;  3RM1 A;  2PVB A;  2MHH A;  2WOS A;  1KFX L;  2AAO A;  2FOT A;  2JT8 A;  1N0Y A;  2TN4 A;  4BY4 A;  1CFP A;  2HPS A;  2BE4 A;  1K9P A;  2P6B B;  1OSA A;  3OHM B;  3GK4 X;  1BLQ A;  1RJV A;  5K89 A;  1YX8 A;  3FWC A;  2LHL A;  1QX5 B;  1CMG A;  1IGV A;  4N1F A;  1X02 A;  2GGZ A;  1F8H A;  2K7B A;  5ER4 X;  1YUT A;  1MR8 A;  2DOQ A;  1A29 A;  1SW8 A;  1QV0 A;  1KK8 C;  2SAS A;  2I94 A;  4GGF A;  3CLN A;  1SMG A;  4TNC A;  2LCP A;  3CTN A;  1DF0 A;  2LHI A;  1KK8 B;  1F4O A;  2KNE A;  3SG2 A;  1S6J A;  5BPJ A;  2JNF A;  2PMY A;  1F70 A;  1QXP A;  1U5I A;  1JF0 A;  3BUW B;  4A4B A;  5CPV A;  2E30 A;  1GGW A;  1XK4 A;  1NPQ A;  1YVH A;  1H4B A;  1N65 A;  3F45 A;  4HRG A;  4JQ0 D;  1DF0 B;  3OB1 B;  5I2Q A;  2CBL A;  3PAL A;  1K9K A;  3DF0 A;  2BL0 B;  1OOJ A;  1B7T Z;  2ZN9 A;  4L9M A;  1LA0 A;  1QS7 A;  4MVF A;  2EC6 B;  1K93 D;  1KFU S;  1U5I B;  4I5J A;  1KK7 Z;  4PE1 A;  4XJK A;  2CT9 A;  1GGZ A;  3LCP C;  1FI5 A;  1KQM C;  3GK2 A;  1ALW A;  3PLF B;  5DKN A;  3VRQ A;  4DCK A;  1IRJ A;  2MBX A;  3AAK A;  3LLE A;  1RFJ A;  1CTR A;  3O4Y A;  5I2L A;  4QJ4 B;  3BUX B;  1KQM B;  2F3Y A;  1ZUZ A;  3KEV A;  1Y1X A;  1E8A A;  2LVI A;  3DF0 B;  4YGB B;  1F54 A;  1R2U A;  3PM8 A;  5DKR A;  5JOL A;  2NLN A;  4XJK B;  4I5K A;  3VRR A;  1CFF A;  1QIV A;  1YRU B;  3O2P A;  3VGO A;  1IH0 A;  2R2I A;  1MF8 B;  2G9B A;  1DJY A;  2D8N A;  2M3W A;  3CS1 A;  4CID A;  2BEC A;  1S5G Z;  1WRL A;  1MQ1 A;  1DJX A;  2JC2 A;  2JXL A;  1J55 A;  1SR6 C;  1ALV A;  1PSB A;  1S6I A;  4ORC B;  1UUS A;  5B8I B;  2HET A;  2WOR A;  4GPL B;  1M45 A;  1BOD A;  1NX1 A;  3OP0 A;  3CR5 X;  3BXK A;  1SR6 B;  1OMD A;  4AQI A;  1BF5 A;  3HCM A;  2AUC A;  2WCB A;  3WNX B;  3EVR A;  3FWB A;  3LL8 B;  1TRF A;  4FQO A;  3QRX A;  1B8C A;  4OCI A;  3GOF A;  1LA3 A;  2KI4 B;  3FIA A;  3A4U B;  2LAN A;  1IG5 A;  1CM1 A;  1C7V A;  2JTZ A;  1MXE A;  1SL8 A;  1EG3 A;  1QIW A;  2O60 A;  2SCP A;  3I5G B;  1AVS A;  4JWQ A;  4N5X A;  1FF1 A;  1CLB A;  4IL1 A;  1UHI A;  5CSI A;  3PSR A;  4PHN A;  5AXI A;  4GAO A;  2ZRS A;  3ZNI A;  4I5N B;  4U8D A;  1Y1U A;  1B7T Y;  3I5F C;  1XFW O;  1TOP A;  4NDC A;  4OVN F;  1KK7 Y;  2PAS A;  1CDP A;  3O78 A;  2M0R A;  3TDZ A;  4C0L A;  3TUY C;  2LLU A;  1S3P A;  1VRK A;  2HQW A;  4YI8 A;  4MBE A;  1KFX S;  3TZ1 A;  2ISD A;  2H61 C;  4JPZ B;  1A03 A;  3IQQ A;  1SCV A;  4M2Q A;  3ZWH A;  4N1G A;  3BUN B;  4HSZ A;  1YVL A;  5IBW A;  1F4Q A;  1TNW A;  2VRG A;  4QJ3 B;  1HQV A;  5HKZ A;  3D0Y A;  3SIB A;  3DVK A;  2LUX A;  2LP2 A;  1M31 A;  1KCY A;  1RK9 A;  2I18 A;  1S5G Y;  1W7I B;  1BR4 B;  3O6B A;  1AP4 A;  3LK1 A;  1NUB A;  2M7N A;  1IJ6 A;  1NX2 A;  1OMR A;  1RWY A;  2GGM A;  3EK8 A;  1G4Y R;  2MRD A;  1WRZ A;  1SL9 A;  1GQM A;  1UHJ A;  1MHO A;  1WLZ A;  2K2A A;  3SG4 A;  4MN0 A;  5AER A;  3VRN A;  1NIW A;  1MXL C;  2KI6 C;  2V53 A;  3BOW A;  4FTG A;  2LMV A;  2JT3 A;  1CKK A;  2JZI A;  3WHT B;  1JSA A;  2KGR A;  4MRX A;  2WCF A;  2KFH A;  2F2O A;  1WDC B;  1YUU A;  1S1E A;  2F8P A;  4GGF C;  4ORA B;  2BCA A;  1C07 A;  1JWD A;  3DVJ A;  4MEW A;  4MZL A;  3ICB A;  1ODB A;  1DT7 B;  1SL7 A;  4YGE B;  4BY5 A;  1SNL A;  3BOW B;  4D1E A;  2FCE A;  1QTX A;  2JQ6 A;  2BL0 C;  1PAL A;  3AAJ A;  3IF7 A;  2KAV A;  4AQJ A;  2F33 A;  2G2B A;  1B4C A;  2EC6 C;  2BBM A;  2JNX A;  2HQ8 A;  1XVJ A;  2LMU A;  2Q91 A;  3OX5 A;  2Y1M A;  5D7F A;  5F6T A;  1AUI B;  1XK4 C;  1NCX A;  3KO0 A;  1K94 A;  2JUL A;  4OKH A;  2AMI A;  1B8L A;  2GV5 A;  1L7Z A;  2EGD A;  3KPX A;  4F0Z B;  3DVE A;  3CZT X;  5I2O A;  1S6C A;  2LE9 B;  2NXQ A;  2LVK A;  1BJF A;  3BUO B;  1S26 D;  4PCW A;  1OZS A;  1YX7 A;  1BOC A;  1LXF C;  1PRW A;  4GGN A;  2L50 A;  1EL4 A;  1KWO C;  2WND A;  4M2P A;  3K21 A;  2K61 A;  1OZO A;  3SG6 A;  5PAL A;  3A8R A;  2L4I A;  3SIA A;  1KWO B;  2JOJ A;  1UP5 A;  1K96 A;  3OB2 B;  1YR5 A;  1F55 A;  2LM5 A;  1XFX O;  1AHR A;  2PSR A;  1WLM A;  1M63 B;  1NSH A;  1RTP 1;  1UHH A;  4USL A;  2NCO A;  1BT6 A;  1NP8 A;  1JUO A;  2B1U A;  1IKU A;  4YBH B;  3OX6 A;  4DS7 A;  2K7C A;  2ZN8 A;  1CNP A;  1W7J B;  3IQO A;  4HRE E;  1H8B A;  1CDM A;  4MRY A;  1YUS A;  2CCM A;  1M39 A;  1BU3 A;  1J7P A;  5CSN A;  1QX2 A;  1TIZ A;  2K7D A;  2KI4 C;  3CGA A;  3SG7 A;  2I2R E;  1EH2 A;  4C0K A;  1TN4 A;  4GUK A;  5AEQ A;  2LNK A;  4PDZ A;  2OTG B;  1JF2 A;  1FI6 A;  1PVA A;  1TTX A;  1EG4 A;  2Y5I A;  1J7O A;  1XA5 A;  2F3Z A;  4QJ5 B;  1QJT A;  2ZNE A;  1OMV A;  3I5G C;  1IQ3 A;  2CTN A;  4PE7 A;  1CMF A;  2BKH B;  1CB1 A;  2M49 B;  1QLS A;  1B47 A;  1R6P A;  3KHE A;  4ORB B;  1SKT A;  2HF5 A;  4R1E A;  1K9U A;  2JRF A;  2NCP A;  2QAC A;  1UUR A;  1JFK A;  1CM4 A;  2FJU B;  2KAX A;  1NCY A;  4DIR A;  2L51 A;  2MLE C;  2O5G A;  1K8U A;  2M29 A;  1PUL A;  1UWO A;  3EK7 A;  2K7O A;  2L98 A;  1JBA A;  5J3X A;  4YGC B;  4MZK A;  2LLS A;  1B9A A;  2KGB C;  4ZCU A;  1Y6W A;  1MUX A;  2KI6 D;  2CXJ A;  3I5I C;  2M8U A;  3EKH A;  2KHN A;  1FBV A;  1G33 A;  4MZJ A;  1OQP A;  3EVU A;  3I5H B;  4M2O A;  2F2P A;  1Y1A A;  1NCZ A;  2RGI A;  3HX4 A;  2K8M B;  3I5I B;  2LVJ A;  1SRA A;  2LUC A;  1M46 A;  1NX0 A;  2KFF A;  1YTZ C;  2I7A A;  3JTD C;  2ZKM X;  1EJ3 A;  2H2K A;  2KSP A;  1L2O B;  4WQ2 A;  4NDB A;  3VRO A;  2PRU A;  3TDI A;  3JTD B;  2OS8 B;  4CPV A;  3SJS A;  4UPG A;  4PE0 A;  5KU1 A;  2ZRT A;  1CFC A;  1NX3 A;  2BE6 A;  2K0J A;  2KBM A;  4YGD B;  1C7W A;  2JPT A;  2NZ0 A;  4CFQ A;  1SBJ A;  3CR2 A;  3D0Y B;  5CSJ A;  2KQY A;  2MLF C;  2L2E A;  1SCM B;  1SPY A;  2JWW A;  1WY9 A;  5FYX A;  1XYD A;  3TDU A;  4P2Y B;  3WHU B;  1XFZ O;  1J7Q A;  2WC8 A;  5G08 A;  1S36 A;  3BUM B;  1FW4 A;  1WDC C;  3NSL A;  2MAZ A;  1A4P A;  1QVI Z;  1B1G A;  1DJH A;  2KOT A;  2MJW B;  2A4J A;  4NDD A;  2KAY A;  1DJI A;  3AKA A;  3CR4 X;  4NQG A;  2QPT A;  3TS5 C;  1QLK A;  4ZCV A;  1YRT B;  3VRP A;  2OPO A;  1CLM A;  1V1G A;  1IJ5 A;  3TS5 B;  4PAL A;  1QAT A;  2JXC A;  3WXA A;  2BCX A;  3FS7 A;  1TNX A;  1CDL A;  4C0J A;  1G8I A;  1LKJ A;  1NWD A;  4PE4 A;  2PAL A;  1FPW A;  1LVC D;  4XYN A;  1K2H A;  1XO5 A;  2KYF A;  2M97 A;  2Y1N A;  1J1E A;  5AFP A;  4CLN A;  4WQ3 A;  5HKW A;  2WCE A;  2COL B;  3C1V A;  5JJG A;  1IQ5 A;  1CLL A;  2KBI A;  3MSE B;  1DJZ A;  1NYA A;  1PK0 D;  3PAT A;  1MWN A;  2JTT A;  1DGU A;  3DVM A;  1D1O A;  5ER5 A;  3AKB A;  1PVB A;  2CNP A;  2KQ6 A;  1KQV A;  3PN7 C;  1J7R A;  2L4H A;  3H4S E;  5D69 A;  3SG3 A;  1K95 A;  1TNQ A;  2Y4Q A;  3LK0 A;  1DVI A;  1JC2 A;  4I5L B;  1AK8 A;  2LAP A;  5I8N A;  3PN7 B;  1OE9 B;  5HYD A;  5HKY A;  3NSK A;  1EXR A;  1Q80 A;  3NSI A;  4YRU A;  1XFY O;  2M1K B;  1XFV O;  2KDH A;  3RLZ A;  2OTG C;  1ZOT B;  1KFU L;  3DD4 A;  2IS9 A;  1BG1 A;  1BMO A;  3EKJ A;  1CDN A;  1A2X A;  4WRI A;  1SK6 D;  1B8R A;  1UHK A;  3NSO A;  1BR1 B;  2JU0 A;  4PHK A;  1TNP A;  2JT0 A;  2ZND A;  1QVI Y;  1AJ4 A;  1WRK A;  2LV7 A;  1A75 A;  1ZFS A;  4OR9 B;  4CFR A;  5KTY A;  1JFJ A;  1SYM A;  4P5O E;  1TCF A;  1DMO A;  3KF9 A; 
#chains in the Genus database with same CATH topology
 2LP3 A;  2E6W A;  4INW A;  2MA2 A;  3DY9 A;  3M0W A;  2KYC A;  3GK1 A;  4GFT A;  1UHN A;  1J1D A;  1A75 B;  3CZ2 A;  3B6X A;  5HLO A;  1Y0V H;  1QV1 A;  1RRO A;  2BCB A;  1DJW A;  4HRH A;  5GQQ C;  3E3R A;  3SS4 A;  1K90 D;  1KSO A;  3SG5 A;  1QX7 A;  1F71 A;  4E68 A;  3JVT C;  1T14 A;  5AAN A;  2M7L A;  2Q4U A;  1V1F A;  1AJ5 A;  1XFU O;  3I5H C;  4ICB A;  4OV2 A;  4PHM A;  2LVV A;  3JVT B;  2LC5 A;  1HT9 A;  3FE9 A;  3PFV A;  3EK4 A;  2M1U A;  5CSF A;  1ZMZ A;  3CWG A;  2EHB A;  1N2D A;  4MSP A;  2BBN A;  3NXA A;  3D10 A;  5TNC A;  4PT1 A;  3NHT A;  2BKI B;  3BQ3 A;  2K2F A;  5FI2 A;  1L2O C;  1LIN A;  4JKT A;  4ETO A;  1CFD A;  2L5X B;  1SY9 A;  1GJY A;  1DJG A;  3QME A;  4A4C A;  2OS8 C;  2FCD A;  4AOM A;  3BYA A;  4GBA A;  1QAS A;  4GNK B;  5DKQ A;  2LMT A;  2ZFD A;  2L0P A;  5HLV A;  3EVV A;  1OOI X;  2H61 A;  1KSM A;  3I5F B;  1P28 A;  2WCL A;  1YUR A;  1DGV A;  4Q04 A;  4YI9 A;  2LLT A;  3UNW A;  1IWQ A;  4PHJ A;  1ZAC A;  3TUY B;  1TCO B;  1SCM C;  4DUQ A;  4DRW A;  1REC A;  2M9G A;  2KFG A;  5KSZ A;  1DTL A;  3B87 A;  4MLW A;  1PSR A;  4YGA A;  3RM1 A;  2PVB A;  2MHH A;  2WOS A;  1KFX L;  2AAO A;  2FOT A;  2JT8 A;  1N0Y A;  2TN4 A;  4BY4 A;  1CFP A;  2HPS A;  2BE4 A;  1K9P A;  2P6B B;  1GM0 A;  1OSA A;  2YGU A;  3L47 A;  5FI7 A;  3Q8I A;  3OHM B;  3GK4 X;  1BLQ A;  1RJV A;  5K89 A;  3BJH A;  1YX8 A;  3S0B A;  3FWC A;  3S0G A;  2LHL A;  1QX5 B;  1CMG A;  1IGV A;  4N1F A;  1X02 A;  2GGZ A;  1F8H A;  2K7B A;  5ER4 X;  1YUT A;  1MR8 A;  2QEB A;  2DOQ A;  1A29 A;  1SW8 A;  1QV0 A;  1KK8 C;  2SAS A;  2I94 A;  4GGF A;  3CLN A;  1SMG A;  4TNC A;  2LCP A;  3CTN A;  1DF0 A;  2LHI A;  1KK8 B;  1F4O A;  2KNE A;  3SG2 A;  4KYN A;  1S6J A;  5BPJ A;  2JNF A;  2PMY A;  1F70 A;  1QXP A;  1LS8 A;  1U5I A;  1JF0 A;  3BUW B;  4A4B A;  5CPV A;  3V2L A;  2E30 A;  1GGW A;  1XK4 A;  1NPQ A;  1YVH A;  1H4B A;  1N65 A;  3F45 A;  4HRG A;  4JQ0 D;  1DF0 B;  3OB1 B;  5I2Q A;  2CBL A;  3PAL A;  3SS3 A;  1K9K A;  3DF0 A;  1OOJ A;  2BL0 B;  1B7T Z;  2ZN9 A;  4L9M A;  1LA0 A;  1QS7 A;  4MVF A;  2EC6 B;  1K93 D;  1KFU S;  1OOG A;  1U5I B;  1KK7 Z;  4I5J A;  4PE1 A;  2CT9 A;  4XJK A;  1GGZ A;  3LCP C;  1FI5 A;  1KQM C;  3GK2 A;  1IIO A;  1ALW A;  3PLF B;  5DKN A;  3VRQ A;  4DCK A;  1IRJ A;  2MBX A;  3AAK A;  3LLE A;  1RFJ A;  1CTR A;  3O4Y A;  5I2L A;  4QJ4 B;  3BUX B;  1KQM B;  2F3Y A;  1ZUZ A;  2PQL A;  3KEV A;  1Y1X A;  1E8A A;  2LVI A;  3DF0 B;  4YGB B;  1F54 A;  1R2U A;  3PM8 A;  5DKR A;  5JOL A;  2NLN A;  3OGN A;  4I5K A;  4XJK B;  3VRR A;  1QIV A;  1YRU B;  1CFF A;  3O2P A;  3DXL A;  3VGO A;  1IH0 A;  3FE6 A;  2R2I A;  1MF8 B;  2G9B A;  1DJY A;  2D8N A;  1DEK A;  2M3W A;  3CS1 A;  3IVT A;  4CID A;  2BEC A;  1S5G Z;  1WRL A;  1MQ1 A;  2P70 A;  1DJX A;  2JC2 A;  2JXL A;  1J55 A;  1SR6 C;  1ALV A;  1PSB A;  1S6I A;  4ORC B;  1UUS A;  5B8I B;  2HET A;  2WOR A;  4GPL B;  1M45 A;  1BOD A;  1NX1 A;  3OP0 A;  1OOF A;  3CR5 X;  3S0F A;  3BXK A;  1SR6 B;  1OMD A;  2QEH A;  4AQI A;  1BF5 A;  3HCM A;  2AUC A;  1W9Z A;  2WCB A;  3WNX B;  2FJY A;  3EG5 B;  3EVR A;  3FWB A;  3LL8 B;  1TRF A;  4FQO A;  3QRX A;  1B8C A;  4OCI A;  3GOF A;  1LA3 A;  2KI4 B;  3FIA A;  3A4U B;  2LAN A;  1IG5 A;  1CM1 A;  1C7V A;  2JTZ A;  1MXE A;  1SL8 A;  3S0E A;  3D73 A;  3D77 A;  1EG3 A;  1QIW A;  2H8V A;  2O60 A;  2SCP A;  3I5G B;  1AVS A;  4JWQ A;  4OZD A;  4N5X A;  1FF1 A;  1CLB A;  4IL1 A;  3B86 A;  1UHI A;  5CSI A;  3PSR A;  4PHN A;  5AXI A;  4GAO A;  2ZRS A;  3ZNI A;  4I5N B;  4U8D A;  1Y1U A;  1B7T Y;  3I5F C;  1XFW O;  3L4A A;  1TOP A;  4NDC A;  3B7A A;  4OVN F;  1KK7 Y;  2PAS A;  1CDP A;  3O78 A;  2M0R A;  3TDZ A;  4C0L A;  3TUY C;  2LLU A;  1S3P A;  1VRK A;  2HQW A;  4YI8 A;  4MBE A;  1KFX S;  3L4L A;  3TZ1 A;  2ISD A;  2H61 C;  4JPZ B;  1A03 A;  3IQQ A;  4FQT A;  1SCV A;  4M2Q A;  3ZWH A;  4N1G A;  3BUN B;  4HSZ A;  1YVL A;  5IBW A;  1F4Q A;  1TNW A;  1TWO A;  2VRG A;  4QJ3 B;  2PYQ A;  1HQV A;  5HKZ A;  3D0Y A;  3SIB A;  3DVK A;  2LUX A;  2LP2 A;  1M31 A;  3D78 A;  1RK9 A;  3CAB A;  2I18 A;  1KCY A;  1TUZ A;  1S5G Y;  1W7I B;  5HL1 A;  1BR4 B;  3O6B A;  1AP4 A;  3LK1 A;  1NUB A;  2M7N A;  1IJ6 A;  1NX2 A;  1OMR A;  1RWY A;  2GGM A;  3EK8 A;  1G4Y R;  2MRD A;  1WRZ A;  1SL9 A;  1GQM A;  1UHJ A;  1MHO A;  1WLZ A;  2K2A A;  3SG4 A;  4MN0 A;  2QEO A;  5AER A;  3VRN A;  1NIW A;  1MXL C;  2KI6 C;  2V53 A;  3BOW A;  3R72 A;  4FTG A;  2LMV A;  2JT3 A;  1CKK A;  2JZI A;  3WHT B;  1JSA A;  2KGR A;  4MRX A;  2WCF A;  2KFH A;  3CYZ A;  2F2O A;  1WDC B;  2K60 A;  1YUU A;  1S1E A;  2F8P A;  4GGF C;  4ORA B;  3NHI A;  2BCA A;  1C07 A;  1JWD A;  3DVJ A;  4MEW A;  4MZL A;  3ICB A;  1ODB A;  1DT7 B;  1SL7 A;  4YGE B;  4BY5 A;  1SNL A;  3BOW B;  4D1E A;  2FCE A;  1QTX A;  2JQ6 A;  2BL0 C;  1PAL A;  3AAJ A;  3B88 A;  2KAV A;  3IF7 A;  2F33 A;  2G2B A;  4AQJ A;  1B4C A;  3N7H A;  2EC6 C;  2BBM A;  2JNX A;  2HQ8 A;  1XVJ A;  2LMU A;  2Q91 A;  3OX5 A;  2Y1M A;  5D7F A;  5F6T A;  1AUI B;  1XK4 C;  1NCX A;  3KO0 A;  1K94 A;  2JUL A;  3R1O A;  2L5Y A;  1Z4H A;  4OKH A;  2AMI A;  1B8L A;  2GV5 A;  1L7Z A;  2EGD A;  3KPX A;  4F0Z B;  2WCH A;  3DVE A;  3CZT X;  5I2O A;  1S6C A;  2LE9 B;  2NXQ A;  2LVK A;  1BJF A;  3BUO B;  1S26 D;  4PCW A;  1OZS A;  1YX7 A;  3CZ1 A;  1BOC A;  1LXF C;  1PRW A;  3UO9 A;  4GGN A;  2L50 A;  1EL4 A;  1KWO C;  2WND A;  2WC5 A;  4M2P A;  3K21 A;  2K61 A;  1OZO A;  3R1V A;  5PAL A;  2WCK A;  3SG6 A;  3A8R A;  2L4I A;  2KLD A;  3SIA A;  1KWO B;  2JOJ A;  4IJ7 A;  1UP5 A;  1K96 A;  3OB2 B;  1YR5 A;  1F55 A;  2LM5 A;  1XFX O;  1AHR A;  2PSR A;  1SSE B;  1XFR A;  1WLM A;  1M63 B;  1NSH A;  1RTP 1;  1UHH A;  4USL A;  2NCO A;  3S0D A;  1BT6 A;  1NP8 A;  5D3O A;  1JUO A;  2B1U A;  1IKU A;  4YBH B;  3OX6 A;  4DS7 A;  2K7C A;  2ZN8 A;  1CNP A;  1W7J B;  3IQO A;  4HRE E;  1H8B A;  1CDM A;  4MRY A;  1YUS A;  2CCM A;  1M39 A;  1BU3 A;  1J7P A;  5CSN A;  1QX2 A;  1TIZ A;  2K7D A;  2KI4 C;  3CGA A;  5EL2 A;  2I2R E;  3SG7 A;  1EH2 A;  4C0K A;  1TN4 A;  2GTE A;  4GUK A;  2LNK A;  4PDZ A;  2OTG B;  5AEQ A;  1JF2 A;  1FI6 A;  1PVA A;  1TTX A;  1EG4 A;  2Y5I A;  1J7O A;  1XA5 A;  2F3Z A;  4QJ5 B;  1QJT A;  2ZNE A;  1OMV A;  3I5G C;  1IQ3 A;  2CTN A;  4PE7 A;  1CMF A;  2BKH B;  1CB1 A;  2M49 B;  1QLS A;  2JPO A;  1B47 A;  1R6P A;  3KHE A;  4ORB B;  1SKT A;  2HF5 A;  4R1E A;  1K9U A;  2JRF A;  2NCP A;  2QAC A;  1UUR A;  1JFK A;  1CM4 A;  2FJU B;  2KAX A;  1NCY A;  4DIR A;  2L51 A;  3NGV A;  2MLE C;  2O5G A;  1K8U A;  1TUJ A;  1PUL A;  1UWO A;  2M29 A;  3EK7 A;  2K7O A;  4F7F A;  2L98 A;  1JBA A;  5J3X A;  4YGC B;  2KPH A;  4MZK A;  2LLS A;  1B9A A;  2KGB C;  4ZCU A;  1Y6W A;  1MUX A;  1C3Z A;  2KI6 D;  2CXJ A;  3I5I C;  2M8U A;  3EKH A;  2KHN A;  1DQE A;  1FBV A;  1G33 A;  1OQP A;  3EVU A;  3I5H B;  4M2O A;  2F2P A;  4MZJ A;  1Y1A A;  1NCZ A;  2RGI A;  3HX4 A;  2K8M B;  3I5I B;  2LVJ A;  1SRA A;  3BFH A;  2LUC A;  1M46 A;  1OOH A;  1NX0 A;  2KFF A;  1YTZ C;  2I7A A;  3JTD C;  2ZKM X;  3BFB A;  1EJ3 A;  2H2K A;  2KLE A;  2KSP A;  1L2O B;  3RZS A;  4WQ2 A;  4NDB A;  2WC6 A;  3VRO A;  2PRU A;  3TDI A;  3JTD B;  2OS8 B;  4CPV A;  3SJS A;  2BAP A;  3D75 A;  3PM2 A;  4UPG A;  4PE0 A;  5KU1 A;  2BNX A;  2ZRT A;  1CFC A;  3CZ0 A;  1NX3 A;  2BE6 A;  2K0J A;  2KBM A;  4YGD B;  1C7W A;  2JPT A;  2NZ0 A;  4CFQ A;  1SBJ A;  3CR2 A;  3D0Y B;  5CSJ A;  2KQY A;  2MLF C;  2L2E A;  1SCM B;  1SPY A;  2QDI A;  2JWW A;  1WY9 A;  5FYX A;  1XYD A;  3K1E A;  4P2Y B;  3TDU A;  1XFZ O;  3WHU B;  5I94 A;  1J7Q A;  2WC8 A;  5G08 A;  4INX A;  1S36 A;  3BUM B;  1FW4 A;  3DYE A;  1WDC C;  3NSL A;  2MAZ A;  1DEL A;  1A4P A;  4JD9 A;  1QVI Z;  1B1G A;  1DC1 A;  1DJH A;  2KOT A;  2MJW B;  2A4J A;  4NDD A;  2KAY A;  1DJI A;  3AKA A;  3CR4 X;  4NQG A;  2QPT A;  3TS5 C;  1QLK A;  4ZCV A;  2P71 A;  1YRT B;  3VRP A;  2OPO A;  3DZT A;  1CLM A;  1V1G A;  1IJ5 A;  3TS5 B;  4PAL A;  1QAT A;  2JXC A;  5DIC A;  3WXA A;  2BCX A;  3FS7 A;  1TNX A;  1CDL A;  4C0J A;  1G8I A;  1LKJ A;  1NWD A;  2QEV A;  3S0A A;  3O4X A;  3FE8 A;  4PE4 A;  2PAL A;  1FPW A;  1LVC D;  4XYN A;  1K2H A;  1XO5 A;  2KYF A;  2M97 A;  2Y1N A;  1J1E A;  5AFP A;  4CLN A;  1OW4 A;  3CDN A;  3VB1 A;  4WQ3 A;  5HKW A;  2WCE A;  2COL B;  3C1V A;  5JJG A;  1IQ5 A;  1CLL A;  2KBI A;  1Z2C B;  3MSE B;  1DJZ A;  1NYA A;  1PK0 D;  3PAT A;  3PJI A;  1MWN A;  2JTT A;  1DGU A;  3DVM A;  1D1O A;  5ER5 A;  3AKB A;  1PVB A;  2CNP A;  1ORG A;  2KQ6 A;  1KQV A;  3PN7 C;  1J7R A;  2L4H A;  3H4S E;  5D69 A;  3SG3 A;  1K95 A;  1TNQ A;  2Y4Q A;  3LK0 A;  1DVI A;  1JC2 A;  4I5L B;  1AK8 A;  2LAP A;  5I8N A;  3PN7 B;  1OE9 B;  5HYD A;  2WCJ A;  5HKY A;  3NSK A;  1EXR A;  1Q80 A;  3NSI A;  1QWV A;  4YRU A;  1XFY O;  2M1K B;  1XFV O;  1C3Y A;  2KDH A;  3RLZ A;  2WCM A;  2OTG C;  1ZOT B;  1KFU L;  3DD4 A;  2IS9 A;  1BG1 A;  1BMO A;  2L2C A;  3EKJ A;  1CDN A;  1A2X A;  4WRI A;  1SK6 D;  3R1P A;  1B8R A;  1UHK A;  3NSO A;  1BR1 B;  2JU0 A;  4PHK A;  3OBV A;  1TNP A;  3SS5 A;  2JT0 A;  2ZND A;  1QVI Y;  3D74 A;  1AJ4 A;  1WRK A;  2LV7 A;  1ZFS A;  1A75 A;  4OR9 B;  3D76 A;  5FI6 A;  4CFR A;  5KTY A;  1JFJ A;  1SYM A;  4P5O E;  1TCF A;  1DMO A;  3KF9 A;  3BFA A;  2ERB A; 
#chains in the Genus database with same CATH homology
 2LP3 A;  2E6W A;  2MA2 A;  3M0W A;  2KYC A;  3GK1 A;  4GFT A;  1UHN A;  1J1D A;  1A75 B;  5HLO A;  1Y0V H;  1QV1 A;  1RRO A;  2BCB A;  1DJW A;  4HRH A;  5GQQ C;  3E3R A;  1K90 D;  1KSO A;  3SG5 A;  1QX7 A;  1F71 A;  4E68 A;  3JVT C;  5AAN A;  2M7L A;  2Q4U A;  1V1F A;  1AJ5 A;  1XFU O;  3I5H C;  4ICB A;  4OV2 A;  4PHM A;  2LVV A;  3JVT B;  2LC5 A;  1HT9 A;  3PFV A;  5CSF A;  3EK4 A;  2M1U A;  1ZMZ A;  3CWG A;  2EHB A;  1N2D A;  4MSP A;  2BBN A;  3NXA A;  3D10 A;  5TNC A;  2BKI B;  3BQ3 A;  2K2F A;  1L2O C;  1LIN A;  4ETO A;  1CFD A;  2L5X B;  1SY9 A;  1GJY A;  1DJG A;  4A4C A;  2OS8 C;  2FCD A;  4AOM A;  3BYA A;  4GBA A;  1QAS A;  4GNK B;  5DKQ A;  2LMT A;  2ZFD A;  2L0P A;  5HLV A;  3EVV A;  2H61 A;  1KSM A;  3I5F B;  4Q04 A;  4YI9 A;  1YUR A;  1DGV A;  2LLT A;  1IWQ A;  4PHJ A;  1ZAC A;  3TUY B;  1TCO B;  1SCM C;  4DUQ A;  4DRW A;  1REC A;  2M9G A;  2KFG A;  5KSZ A;  1DTL A;  4MLW A;  1PSR A;  4YGA A;  3RM1 A;  2PVB A;  2MHH A;  2WOS A;  1KFX L;  2AAO A;  2FOT A;  2JT8 A;  1N0Y A;  2TN4 A;  4BY4 A;  1CFP A;  2HPS A;  2BE4 A;  1K9P A;  2P6B B;  1OSA A;  3OHM B;  3GK4 X;  1BLQ A;  1RJV A;  5K89 A;  1YX8 A;  3FWC A;  2LHL A;  1QX5 B;  1CMG A;  1IGV A;  4N1F A;  1X02 A;  2GGZ A;  1F8H A;  2K7B A;  5ER4 X;  1YUT A;  1MR8 A;  2DOQ A;  1A29 A;  1SW8 A;  1QV0 A;  1KK8 C;  2SAS A;  2I94 A;  4GGF A;  3CLN A;  1SMG A;  4TNC A;  2LCP A;  3CTN A;  1DF0 A;  2LHI A;  1KK8 B;  1F4O A;  2KNE A;  3SG2 A;  1S6J A;  5BPJ A;  2JNF A;  2PMY A;  1F70 A;  1QXP A;  1U5I A;  1JF0 A;  3BUW B;  4A4B A;  5CPV A;  2E30 A;  1GGW A;  1XK4 A;  1NPQ A;  1YVH A;  1H4B A;  1N65 A;  3F45 A;  4HRG A;  4JQ0 D;  1DF0 B;  3OB1 B;  5I2Q A;  2CBL A;  3PAL A;  1K9K A;  3DF0 A;  2BL0 B;  1OOJ A;  1B7T Z;  2ZN9 A;  4L9M A;  1LA0 A;  1QS7 A;  4MVF A;  2EC6 B;  1K93 D;  1KFU S;  1U5I B;  4I5J A;  1KK7 Z;  4PE1 A;  4XJK A;  2CT9 A;  1GGZ A;  3LCP C;  1FI5 A;  1KQM C;  3GK2 A;  1ALW A;  3PLF B;  5DKN A;  3VRQ A;  4DCK A;  1IRJ A;  2MBX A;  3AAK A;  3LLE A;  1RFJ A;  1CTR A;  3O4Y A;  5I2L A;  4QJ4 B;  3BUX B;  1KQM B;  2F3Y A;  1ZUZ A;  3KEV A;  1Y1X A;  1E8A A;  2LVI A;  3DF0 B;  4YGB B;  1F54 A;  1R2U A;  3PM8 A;  5DKR A;  5JOL A;  2NLN A;  4XJK B;  4I5K A;  3VRR A;  1CFF A;  1QIV A;  1YRU B;  3O2P A;  3VGO A;  1IH0 A;  2R2I A;  1MF8 B;  2G9B A;  1DJY A;  2D8N A;  2M3W A;  3CS1 A;  4CID A;  2BEC A;  1S5G Z;  1WRL A;  1MQ1 A;  1DJX A;  2JC2 A;  2JXL A;  1J55 A;  1SR6 C;  1ALV A;  1PSB A;  1S6I A;  4ORC B;  1UUS A;  5B8I B;  2HET A;  2WOR A;  4GPL B;  1M45 A;  1BOD A;  1NX1 A;  3OP0 A;  3CR5 X;  3BXK A;  1SR6 B;  1OMD A;  4AQI A;  1BF5 A;  3HCM A;  2AUC A;  2WCB A;  3WNX B;  3EVR A;  3FWB A;  3LL8 B;  1TRF A;  4FQO A;  3QRX A;  1B8C A;  4OCI A;  3GOF A;  1LA3 A;  2KI4 B;  3FIA A;  3A4U B;  2LAN A;  1IG5 A;  1CM1 A;  1C7V A;  2JTZ A;  1MXE A;  1SL8 A;  1EG3 A;  1QIW A;  2O60 A;  2SCP A;  3I5G B;  1AVS A;  4JWQ A;  4N5X A;  1FF1 A;  1CLB A;  4IL1 A;  1UHI A;  5CSI A;  3PSR A;  4PHN A;  5AXI A;  4GAO A;  2ZRS A;  3ZNI A;  4I5N B;  4U8D A;  1Y1U A;  1B7T Y;  3I5F C;  1XFW O;  1TOP A;  4NDC A;  4OVN F;  1KK7 Y;  2PAS A;  1CDP A;  3O78 A;  2M0R A;  3TDZ A;  4C0L A;  3TUY C;  2LLU A;  1S3P A;  1VRK A;  2HQW A;  4YI8 A;  4MBE A;  1KFX S;  3TZ1 A;  2ISD A;  2H61 C;  4JPZ B;  1A03 A;  3IQQ A;  1SCV A;  4M2Q A;  3ZWH A;  4N1G A;  3BUN B;  4HSZ A;  1YVL A;  5IBW A;  1F4Q A;  1TNW A;  2VRG A;  4QJ3 B;  1HQV A;  5HKZ A;  3D0Y A;  3SIB A;  3DVK A;  2LUX A;  2LP2 A;  1M31 A;  1KCY A;  1RK9 A;  2I18 A;  1S5G Y;  1W7I B;  1BR4 B;  3O6B A;  1AP4 A;  3LK1 A;  1NUB A;  2M7N A;  1IJ6 A;  1NX2 A;  1OMR A;  1RWY A;  2GGM A;  3EK8 A;  1G4Y R;  2MRD A;  1WRZ A;  1SL9 A;  1GQM A;  1UHJ A;  1MHO A;  1WLZ A;  2K2A A;  3SG4 A;  4MN0 A;  5AER A;  3VRN A;  1NIW A;  1MXL C;  2KI6 C;  2V53 A;  3BOW A;  4FTG A;  2LMV A;  2JT3 A;  1CKK A;  2JZI A;  3WHT B;  1JSA A;  2KGR A;  4MRX A;  2WCF A;  2KFH A;  2F2O A;  1WDC B;  1YUU A;  1S1E A;  2F8P A;  4GGF C;  4ORA B;  2BCA A;  1C07 A;  1JWD A;  3DVJ A;  4MEW A;  4MZL A;  3ICB A;  1ODB A;  1DT7 B;  1SL7 A;  4YGE B;  4BY5 A;  1SNL A;  3BOW B;  4D1E A;  2FCE A;  1QTX A;  2JQ6 A;  2BL0 C;  1PAL A;  3AAJ A;  3IF7 A;  2KAV A;  4AQJ A;  2F33 A;  2G2B A;  1B4C A;  2EC6 C;  2BBM A;  2JNX A;  2HQ8 A;  1XVJ A;  2LMU A;  2Q91 A;  3OX5 A;  2Y1M A;  5D7F A;  5F6T A;  1AUI B;  1XK4 C;  1NCX A;  3KO0 A;  1K94 A;  2JUL A;  4OKH A;  2AMI A;  1B8L A;  2GV5 A;  1L7Z A;  2EGD A;  3KPX A;  4F0Z B;  3DVE A;  3CZT X;  5I2O A;  1S6C A;  2LE9 B;  2NXQ A;  2LVK A;  1BJF A;  3BUO B;  1S26 D;  4PCW A;  1OZS A;  1YX7 A;  1BOC A;  1LXF C;  1PRW A;  4GGN A;  2L50 A;  1EL4 A;  1KWO C;  2WND A;  4M2P A;  3K21 A;  2K61 A;  1OZO A;  3SG6 A;  5PAL A;  3A8R A;  2L4I A;  3SIA A;  1KWO B;  2JOJ A;  1UP5 A;  1K96 A;  3OB2 B;  1YR5 A;  1F55 A;  2LM5 A;  1XFX O;  1AHR A;  2PSR A;  1WLM A;  1M63 B;  1NSH A;  1RTP 1;  1UHH A;  4USL A;  2NCO A;  1BT6 A;  1NP8 A;  1JUO A;  2B1U A;  1IKU A;  4YBH B;  3OX6 A;  4DS7 A;  2K7C A;  2ZN8 A;  1CNP A;  1W7J B;  3IQO A;  4HRE E;  1H8B A;  1CDM A;  4MRY A;  1YUS A;  2CCM A;  1M39 A;  1BU3 A;  1J7P A;  5CSN A;  1QX2 A;  1TIZ A;  2K7D A;  2KI4 C;  3CGA A;  3SG7 A;  2I2R E;  1EH2 A;  4C0K A;  1TN4 A;  4GUK A;  5AEQ A;  2LNK A;  4PDZ A;  2OTG B;  1JF2 A;  1FI6 A;  1PVA A;  1TTX A;  1EG4 A;  2Y5I A;  1J7O A;  1XA5 A;  2F3Z A;  4QJ5 B;  1QJT A;  2ZNE A;  1OMV A;  3I5G C;  1IQ3 A;  2CTN A;  4PE7 A;  1CMF A;  2BKH B;  1CB1 A;  2M49 B;  1QLS A;  1B47 A;  1R6P A;  3KHE A;  4ORB B;  1SKT A;  2HF5 A;  4R1E A;  1K9U A;  2JRF A;  2NCP A;  2QAC A;  1UUR A;  1JFK A;  1CM4 A;  2FJU B;  2KAX A;  1NCY A;  4DIR A;  2L51 A;  2MLE C;  2O5G A;  1K8U A;  2M29 A;  1PUL A;  1UWO A;  3EK7 A;  2K7O A;  2L98 A;  1JBA A;  5J3X A;  4YGC B;  4MZK A;  2LLS A;  1B9A A;  2KGB C;  4ZCU A;  1Y6W A;  1MUX A;  2KI6 D;  2CXJ A;  3I5I C;  2M8U A;  3EKH A;  2KHN A;  1FBV A;  1G33 A;  4MZJ A;  1OQP A;  3EVU A;  3I5H B;  4M2O A;  2F2P A;  1Y1A A;  1NCZ A;  2RGI A;  3HX4 A;  2K8M B;  3I5I B;  2LVJ A;  1SRA A;  2LUC A;  1M46 A;  1NX0 A;  2KFF A;  1YTZ C;  2I7A A;  3JTD C;  2ZKM X;  1EJ3 A;  2H2K A;  2KSP A;  1L2O B;  4WQ2 A;  4NDB A;  3VRO A;  2PRU A;  3TDI A;  3JTD B;  2OS8 B;  4CPV A;  3SJS A;  4UPG A;  4PE0 A;  5KU1 A;  2ZRT A;  1CFC A;  1NX3 A;  2BE6 A;  2K0J A;  2KBM A;  4YGD B;  1C7W A;  2JPT A;  2NZ0 A;  4CFQ A;  1SBJ A;  3CR2 A;  3D0Y B;  5CSJ A;  2KQY A;  2MLF C;  2L2E A;  1SCM B;  1SPY A;  2JWW A;  1WY9 A;  5FYX A;  1XYD A;  3TDU A;  4P2Y B;  3WHU B;  1XFZ O;  1J7Q A;  2WC8 A;  5G08 A;  1S36 A;  3BUM B;  1FW4 A;  1WDC C;  3NSL A;  2MAZ A;  1A4P A;  1QVI Z;  1B1G A;  1DJH A;  2KOT A;  2MJW B;  2A4J A;  4NDD A;  2KAY A;  1DJI A;  3AKA A;  3CR4 X;  4NQG A;  2QPT A;  3TS5 C;  1QLK A;  4ZCV A;  1YRT B;  3VRP A;  2OPO A;  1CLM A;  1V1G A;  1IJ5 A;  3TS5 B;  4PAL A;  1QAT A;  2JXC A;  3WXA A;  2BCX A;  3FS7 A;  1TNX A;  1CDL A;  4C0J A;  1G8I A;  1LKJ A;  1NWD A;  4PE4 A;  2PAL A;  1FPW A;  1LVC D;  4XYN A;  1K2H A;  1XO5 A;  2KYF A;  2M97 A;  2Y1N A;  1J1E A;  5AFP A;  4CLN A;  4WQ3 A;  5HKW A;  2WCE A;  2COL B;  3C1V A;  5JJG A;  1IQ5 A;  1CLL A;  2KBI A;  3MSE B;  1DJZ A;  1NYA A;  1PK0 D;  3PAT A;  1MWN A;  2JTT A;  1DGU A;  3DVM A;  1D1O A;  5ER5 A;  3AKB A;  1PVB A;  2CNP A;  2KQ6 A;  1KQV A;  3PN7 C;  1J7R A;  2L4H A;  3H4S E;  5D69 A;  3SG3 A;  1K95 A;  1TNQ A;  2Y4Q A;  3LK0 A;  1DVI A;  1JC2 A;  4I5L B;  1AK8 A;  2LAP A;  5I8N A;  3PN7 B;  1OE9 B;  5HYD A;  5HKY A;  3NSK A;  1EXR A;  1Q80 A;  3NSI A;  4YRU A;  1XFY O;  2M1K B;  1XFV O;  2KDH A;  3RLZ A;  2OTG C;  1ZOT B;  1KFU L;  3DD4 A;  2IS9 A;  1BG1 A;  1BMO A;  3EKJ A;  1CDN A;  1A2X A;  4WRI A;  1SK6 D;  1B8R A;  1UHK A;  3NSO A;  1BR1 B;  2JU0 A;  4PHK A;  1TNP A;  2JT0 A;  2ZND A;  1QVI Y;  1AJ4 A;  1WRK A;  2LV7 A;  1A75 A;  1ZFS A;  4OR9 B;  4CFR A;  5KTY A;  1JFJ A;  1SYM A;  4P5O E;  1TCF A;  1DMO A;  3KF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...