1KCYA

Nmr solution structure of apo calbindin d9k (f36g + p43m mutant)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEGPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords calbindin D9k
publication title The EF-hand domain: a globally cooperative structural unit.
pubmed doi rcsb
source organism Bos taurus
total genus 25
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kcyA00
2HQ8A 1QATA 1YURA 2JQ6A 1CM1A 1NCXA 1R6PA 2EC6C 2JT0A 1YUSA 1OE9B 2EGDA 1G33A 2O60A 3VGOA 1QVIY 2G2BA 2KGRA 1PALA 1F55A 1NSHA 1LA0A 1K95A 2JC2A 1JSAA 1YTZC 1FW4A 1KQVA 4MZJA 4XJKB 1OMDA 5JJGA 1A03A 2KHNA 3EVVA 1BR1B 1SK6D 2PVBA 1LKJA 2HQWA 2LNKA 1QV1A 1WDCB 5ER4X 1JF2A 4N1FA 4NDDA 1CFCA 1GGZA 1SCMB 1RK9A 1IRJA 2ISDA 3FWBA 3O78A 2E30A 2WC8A 3DVJA 3LLEA 1QLSA 4P5OE 1FI5A 3GK4X 4DCKA 2L98A 2HF5A 1A75B 3JTDB 3TDZA 1DJGA 1NWDA 1KCYA 3BUOB 1K9UA 4FQOA 4HRHA 4PE7A 1RJVA 4GUKA 1G8IA 3SIBA 1WLMA 1B8CA 1HT9A 3IF7A 4YGDB 1IG5A 1J7RA 1W7JB 3OX6A 5ER5A 2Q91A 5AEQA 2B1UA 1SKTA 2WORA 1J1DA 1XFWO 2LANA 2EHBA 1C07A 2AUCA 4YGAA 2LVIA 1XO5A 1KQMC 4I5KA 1SR6C 1WRZA 3GK1A 5HYDA 2KFGA 4MLWA 2LE9B 4M2PA 2BKIB 4DRWA 1TIZA 2M7LA 3NSKA 4ZCVA 1BODA 1LA3A 1B9AA 2RGIA 4PHKA 1NIWA 1C7VA 1MUXA 3CLNA 3ZNIA 1AUIB 1U5IA 1EG4A 3I5HC 3PN7C 1QX7A 1QASA 4L9MA 1QS7A 4PALA 1NX1A 5BPJA 3DVMA 1IQ3A 4ORAB 4AOMA 2KI6C 1DJXA 4PCWA 3O2PA 1V1GA 3D10A 2CNPA 1B7TY 3LL8B 5CSJA 5B8IB 4GPLB 3AKAA 4GAOA 1NX2A 2G9BA 3K21A 5HLVA 5FYXA 3SG5A 1UHJA 3CWGA 2NCPA 3PLFB 5KU1A 5HKYA 4GGNA 1RFJA 1W7IB 2KFFA 1EH2A 3E3RA 2ZN9A 1B4CA 1RECA 1EJ3A 2ZKMX 1Y1AA 2NLNA 1DMOA 5PALA 3KEVA 4OR9B 2AMIA 3ZWHA 2LHIA 3EVUA 3FWCA 1UWOA 1QXPA 1QJTA 3PFVA 1PK0D 2FJUB 2ZRSA 3MSEB 1YRTB 2LLUA 2K7BA 2MHHA 2PSRA 1NX3A 1RWYA 2KQ6A 3TDUA 2M9GA 3C1VA 1NUBA 1UP5A 2OTGB 4MZLA 5JOLA 1JFJA 2F3ZA 3EKJA 1LVCD 2HPSA 2LM5A 4HRGA 2MJWB 2LP3A 1TN4A 4E68A 1S5GZ 1KFXL 5GQQC 1DGVA 2JXCA 2JXLA 2K0JA 1QLKA 2OS8B 4NDBA 2I94A 2KYCA 4PDZA 1IKUA 1BLQA 2PASA 4A4BA 2L2EA 1QIWA 1D1OA 1HQVA 3CR5X 3JVTC 4OVNF 1YUTA 4GFTA 3WHUB 1FPWA 1DJYA 2M8UA 4OCIA 2BE6A 3VRPA 1DVIA 1SYMA 1OOJA 1BF5A 1TNPA 2LVJA 2V53A 1TCFA 3OHMB 2OPOA 1NCZA 1SL7A 2Y1MA 1AVSA 5J3XA 5CPVA 3BUWB 2O5GA 1JF0A 1KK8B 2KI4B 1B8LA 3TZ1A 2KAYA 4I5LB 1E8AA 2CXJA 2ZRTA 5KTYA 3WNXB 1F4QA 1AHRA 1B8RA 2PMYA 3CR2A 1MF8B 1JBAA 3FIAA 1Y0VH 1M39A 1DT7B 2BECA 4N1GA 3TUYB 1BOCA 2JZIA 3BOWA 2KBMA 1IH0A 3HCMA 2KI6D 3VRNA 3DD4A 4IL1A 1MQ1A 4YGCB 1YR5A 2JWWA 2FCEA 2LLTA 5HKZA 4QJ5B 1IWQA 1QIVA 2L4HA 3PALA 3PATA 4YI9A 3TS5B 2WNDA 4WQ2A 1TNQA 2GGMA 4JPZB 5I2LA 5CSFA 2QACA 3I5FB 5I2OA 1XK4A 4CFRA 2MLFC 1NYAA 4CFQA 1CMGA 1TNWA 3O4YA 3HX4A 1XK4C 2BCAA 2ZN8A 3OB2B 1K9KA 2H61A 2WCEA 1M45A 1IJ5A 3SG6A 1DTLA 1QX2A 1R2UA 4WQ3A 1UHHA 4U8DA 4A4CA 2JULA 5G08A 2H61C 2FCDA 4D1EA 4PE4A 4F0ZB 1KK7Y 2BE4A 1UHNA 2VRGA 1KWOC 2NZ0A 2M3WA 3OP0A 1QX5B 1KFXS 1Y6WA 3PM8A 1F8HA 3ICBA 2EC6B 1CDNA 2JT8A 2JNXA 2CBLA 3RM1A 2FOTA 4YRUA 1SPYA 1AJ5A 3SIAA 3KF9A 1OSAA 4ORCB 4OKHA 3SG3A 1SCVA 3EK8A 1WY9A 1BR4B 5TNCA 3TDIA 1TTXA 3SJSA 2LUCA 3GOFA 4I5JA 1K93D 1K2HA 1MXLC 3QRXA 1PULA 3BQ3A 3NXAA 1PSBA 1FBVA 1RROA 3M0WA 2GV5A 1YRUB 2OS8C 1NX0A 3CGAA 3CS1A 1BJFA 1SL8A 1AP4A 4I5NB 4NDCA 1BG1A 1XFVO 1QVIZ 3VRQA 1MR8A 1LINA 2SCPA 2SASA 1YVLA 2F8PA 4FTGA 5DKQA 4GNKB 1L2OB 1AK8A 1H4BA 2CTNA 3EVRA 4ZCUA 3O6BA 1ZOTB 1J7QA 2L5XB 1M31A 1DF0B 3OX5A 2CT9A 4DUQA 2KNEA 2JPTA 4ICBA 1KFUS 1OMRA 1L7ZA 5DKNA 2LCPA 1K8UA 2PALA 5AANA 1VRKA 1CLBA 2LV7A 2IS9A 1S1EA 2LLSA 1J7PA 2Y4QA 2KFHA 1Y1XA 1SW8A 1S6IA 3BUMB 2WCFA 2K61A 4XJKA 2MBXA 1KQMB 4AQIA 2JU0A 1SR6B 4CPVA 1ALVA 2K7CA 2KYFA 4OV2A 1BT6A 3IQOA 2TN4A 2WCBA 2M1KB 1OZOA 3NSIA 1IJ6A 1KSOA 4MN0A 2ZFDA 1OQPA 1TRFA 1SL9A 1DJZA 2BKHB 3AAJA 2JT3A 3FS7A 1UURA 4UPGA 3I5HB 1WDCC 1K96A 3H4SE 3PN7B 4AQJA 1FI6A 1NCYA 3OB1B 1CFFA 1U5IB 2KOTA 1SCMC 1ZUZA 4MEWA 2F3YA 1A75A 4ORBB 1CKKA 2A4JA 1IGVA 3BUNB 1DGUA 4CLNA 1BMOA 3KO0A 4M2QA 2KAVA 2L4IA 3I5FC 3JTDC 4PHJA 4QJ3B 3PSRA 2LHLA 4ETOA 3KPXA 2F2OA 2M7NA 2M49B 1N0YA 2CCMA 1CFDA 1SNLA 4MRXA 3NSOA 1UHKA 5AERA 3DVKA 2AAOA 1F54A 3I5IB 1KFUL 2P6BB 2M29A 1KSMA 1WRLA 5CSIA 2Y1NA 2K2AA 4YI8A 1DJIA 4R1EA 2BL0B 1B7TZ 4WRIA 1SMGA 1CB1A 2COLB 4JWQA 2DOQA 1J1EA 1F71A 2LAPA 3WXAA 2LMUA 2L0PA 3GK2A 1BU3A 5D7FA 2K7DA 1MXEA 1H8BA 3JVTB 5AFPA 1JUOA 2MA2A 1MWNA 3RLZA 2JTTA 1EXRA 1SBJA 1FF1A 4MZKA 2H2KA 1Y1UA 2L50A 1B47A 3BUXB 3I5GB 1UHIA 4YGEB 2KDHA 1SY9A 2D8NA 3VROA 1CNPA 1XVJA 4CIDA 4JQ0D 1S5GY 2I2RE 3AKBA 1QV0A 3DF0B 5I8NA 3D0YB 1PRWA 1DF0A 1L2OC 1CTRA 2E6WA 2HETA 1S26D 2ZNEA 3EK4A 1B1GA 4GGFA 1N65A 2KAXA 1NPQA 5KSZA 5CSNA 2M0RA 3WHTB 1M63B 4DS7A 1CFPA 2MLEC 2JRFA 4GGFC 4YBHB 1K90D 1ZFSA 3AAKA 1TNXA 3EKHA 3CZTX 4MVFA 5DKRA 1EL4A 1N2DA 5F6TA 1A29A 4PE0A 2OTGC 2PRUA 2JOJA 4C0JA 4HREE 1S6JA 2MRDA 2KQYA 1YUUA 2LP2A 1JWDA 1ODBA 1K9PA 2I18A 4NQGA 3BOWB 2M1UA 1IQ5A 1ZMZA 1PVAA 4MRYA 1Q80A 3A4UB 3F45A 4QJ4B 2I7AA 1EG3A 1GGWA 1OZSA 2MAZA 4YGBB 1TOPA 4M2OA 2GGZA 1CLMA 1NP8A 1DJWA 1YX7A 2K7OA 1F4OA 1CM4A 2LUXA 4MSPA 4TNCA 2LVKA 4C0LA 3LK0A 1A2XA 1J7OA 1XFZO 1YX8A 2Y5IA 1UUSA 2NCOA 3LK1A 4PHNA 2L51A 2BCBA 2K2FA 5HKWA 4USLA 2KSPA 1SRAA 3BYAA 2JTZA 2Q4UA 1ZACA 2BBNA 4P2YB 1KK8C 1V1FA 1X02A 2KI4C 1JFKA 2LVVA 5D69A 1KWOB 5I2QA 5IBWA 2QPTA 1XFYO 2F33A 2JNFA 2BCXA 4BY4A 1PVBA 1OMVA 4XYNA 1AJ4A 3NSLA 2KGBC 3BXKA 4HSZA 5K89A 1WLZA 3I5IC 1MHOA 1S3PA 1J55A 1XFXO 1CDMA 1XA5A 2LMTA 3CTNA 3TUYC 1TCOB 4MBEA 2BL0C 1ALWA 2ZNDA 3CR4X 2F2PA 4BY5A 3IQQA 1CDLA 1GQMA 4PE1A 1A4PA 1JC2A 2LMVA 4GBAA 2R2IA 1S6CA 1CLLA 1KK7Z 4PHMA 3EK7A 1XFUO 3TS5C 4C0KA 4N5XA 1LXFC 1PSRA 1XYDA 3SG4A 4Q04A 1YVHA 2LC5A 3DVEA 5HLOA 3SG2A 4DIRA 1CDPA 5AXIA 3A8RA 1GJYA 1RTP1 1K94A 2BBMA 2WOSA 1CMFA 3LCPC 1QTXA 2K8MB 1S36A 1WRKA 3SG7A 2M97A 1C7WA 3DF0A 3D0YA 1DJHA 1F70A 3I5GC 3KHEA 1G4YR 2KBIA 2NXQA 1M46A 3VRRA
chains in the Genus database with same CATH superfamily
2HQ8A 1QATA 5FI2A 1YURA 2JQ6A 1CM1A 1NCXA 3BFAA 1R6PA 2EC6C 2JT0A 1YUSA 1OE9B 2EGDA 1G33A 2O60A 3VGOA 1QVIY 2G2BA 2KGRA 1PALA 1F55A 1NSHA 1LA0A 1K95A 2JC2A 1JSAA 1YTZC 1FW4A 1KQVA 4MZJA 4XJKB 1OMDA 2YGUA 5JJGA 1A03A 2KHNA 3EVVA 1BR1B 1SK6D 2PVBA 1LKJA 2HQWA 2LNKA 1QV1A 1WDCB 5ER4X 1JF2A 4N1FA 4NDDA 1CFCA 1GGZA 1SCMB 1RK9A 1IRJA 3DY9A 2ISDA 3FWBA 3O78A 2E30A 2WC8A 3DVJA 3LLEA 1QLSA 2K60A 4P5OE 1FI5A 3GK4X 4DCKA 2L98A 2HF5A 1A75B 2GTEA 3JTDB 3TDZA 1DJGA 1NWDA 3CZ1A 2QEBA 1KCYA 3BUOB 1K9UA 4FQOA 4HRHA 4PE7A 1RJVA 2QEVA 4GUKA 1G8IA 3SIBA 1WLMA 1B8CA 1HT9A 3IF7A 4FQTA 4YGDB 1IG5A 1J7RA 1W7JB 5EL2A 3OX6A 5ER5A 2Q91A 4KYNA 5AEQA 2B1UA 1SKTA 2L2CA 1J1DA 2WORA 3S0GA 1XFWO 2FJYA 2EHBA 2LANA 3D77A 2AUCA 4YGAA 1C07A 2LVIA 1XO5A 1KQMC 4I5KA 1SR6C 1WRZA 3GK1A 5HYDA 2KFGA 4MLWA 2LE9B 4M2PA 2BKIB 4DRWA 1TIZA 2ERBA 2M7LA 3NSKA 4ZCVA 1BODA 1LA3A 1B9AA 2RGIA 5DICA 4PHKA 2JPOA 1NIWA 1C7VA 1MUXA 2WC6A 3CLNA 3ZNIA 1AUIB 1U5IA 1W9ZA 3O4XA 1EG4A 3I5HC 3PN7C 1QX7A 1QASA 4L9MA 1QS7A 4PALA 1NX1A 5BPJA 3DVMA 5FI7A 4ORAB 4AOMA 1IQ3A 2KI6C 1DJXA 3B7AA 4PCWA 3O2PA 1V1GA 3D10A 2CNPA 1B7TY 3LL8B 5CSJA 5B8IB 4GPLB 3AKAA 2WCJA 4GAOA 1NX2A 2G9BA 3K21A 3NGVA 3QMEA 5HLVA 5FYXA 2QEOA 3SG5A 1UHJA 3CWGA 2NCPA 3PLFB 5KU1A 5HKYA 1OW4A 4GGNA 1RFJA 1W7IB 2KFFA 1EH2A 3E3RA 2ZN9A 1B4CA 1RECA 1T14A 1EJ3A 2ZKMX 1Y1AA 2NLNA 1DMOA 5PALA 3KEVA 3L4LA 4OR9B 2AMIA 3ZWHA 2LHIA 3EVUA 3FWCA 1UWOA 1QXPA 3CZ2A 1QJTA 3PFVA 1PK0D 2FJUB 3EG5B 2ZRSA 3MSEB 3R72A 1YRTB 2LLUA 2K7BA 2MHHA 2PSRA 1NX3A 1RWYA 2KQ6A 3TDUA 2M9GA 3C1VA 1NUBA 1UP5A 2OTGB 4MZLA 5JOLA 1JFJA 2F3ZA 3EKJA 1LVCD 2HPSA 2LM5A 4HRGA 2MJWB 2LP3A 1TN4A 4JD9A 4E68A 1S5GZ 1KFXL 3PJIA 5GQQC 1DGVA 2JXCA 2JXLA 2K0JA 1QLKA 3B86A 2KLEA 2OS8B 3NHIA 2I94A 4NDBA 2KYCA 4PDZA 1IKUA 1BLQA 2PASA 4A4BA 2L2EA 5D3OA 1QIWA 1D1OA 1HQVA 3CR5X 3S0BA 2BNXA 3JVTC 3S0EA 3PM2A 4OVNF 1YUTA 4GFTA 3WHUB 1FPWA 3D75A 1DJYA 3DYEA 2M8UA 4OCIA 2BE6A 3VRPA 1DVIA 1SYMA 1OOJA 1BF5A 1TNPA 2LVJA 2V53A 1TCFA 3OHMB 2OPOA 1NCZA 1SL7A 2Y1MA 1AVSA 5J3XA 5CPVA 3BUWB 2O5GA 1JF0A 1KK8B 2KI4B 1B8LA 3TZ1A 2KAYA 4I5LB 1E8AA 2CXJA 2ZRTA 5KTYA 3WNXB 1F4QA 1AHRA 1B8RA 2PMYA 3CR2A 1MF8B 1JBAA 3FIAA 1Y0VH 1M39A 1DT7B 2BECA 3BJHA 3L4AA 4N1GA 3TUYB 1BOCA 2JZIA 3BOWA 2KBMA 1IH0A 3HCMA 2KI6D 3VRNA 3DD4A 4IL1A 1MQ1A 2WCHA 1YR5A 4YGCB 2JWWA 2FCEA 2LLTA 5HKZA 4QJ5B 1IWQA 1QIVA 2L4HA 2WCLA 3PALA 3PATA 4YI9A 3TS5B 2WNDA 4WQ2A 1TNQA 2GGMA 4JPZB 5I2LA 1H4BA 5CSFA 2QACA 3I5FB 5I2OA 1XK4A 4CFRA 2MLFC 1NYAA 4CFQA 1CMGA 1TNWA 3O4YA 3HX4A 1XK4C 2BCAA 2ZN8A 3OB2B 1K9KA 2H61A 2WCEA 1M45A 1IJ5A 3SG6A 1DTLA 1QX2A 1R2UA 4WQ3A 1UHHA 4INWA 4U8DA 4A4CA 2JULA 5G08A 2H61C 3VB1A 1Z2CB 2FCDA 4D1EA 4PE4A 4F0ZB 1KK7Y 2BE4A 1UHNA 2VRGA 1KWOC 2NZ0A 2M3WA 3OP0A 1QX5B 1KFXS 1Y6WA 3PM8A 1F8HA 3ICBA 2EC6B 1CDNA 2JT8A 2JNXA 2CBLA 3RM1A 3IVTA 2FOTA 4YRUA 1SPYA 1AJ5A 3SIAA 3KF9A 1OSAA 4ORCB 4OKHA 3SG3A 1C3YA 4JKTA 1SCVA 3EK8A 1WY9A 1BR4B 5TNCA 3TDIA 1TTXA 3SJSA 2LUCA 3GOFA 4I5JA 1K93D 1K2HA 1MXLC 3QRXA 1PULA 3BQ3A 3NXAA 1ORGA 1GM0A 1PSBA 1FBVA 1RROA 4PT1A 3M0WA 2GV5A 1TUJA 2PYQA 1YRUB 2OS8C 1NX0A 3B88A 3CGAA 3CS1A 1BJFA 1SL8A 3CABA 3D76A 1AP4A 4I5NB 4NDCA 1BG1A 1XFVO 1QVIZ 3VRQA 1MR8A 1LINA 1TWOA 2SCPA 1YVLA 2F8PA 2SASA 4FTGA 4GNKB 1L2OB 5DKQA 1AK8A 1OOGA 2CTNA 3EVRA 3L47A 3O6BA 1ZOTB 4ZCUA 1J7QA 2L5XB 1M31A 1DF0B 3OX5A 2CT9A 3UO9A 4DUQA 2KNEA 2JPTA 2WCMA 1KFUS 1OMRA 1L7ZA 4ICBA 2LCPA 5DKNA 1K8UA 2PALA 3V2LA 5AANA 1VRKA 1DC1A 3R1OA 3SS5A 1CLBA 2LV7A 2QDIA 2IS9A 1S1EA 2LLSA 2P71A 1J7PA 2Y4QA 2KFHA 2BAPA 1Y1XA 1SW8A 1S6IA 3BUMB 2WCFA 2K61A 4XJKA 2H8VA 2MBXA 1KQMB 2P70A 2JU0A 1SR6B 4AQIA 4CPVA 1ALVA 2K7CA 2KYFA 4OV2A 1BT6A 3IQOA 2TN4A 5HL1A 2WCBA 2M1KB 1OZOA 3NSIA 1IJ6A 1KSOA 3D78A 4MN0A 2ZFDA 1OQPA 1TRFA 1SL9A 1DJZA 2BKHB 1Z4HA 3AAJA 2JT3A 3FS7A 1UURA 2KPHA 4UPGA 3I5HB 1WDCC 1K96A 3H4SE 3PN7B 4AQJA 1FI6A 3DXLA 1NCYA 3OB1B 1CFFA 1U5IB 2KOTA 1SCMC 1ZUZA 4MEWA 2F3YA 1A75A 4ORBB 1CKKA 2A4JA 1IGVA 3BUNB 1DGUA 4CLNA 1BMOA 3KO0A 4M2QA 3S0FA 2KAVA 2L4IA 3I5FC 3JTDC 4PHJA 4QJ3B 3PSRA 2LHLA 4ETOA 3KPXA 2F2OA 2M7NA 2M49B 1N0YA 2CCMA 1CFDA 1SNLA 4MRXA 3Q8IA 3NSOA 1UHKA 5AERA 3DVKA 2AAOA 1F54A 3R1VA 3I5IB 1KFUL 2P6BB 2M29A 1KSMA 1WRLA 5CSIA 1DQEA 2Y1NA 2K2AA 4YI8A 3SS4A 1DJIA 2PQLA 2BL0B 4R1EA 3S0AA 1LS8A 1TUZA 2WCKA 1B7TZ 4WRIA 1SMGA 1CB1A 2COLB 4JWQA 3SS3A 2DOQA 1J1EA 1P28A 1F71A 2LAPA 3B87A 3WXAA 2LMUA 2L0PA 3GK2A 3OGNA 2L5YA 1BU3A 5D7FA 2K7DA 1MXEA 3DZTA 1H8BA 3JVTB 5AFPA 1JUOA 2MA2A 1MWNA 3RLZA 2JTTA 3OBVA 1EXRA 1SBJA 1FF1A 4MZKA 3FE6A 2H2KA 1Y1UA 2L50A 1B47A 5FI6A 3BFHA 3BUXB 1UHIA 3I5GB 2KDHA 4YGEB 1SY9A 2D8NA 3VROA 1CNPA 1XVJA 4CIDA 4JQ0D 1S5GY 2I2RE 3AKBA 1QV0A 3DF0B 5I8NA 3D0YB 1PRWA 3R1PA 1DF0A 1L2OC 1CTRA 2E6WA 2HETA 1S26D 2ZNEA 3RZSA 3EK4A 1B1GA 4GGFA 1N65A 2KAXA 1NPQA 5KSZA 1QWVA 2KLDA 1XFRA 1M63B 2M0RA 5CSNA 3WHTB 4DS7A 1CFPA 2MLEC 2JRFA 4GGFC 4YBHB 1K90D 1ZFSA 3AAKA 1TNXA 3EKHA 3CZTX 1SSEB 4MVFA 5DKRA 1EL4A 1N2DA 5F6TA 1A29A 4PE0A 2OTGC 2PRUA 2JOJA 4C0JA 4HREE 1S6JA 2MRDA 2KQYA 1YUUA 2LP2A 1JWDA 1ODBA 3UNWA 1K9PA 3D74A 2I18A 4NQGA 3BOWB 2M1UA 3S0DA 1IQ5A 4F7FA 1ZMZA 1PVAA 2WC5A 1OOFA 4MRYA 1Q80A 3A4UB 3CDNA 3F45A 4QJ4B 3FE9A 1DELA 1OOIX 2I7AA 1EG3A 1GGWA 1OZSA 2MAZA 4YGBB 1TOPA 4M2OA 4INXA 2GGZA 1CLMA 1NP8A 1DJWA 1YX7A 2K7OA 1F4OA 1CM4A 2LUXA 4MSPA 4TNCA 2LVKA 4C0LA 3CYZA 3LK0A 1A2XA 1J7OA 1XFZO 3NHTA 1YX8A 2Y5IA 1UUSA 2NCOA 3LK1A 4PHNA 2L51A 2BCBA 2K2FA 5HKWA 4USLA 3CZ0A 2KSPA 1SRAA 3BYAA 2JTZA 2Q4UA 1DEKA 1ZACA 2BBNA 4P2YB 1KK8C 1V1FA 1X02A 2KI4C 1JFKA 2LVVA 5D69A 1KWOB 5I2QA 5IBWA 2QPTA 1XFYO 2F33A 2JNFA 2BCXA 4BY4A 1PVBA 1OMVA 4XYNA 1AJ4A 3BFBA 3NSLA 2KGBC 1OOHA 3BXKA 3FE8A 4HSZA 1WLZA 3I5IC 5K89A 1MHOA 1S3PA 1J55A 1XFXO 1CDMA 1XA5A 2LMTA 3CTNA 3TUYC 1TCOB 4MBEA 2BL0C 1ALWA 2ZNDA 3CR4X 2F2PA 4BY5A 3IQQA 1CDLA 1GQMA 3B6XA 1A4PA 4PE1A 1JC2A 2LMVA 4GBAA 2R2IA 3K1EA 1S6CA 1CLLA 1KK7Z 4PHMA 3EK7A 1XFUO 3TS5C 4C0KA 4N5XA 1LXFC 1PSRA 1XYDA 3N7HA 3SG4A 4Q04A 1YVHA 2LC5A 3DVEA 5HLOA 3SG2A 4DIRA 1CDPA 5AXIA 3A8RA 1GJYA 1RTP1 4IJ7A 4OZDA 1K94A 2BBMA 2WOSA 1CMFA 3LCPC 1QTXA 2K8MB 1S36A 5I94A 1WRKA 3SG7A 1IIOA 2M97A 1C7WA 3D73A 3DF0A 3D0YA 1C3ZA 1DJHA 3I5GC 2QEHA 3KHEA 1F70A 1G4YR 2KBIA 2NXQA 1M46A 3VRRA
chains in the Genus database with same CATH topology
2HQ8A 1QATA 1YURA 2JQ6A 1CM1A 1NCXA 1R6PA 2EC6C 2JT0A 1YUSA 1OE9B 2EGDA 1G33A 2O60A 3VGOA 1QVIY 2G2BA 2KGRA 1PALA 1F55A 1NSHA 1LA0A 1K95A 2JC2A 1JSAA 1YTZC 1FW4A 1KQVA 4MZJA 4XJKB 1OMDA 5JJGA 1A03A 2KHNA 3EVVA 1BR1B 1SK6D 2PVBA 1LKJA 2HQWA 2LNKA 1QV1A 1WDCB 5ER4X 1JF2A 4N1FA 4NDDA 1CFCA 1GGZA 1SCMB 1RK9A 1IRJA 2ISDA 3FWBA 3O78A 2E30A 2WC8A 3DVJA 3LLEA 1QLSA 4P5OE 1FI5A 3GK4X 4DCKA 2L98A 2HF5A 1A75B 3JTDB 3TDZA 1DJGA 1NWDA 1KCYA 3BUOB 1K9UA 4FQOA 4HRHA 4PE7A 1RJVA 4GUKA 1G8IA 3SIBA 1WLMA 1B8CA 1HT9A 3IF7A 4YGDB 1IG5A 1J7RA 1W7JB 3OX6A 5ER5A 2Q91A 5AEQA 2B1UA 1SKTA 2WORA 1J1DA 1XFWO 2LANA 2EHBA 1C07A 2AUCA 4YGAA 2LVIA 1XO5A 1KQMC 4I5KA 1SR6C 1WRZA 3GK1A 5HYDA 2KFGA 4MLWA 2LE9B 4M2PA 2BKIB 4DRWA 1TIZA 2M7LA 3NSKA 4ZCVA 1BODA 1LA3A 1B9AA 2RGIA 4PHKA 1NIWA 1C7VA 1MUXA 3CLNA 3ZNIA 1AUIB 1U5IA 1EG4A 3I5HC 3PN7C 1QX7A 1QASA 4L9MA 1QS7A 4PALA 1NX1A 5BPJA 3DVMA 1IQ3A 4ORAB 4AOMA 2KI6C 1DJXA 4PCWA 3O2PA 1V1GA 3D10A 2CNPA 1B7TY 3LL8B 5CSJA 5B8IB 4GPLB 3AKAA 4GAOA 1NX2A 2G9BA 3K21A 5HLVA 5FYXA 3SG5A 1UHJA 3CWGA 2NCPA 3PLFB 5KU1A 5HKYA 4GGNA 1RFJA 1W7IB 2KFFA 1EH2A 3E3RA 2ZN9A 1B4CA 1RECA 1EJ3A 2ZKMX 1Y1AA 2NLNA 1DMOA 5PALA 3KEVA 4OR9B 2AMIA 3ZWHA 2LHIA 3EVUA 3FWCA 1UWOA 1QXPA 1QJTA 3PFVA 1PK0D 2FJUB 2ZRSA 3MSEB 1YRTB 2LLUA 2K7BA 2MHHA 2PSRA 1NX3A 1RWYA 2KQ6A 3TDUA 2M9GA 3C1VA 1NUBA 1UP5A 2OTGB 4MZLA 5JOLA 1JFJA 2F3ZA 3EKJA 1LVCD 2HPSA 2LM5A 4HRGA 2MJWB 2LP3A 1TN4A 4E68A 1S5GZ 1KFXL 5GQQC 1DGVA 2JXCA 2JXLA 2K0JA 1QLKA 2OS8B 4NDBA 2I94A 2KYCA 4PDZA 1IKUA 1BLQA 2PASA 4A4BA 2L2EA 1QIWA 1D1OA 1HQVA 3CR5X 3JVTC 4OVNF 1YUTA 4GFTA 3WHUB 1FPWA 1DJYA 2M8UA 4OCIA 2BE6A 3VRPA 1DVIA 1SYMA 1OOJA 1BF5A 1TNPA 2LVJA 2V53A 1TCFA 3OHMB 2OPOA 1NCZA 1SL7A 2Y1MA 1AVSA 5J3XA 5CPVA 3BUWB 2O5GA 1JF0A 1KK8B 2KI4B 1B8LA 3TZ1A 2KAYA 4I5LB 1E8AA 2CXJA 2ZRTA 5KTYA 3WNXB 1F4QA 1AHRA 1B8RA 2PMYA 3CR2A 1MF8B 1JBAA 3FIAA 1Y0VH 1M39A 1DT7B 2BECA 4N1GA 3TUYB 1BOCA 2JZIA 3BOWA 2KBMA 1IH0A 3HCMA 2KI6D 3VRNA 3DD4A 4IL1A 1MQ1A 4YGCB 1YR5A 2JWWA 2FCEA 2LLTA 5HKZA 4QJ5B 1IWQA 1QIVA 2L4HA 3PALA 3PATA 4YI9A 3TS5B 2WNDA 4WQ2A 1TNQA 2GGMA 4JPZB 5I2LA 5CSFA 2QACA 3I5FB 5I2OA 1XK4A 4CFRA 2MLFC 1NYAA 4CFQA 1CMGA 1TNWA 3O4YA 3HX4A 1XK4C 2BCAA 2ZN8A 3OB2B 1K9KA 2H61A 2WCEA 1M45A 1IJ5A 3SG6A 1DTLA 1QX2A 1R2UA 4WQ3A 1UHHA 4U8DA 4A4CA 2JULA 5G08A 2H61C 2FCDA 4D1EA 4PE4A 4F0ZB 1KK7Y 2BE4A 1UHNA 2VRGA 1KWOC 2NZ0A 2M3WA 3OP0A 1QX5B 1KFXS 1Y6WA 3PM8A 1F8HA 3ICBA 2EC6B 1CDNA 2JT8A 2JNXA 2CBLA 3RM1A 2FOTA 4YRUA 1SPYA 1AJ5A 3SIAA 3KF9A 1OSAA 4ORCB 4OKHA 3SG3A 1SCVA 3EK8A 1WY9A 1BR4B 5TNCA 3TDIA 1TTXA 3SJSA 2LUCA 3GOFA 4I5JA 1K93D 1K2HA 1MXLC 3QRXA 1PULA 3BQ3A 3NXAA 1PSBA 1FBVA 1RROA 3M0WA 2GV5A 1YRUB 2OS8C 1NX0A 3CGAA 3CS1A 1BJFA 1SL8A 1AP4A 4I5NB 4NDCA 1BG1A 1XFVO 1QVIZ 3VRQA 1MR8A 1LINA 2SCPA 2SASA 1YVLA 2F8PA 4FTGA 5DKQA 4GNKB 1L2OB 1AK8A 1H4BA 2CTNA 3EVRA 4ZCUA 3O6BA 1ZOTB 1J7QA 2L5XB 1M31A 1DF0B 3OX5A 2CT9A 4DUQA 2KNEA 2JPTA 4ICBA 1KFUS 1OMRA 1L7ZA 5DKNA 2LCPA 1K8UA 2PALA 5AANA 1VRKA 1CLBA 2LV7A 2IS9A 1S1EA 2LLSA 1J7PA 2Y4QA 2KFHA 1Y1XA 1SW8A 1S6IA 3BUMB 2WCFA 2K61A 4XJKA 2MBXA 1KQMB 4AQIA 2JU0A 1SR6B 4CPVA 1ALVA 2K7CA 2KYFA 4OV2A 1BT6A 3IQOA 2TN4A 2WCBA 2M1KB 1OZOA 3NSIA 1IJ6A 1KSOA 4MN0A 2ZFDA 1OQPA 1TRFA 1SL9A 1DJZA 2BKHB 3AAJA 2JT3A 3FS7A 1UURA 4UPGA 3I5HB 1WDCC 1K96A 3H4SE 3PN7B 4AQJA 1FI6A 1NCYA 3OB1B 1CFFA 1U5IB 2KOTA 1SCMC 1ZUZA 4MEWA 2F3YA 1A75A 4ORBB 1CKKA 2A4JA 1IGVA 3BUNB 1DGUA 4CLNA 1BMOA 3KO0A 4M2QA 2KAVA 2L4IA 3I5FC 3JTDC 4PHJA 4QJ3B 3PSRA 2LHLA 4ETOA 3KPXA 2F2OA 2M7NA 2M49B 1N0YA 2CCMA 1CFDA 1SNLA 4MRXA 3NSOA 1UHKA 5AERA 3DVKA 2AAOA 1F54A 3I5IB 1KFUL 2P6BB 2M29A 1KSMA 1WRLA 5CSIA 2Y1NA 2K2AA 4YI8A 1DJIA 4R1EA 2BL0B 1B7TZ 4WRIA 1SMGA 1CB1A 2COLB 4JWQA 2DOQA 1J1EA 1F71A 2LAPA 3WXAA 2LMUA 2L0PA 3GK2A 1BU3A 5D7FA 2K7DA 1MXEA 1H8BA 3JVTB 5AFPA 1JUOA 2MA2A 1MWNA 3RLZA 2JTTA 1EXRA 1SBJA 1FF1A 4MZKA 2H2KA 1Y1UA 2L50A 1B47A 3BUXB 3I5GB 1UHIA 4YGEB 2KDHA 1SY9A 2D8NA 3VROA 1CNPA 1XVJA 4CIDA 4JQ0D 1S5GY 2I2RE 3AKBA 1QV0A 3DF0B 5I8NA 3D0YB 1PRWA 1DF0A 1L2OC 1CTRA 2E6WA 2HETA 1S26D 2ZNEA 3EK4A 1B1GA 4GGFA 1N65A 2KAXA 1NPQA 5KSZA 5CSNA 2M0RA 3WHTB 1M63B 4DS7A 1CFPA 2MLEC 2JRFA 4GGFC 4YBHB 1K90D 1ZFSA 3AAKA 1TNXA 3EKHA 3CZTX 4MVFA 5DKRA 1EL4A 1N2DA 5F6TA 1A29A 4PE0A 2OTGC 2PRUA 2JOJA 4C0JA 4HREE 1S6JA 2MRDA 2KQYA 1YUUA 2LP2A 1JWDA 1ODBA 1K9PA 2I18A 4NQGA 3BOWB 2M1UA 1IQ5A 1ZMZA 1PVAA 4MRYA 1Q80A 3A4UB 3F45A 4QJ4B 2I7AA 1EG3A 1GGWA 1OZSA 2MAZA 4YGBB 1TOPA 4M2OA 2GGZA 1CLMA 1NP8A 1DJWA 1YX7A 2K7OA 1F4OA 1CM4A 2LUXA 4MSPA 4TNCA 2LVKA 4C0LA 3LK0A 1A2XA 1J7OA 1XFZO 1YX8A 2Y5IA 1UUSA 2NCOA 3LK1A 4PHNA 2L51A 2BCBA 2K2FA 5HKWA 4USLA 2KSPA 1SRAA 3BYAA 2JTZA 2Q4UA 1ZACA 2BBNA 4P2YB 1KK8C 1V1FA 1X02A 2KI4C 1JFKA 2LVVA 5D69A 1KWOB 5I2QA 5IBWA 2QPTA 1XFYO 2F33A 2JNFA 2BCXA 4BY4A 1PVBA 1OMVA 4XYNA 1AJ4A 3NSLA 2KGBC 3BXKA 4HSZA 5K89A 1WLZA 3I5IC 1MHOA 1S3PA 1J55A 1XFXO 1CDMA 1XA5A 2LMTA 3CTNA 3TUYC 1TCOB 4MBEA 2BL0C 1ALWA 2ZNDA 3CR4X 2F2PA 4BY5A 3IQQA 1CDLA 1GQMA 4PE1A 1A4PA 1JC2A 2LMVA 4GBAA 2R2IA 1S6CA 1CLLA 1KK7Z 4PHMA 3EK7A 1XFUO 3TS5C 4C0KA 4N5XA 1LXFC 1PSRA 1XYDA 3SG4A 4Q04A 1YVHA 2LC5A 3DVEA 5HLOA 3SG2A 4DIRA 1CDPA 5AXIA 3A8RA 1GJYA 1RTP1 1K94A 2BBMA 2WOSA 1CMFA 3LCPC 1QTXA 2K8MB 1S36A 1WRKA 3SG7A 2M97A 1C7WA 3DF0A 3D0YA 1DJHA 1F70A 3I5GC 3KHEA 1G4YR 2KBIA 2NXQA 1M46A 3VRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQ8 A;  1QAT A;  1YUR A;  2JQ6 A;  1CM1 A;  1NCX A;  1R6P A;  2EC6 C;  2JT0 A;  1YUS A;  1OE9 B;  2EGD A;  1G33 A;  2O60 A;  3VGO A;  1QVI Y;  2G2B A;  2KGR A;  1PAL A;  1F55 A;  1NSH A;  1LA0 A;  1K95 A;  2JC2 A;  1JSA A;  1YTZ C;  1FW4 A;  1KQV A;  4MZJ A;  4XJK B;  1OMD A;  5JJG A;  1A03 A;  2KHN A;  3EVV A;  1BR1 B;  1SK6 D;  2PVB A;  1LKJ A;  2HQW A;  2LNK A;  1QV1 A;  1WDC B;  5ER4 X;  1JF2 A;  4N1F A;  4NDD A;  1CFC A;  1GGZ A;  1SCM B;  1RK9 A;  1IRJ A;  2ISD A;  3FWB A;  3O78 A;  2E30 A;  2WC8 A;  3DVJ A;  3LLE A;  1QLS A;  4P5O E;  1FI5 A;  3GK4 X;  4DCK A;  2L98 A;  2HF5 A;  1A75 B;  3JTD B;  3TDZ A;  1DJG A;  1NWD A;  1KCY A;  3BUO B;  1K9U A;  4FQO A;  4HRH A;  4PE7 A;  1RJV A;  4GUK A;  1G8I A;  3SIB A;  1WLM A;  1B8C A;  1HT9 A;  3IF7 A;  4YGD B;  1IG5 A;  1J7R A;  1W7J B;  3OX6 A;  5ER5 A;  2Q91 A;  5AEQ A;  2B1U A;  1SKT A;  2WOR A;  1J1D A;  1XFW O;  2LAN A;  2EHB A;  1C07 A;  2AUC A;  4YGA A;  2LVI A;  1XO5 A;  1KQM C;  4I5K A;  1SR6 C;  1WRZ A;  3GK1 A;  5HYD A;  2KFG A;  4MLW A;  2LE9 B;  4M2P A;  2BKI B;  4DRW A;  1TIZ A;  2M7L A;  3NSK A;  4ZCV A;  1BOD A;  1LA3 A;  1B9A A;  2RGI A;  4PHK A;  1NIW A;  1C7V A;  1MUX A;  3CLN A;  3ZNI A;  1AUI B;  1U5I A;  1EG4 A;  3I5H C;  3PN7 C;  1QX7 A;  1QAS A;  4L9M A;  1QS7 A;  4PAL A;  1NX1 A;  5BPJ A;  3DVM A;  1IQ3 A;  4ORA B;  4AOM A;  2KI6 C;  1DJX A;  4PCW A;  3O2P A;  1V1G A;  3D10 A;  2CNP A;  1B7T Y;  3LL8 B;  5CSJ A;  5B8I B;  4GPL B;  3AKA A;  4GAO A;  1NX2 A;  2G9B A;  3K21 A;  5HLV A;  5FYX A;  3SG5 A;  1UHJ A;  3CWG A;  2NCP A;  3PLF B;  5KU1 A;  5HKY A;  4GGN A;  1RFJ A;  1W7I B;  2KFF A;  1EH2 A;  3E3R A;  2ZN9 A;  1B4C A;  1REC A;  1EJ3 A;  2ZKM X;  1Y1A A;  2NLN A;  1DMO A;  5PAL A;  3KEV A;  4OR9 B;  2AMI A;  3ZWH A;  2LHI A;  3EVU A;  3FWC A;  1UWO A;  1QXP A;  1QJT A;  3PFV A;  1PK0 D;  2FJU B;  2ZRS A;  3MSE B;  1YRT B;  2LLU A;  2K7B A;  2MHH A;  2PSR A;  1NX3 A;  1RWY A;  2KQ6 A;  3TDU A;  2M9G A;  3C1V A;  1NUB A;  1UP5 A;  2OTG B;  4MZL A;  5JOL A;  1JFJ A;  2F3Z A;  3EKJ A;  1LVC D;  2HPS A;  2LM5 A;  4HRG A;  2MJW B;  2LP3 A;  1TN4 A;  4E68 A;  1S5G Z;  1KFX L;  5GQQ C;  1DGV A;  2JXC A;  2JXL A;  2K0J A;  1QLK A;  2OS8 B;  4NDB A;  2I94 A;  2KYC A;  4PDZ A;  1IKU A;  1BLQ A;  2PAS A;  4A4B A;  2L2E A;  1QIW A;  1D1O A;  1HQV A;  3CR5 X;  3JVT C;  4OVN F;  1YUT A;  4GFT A;  3WHU B;  1FPW A;  1DJY A;  2M8U A;  4OCI A;  2BE6 A;  3VRP A;  1DVI A;  1SYM A;  1OOJ A;  1BF5 A;  1TNP A;  2LVJ A;  2V53 A;  1TCF A;  3OHM B;  2OPO A;  1NCZ A;  1SL7 A;  2Y1M A;  1AVS A;  5J3X A;  5CPV A;  3BUW B;  2O5G A;  1JF0 A;  1KK8 B;  2KI4 B;  1B8L A;  3TZ1 A;  2KAY A;  4I5L B;  1E8A A;  2CXJ A;  2ZRT A;  5KTY A;  3WNX B;  1F4Q A;  1AHR A;  1B8R A;  2PMY A;  3CR2 A;  1MF8 B;  1JBA A;  3FIA A;  1Y0V H;  1M39 A;  1DT7 B;  2BEC A;  4N1G A;  3TUY B;  1BOC A;  2JZI A;  3BOW A;  2KBM A;  1IH0 A;  3HCM A;  2KI6 D;  3VRN A;  3DD4 A;  4IL1 A;  1MQ1 A;  4YGC B;  1YR5 A;  2JWW A;  2FCE A;  2LLT A;  5HKZ A;  4QJ5 B;  1IWQ A;  1QIV A;  2L4H A;  3PAL A;  3PAT A;  4YI9 A;  3TS5 B;  2WND A;  4WQ2 A;  1TNQ A;  2GGM A;  4JPZ B;  5I2L A;  5CSF A;  2QAC A;  3I5F B;  5I2O A;  1XK4 A;  4CFR A;  2MLF C;  1NYA A;  4CFQ A;  1CMG A;  1TNW A;  3O4Y A;  3HX4 A;  1XK4 C;  2BCA A;  2ZN8 A;  3OB2 B;  1K9K A;  2H61 A;  2WCE A;  1M45 A;  1IJ5 A;  3SG6 A;  1DTL A;  1QX2 A;  1R2U A;  4WQ3 A;  1UHH A;  4U8D A;  4A4C A;  2JUL A;  5G08 A;  2H61 C;  2FCD A;  4D1E A;  4PE4 A;  4F0Z B;  1KK7 Y;  2BE4 A;  1UHN A;  2VRG A;  1KWO C;  2NZ0 A;  2M3W A;  3OP0 A;  1QX5 B;  1KFX S;  1Y6W A;  3PM8 A;  1F8H A;  3ICB A;  2EC6 B;  1CDN A;  2JT8 A;  2JNX A;  2CBL A;  3RM1 A;  2FOT A;  4YRU A;  1SPY A;  1AJ5 A;  3SIA A;  3KF9 A;  1OSA A;  4ORC B;  4OKH A;  3SG3 A;  1SCV A;  3EK8 A;  1WY9 A;  1BR4 B;  5TNC A;  3TDI A;  1TTX A;  3SJS A;  2LUC A;  3GOF A;  4I5J A;  1K93 D;  1K2H A;  1MXL C;  3QRX A;  1PUL A;  3BQ3 A;  3NXA A;  1PSB A;  1FBV A;  1RRO A;  3M0W A;  2GV5 A;  1YRU B;  2OS8 C;  1NX0 A;  3CGA A;  3CS1 A;  1BJF A;  1SL8 A;  1AP4 A;  4I5N B;  4NDC A;  1BG1 A;  1XFV O;  1QVI Z;  3VRQ A;  1MR8 A;  1LIN A;  2SCP A;  2SAS A;  1YVL A;  2F8P A;  4FTG A;  5DKQ A;  4GNK B;  1L2O B;  1AK8 A;  1H4B A;  2CTN A;  3EVR A;  4ZCU A;  3O6B A;  1ZOT B;  1J7Q A;  2L5X B;  1M31 A;  1DF0 B;  3OX5 A;  2CT9 A;  4DUQ A;  2KNE A;  2JPT A;  4ICB A;  1KFU S;  1OMR A;  1L7Z A;  5DKN A;  2LCP A;  1K8U A;  2PAL A;  5AAN A;  1VRK A;  1CLB A;  2LV7 A;  2IS9 A;  1S1E A;  2LLS A;  1J7P A;  2Y4Q A;  2KFH A;  1Y1X A;  1SW8 A;  1S6I A;  3BUM B;  2WCF A;  2K61 A;  4XJK A;  2MBX A;  1KQM B;  4AQI A;  2JU0 A;  1SR6 B;  4CPV A;  1ALV A;  2K7C A;  2KYF A;  4OV2 A;  1BT6 A;  3IQO A;  2TN4 A;  2WCB A;  2M1K B;  1OZO A;  3NSI A;  1IJ6 A;  1KSO A;  4MN0 A;  2ZFD A;  1OQP A;  1TRF A;  1SL9 A;  1DJZ A;  2BKH B;  3AAJ A;  2JT3 A;  3FS7 A;  1UUR A;  4UPG A;  3I5H B;  1WDC C;  1K96 A;  3H4S E;  3PN7 B;  4AQJ A;  1FI6 A;  1NCY A;  3OB1 B;  1CFF A;  1U5I B;  2KOT A;  1SCM C;  1ZUZ A;  4MEW A;  2F3Y A;  1A75 A;  4ORB B;  1CKK A;  2A4J A;  1IGV A;  3BUN B;  1DGU A;  4CLN A;  1BMO A;  3KO0 A;  4M2Q A;  2KAV A;  2L4I A;  3I5F C;  3JTD C;  4PHJ A;  4QJ3 B;  3PSR A;  2LHL A;  4ETO A;  3KPX A;  2F2O A;  2M7N A;  2M49 B;  1N0Y A;  2CCM A;  1CFD A;  1SNL A;  4MRX A;  3NSO A;  1UHK A;  5AER A;  3DVK A;  2AAO A;  1F54 A;  3I5I B;  1KFU L;  2P6B B;  2M29 A;  1KSM A;  1WRL A;  5CSI A;  2Y1N A;  2K2A A;  4YI8 A;  1DJI A;  4R1E A;  2BL0 B;  1B7T Z;  4WRI A;  1SMG A;  1CB1 A;  2COL B;  4JWQ A;  2DOQ A;  1J1E A;  1F71 A;  2LAP A;  3WXA A;  2LMU A;  2L0P A;  3GK2 A;  1BU3 A;  5D7F A;  2K7D A;  1MXE A;  1H8B A;  3JVT B;  5AFP A;  1JUO A;  2MA2 A;  1MWN A;  3RLZ A;  2JTT A;  1EXR A;  1SBJ A;  1FF1 A;  4MZK A;  2H2K A;  1Y1U A;  2L50 A;  1B47 A;  3BUX B;  3I5G B;  1UHI A;  4YGE B;  2KDH A;  1SY9 A;  2D8N A;  3VRO A;  1CNP A;  1XVJ A;  4CID A;  4JQ0 D;  1S5G Y;  2I2R E;  3AKB A;  1QV0 A;  3DF0 B;  5I8N A;  3D0Y B;  1PRW A;  1DF0 A;  1L2O C;  1CTR A;  2E6W A;  2HET A;  1S26 D;  2ZNE A;  3EK4 A;  1B1G A;  4GGF A;  1N65 A;  2KAX A;  1NPQ A;  5KSZ A;  5CSN A;  2M0R A;  3WHT B;  1M63 B;  4DS7 A;  1CFP A;  2MLE C;  2JRF A;  4GGF C;  4YBH B;  1K90 D;  1ZFS A;  3AAK A;  1TNX A;  3EKH A;  3CZT X;  4MVF A;  5DKR A;  1EL4 A;  1N2D A;  5F6T A;  1A29 A;  4PE0 A;  2OTG C;  2PRU A;  2JOJ A;  4C0J A;  4HRE E;  1S6J A;  2MRD A;  2KQY A;  1YUU A;  2LP2 A;  1JWD A;  1ODB A;  1K9P A;  2I18 A;  4NQG A;  3BOW B;  2M1U A;  1IQ5 A;  1ZMZ A;  1PVA A;  4MRY A;  1Q80 A;  3A4U B;  3F45 A;  4QJ4 B;  2I7A A;  1EG3 A;  1GGW A;  1OZS A;  2MAZ A;  4YGB B;  1TOP A;  4M2O A;  2GGZ A;  1CLM A;  1NP8 A;  1DJW A;  1YX7 A;  2K7O A;  1F4O A;  1CM4 A;  2LUX A;  4MSP A;  4TNC A;  2LVK A;  4C0L A;  3LK0 A;  1A2X A;  1J7O A;  1XFZ O;  1YX8 A;  2Y5I A;  1UUS A;  2NCO A;  3LK1 A;  4PHN A;  2L51 A;  2BCB A;  2K2F A;  5HKW A;  4USL A;  2KSP A;  1SRA A;  3BYA A;  2JTZ A;  2Q4U A;  1ZAC A;  2BBN A;  4P2Y B;  1KK8 C;  1V1F A;  1X02 A;  2KI4 C;  1JFK A;  2LVV A;  5D69 A;  1KWO B;  5I2Q A;  5IBW A;  2QPT A;  1XFY O;  2F33 A;  2JNF A;  2BCX A;  4BY4 A;  1PVB A;  1OMV A;  4XYN A;  1AJ4 A;  3NSL A;  2KGB C;  3BXK A;  4HSZ A;  5K89 A;  1WLZ A;  3I5I C;  1MHO A;  1S3P A;  1J55 A;  1XFX O;  1CDM A;  1XA5 A;  2LMT A;  3CTN A;  3TUY C;  1TCO B;  4MBE A;  2BL0 C;  1ALW A;  2ZND A;  3CR4 X;  2F2P A;  4BY5 A;  3IQQ A;  1CDL A;  1GQM A;  4PE1 A;  1A4P A;  1JC2 A;  2LMV A;  4GBA A;  2R2I A;  1S6C A;  1CLL A;  1KK7 Z;  4PHM A;  3EK7 A;  1XFU O;  3TS5 C;  4C0K A;  4N5X A;  1LXF C;  1PSR A;  1XYD A;  3SG4 A;  4Q04 A;  1YVH A;  2LC5 A;  3DVE A;  5HLO A;  3SG2 A;  4DIR A;  1CDP A;  5AXI A;  3A8R A;  1GJY A;  1RTP 1;  1K94 A;  2BBM A;  2WOS A;  1CMF A;  3LCP C;  1QTX A;  2K8M B;  1S36 A;  1WRK A;  3SG7 A;  2M97 A;  1C7W A;  3DF0 A;  3D0Y A;  1DJH A;  1F70 A;  3I5G C;  3KHE A;  1G4Y R;  2KBI A;  2NXQ A;  1M46 A;  3VRR A; 
#chains in the Genus database with same CATH topology
 2HQ8 A;  1QAT A;  5FI2 A;  1YUR A;  2JQ6 A;  1CM1 A;  1NCX A;  3BFA A;  1R6P A;  2EC6 C;  2JT0 A;  1YUS A;  1OE9 B;  2EGD A;  1G33 A;  2O60 A;  3VGO A;  1QVI Y;  2G2B A;  2KGR A;  1PAL A;  1F55 A;  1NSH A;  1LA0 A;  1K95 A;  2JC2 A;  1JSA A;  1YTZ C;  1FW4 A;  1KQV A;  4MZJ A;  4XJK B;  1OMD A;  2YGU A;  5JJG A;  1A03 A;  2KHN A;  3EVV A;  1BR1 B;  1SK6 D;  2PVB A;  1LKJ A;  2HQW A;  2LNK A;  1QV1 A;  1WDC B;  5ER4 X;  1JF2 A;  4N1F A;  4NDD A;  1CFC A;  1GGZ A;  1SCM B;  1RK9 A;  1IRJ A;  3DY9 A;  2ISD A;  3FWB A;  3O78 A;  2E30 A;  2WC8 A;  3DVJ A;  3LLE A;  1QLS A;  2K60 A;  4P5O E;  1FI5 A;  3GK4 X;  4DCK A;  2L98 A;  2HF5 A;  1A75 B;  2GTE A;  3JTD B;  3TDZ A;  1DJG A;  1NWD A;  3CZ1 A;  2QEB A;  1KCY A;  3BUO B;  1K9U A;  4FQO A;  4HRH A;  4PE7 A;  1RJV A;  2QEV A;  4GUK A;  1G8I A;  3SIB A;  1WLM A;  1B8C A;  1HT9 A;  3IF7 A;  4FQT A;  4YGD B;  1IG5 A;  1J7R A;  1W7J B;  5EL2 A;  3OX6 A;  5ER5 A;  2Q91 A;  4KYN A;  5AEQ A;  2B1U A;  1SKT A;  2L2C A;  1J1D A;  2WOR A;  3S0G A;  1XFW O;  2FJY A;  2EHB A;  2LAN A;  3D77 A;  2AUC A;  4YGA A;  1C07 A;  2LVI A;  1XO5 A;  1KQM C;  4I5K A;  1SR6 C;  1WRZ A;  3GK1 A;  5HYD A;  2KFG A;  4MLW A;  2LE9 B;  4M2P A;  2BKI B;  4DRW A;  1TIZ A;  2ERB A;  2M7L A;  3NSK A;  4ZCV A;  1BOD A;  1LA3 A;  1B9A A;  2RGI A;  5DIC A;  4PHK A;  2JPO A;  1NIW A;  1C7V A;  1MUX A;  2WC6 A;  3CLN A;  3ZNI A;  1AUI B;  1U5I A;  1W9Z A;  3O4X A;  1EG4 A;  3I5H C;  3PN7 C;  1QX7 A;  1QAS A;  4L9M A;  1QS7 A;  4PAL A;  1NX1 A;  5BPJ A;  3DVM A;  5FI7 A;  4ORA B;  4AOM A;  1IQ3 A;  2KI6 C;  1DJX A;  3B7A A;  4PCW A;  3O2P A;  1V1G A;  3D10 A;  2CNP A;  1B7T Y;  3LL8 B;  5CSJ A;  5B8I B;  4GPL B;  3AKA A;  2WCJ A;  4GAO A;  1NX2 A;  2G9B A;  3K21 A;  3NGV A;  3QME A;  5HLV A;  5FYX A;  2QEO A;  3SG5 A;  1UHJ A;  3CWG A;  2NCP A;  3PLF B;  5KU1 A;  5HKY A;  1OW4 A;  4GGN A;  1RFJ A;  1W7I B;  2KFF A;  1EH2 A;  3E3R A;  2ZN9 A;  1B4C A;  1REC A;  1T14 A;  1EJ3 A;  2ZKM X;  1Y1A A;  2NLN A;  1DMO A;  5PAL A;  3KEV A;  3L4L A;  4OR9 B;  2AMI A;  3ZWH A;  2LHI A;  3EVU A;  3FWC A;  1UWO A;  1QXP A;  3CZ2 A;  1QJT A;  3PFV A;  1PK0 D;  2FJU B;  3EG5 B;  2ZRS A;  3MSE B;  3R72 A;  1YRT B;  2LLU A;  2K7B A;  2MHH A;  2PSR A;  1NX3 A;  1RWY A;  2KQ6 A;  3TDU A;  2M9G A;  3C1V A;  1NUB A;  1UP5 A;  2OTG B;  4MZL A;  5JOL A;  1JFJ A;  2F3Z A;  3EKJ A;  1LVC D;  2HPS A;  2LM5 A;  4HRG A;  2MJW B;  2LP3 A;  1TN4 A;  4JD9 A;  4E68 A;  1S5G Z;  1KFX L;  3PJI A;  5GQQ C;  1DGV A;  2JXC A;  2JXL A;  2K0J A;  1QLK A;  3B86 A;  2KLE A;  2OS8 B;  3NHI A;  2I94 A;  4NDB A;  2KYC A;  4PDZ A;  1IKU A;  1BLQ A;  2PAS A;  4A4B A;  2L2E A;  5D3O A;  1QIW A;  1D1O A;  1HQV A;  3CR5 X;  3S0B A;  2BNX A;  3JVT C;  3S0E A;  3PM2 A;  4OVN F;  1YUT A;  4GFT A;  3WHU B;  1FPW A;  3D75 A;  1DJY A;  3DYE A;  2M8U A;  4OCI A;  2BE6 A;  3VRP A;  1DVI A;  1SYM A;  1OOJ A;  1BF5 A;  1TNP A;  2LVJ A;  2V53 A;  1TCF A;  3OHM B;  2OPO A;  1NCZ A;  1SL7 A;  2Y1M A;  1AVS A;  5J3X A;  5CPV A;  3BUW B;  2O5G A;  1JF0 A;  1KK8 B;  2KI4 B;  1B8L A;  3TZ1 A;  2KAY A;  4I5L B;  1E8A A;  2CXJ A;  2ZRT A;  5KTY A;  3WNX B;  1F4Q A;  1AHR A;  1B8R A;  2PMY A;  3CR2 A;  1MF8 B;  1JBA A;  3FIA A;  1Y0V H;  1M39 A;  1DT7 B;  2BEC A;  3BJH A;  3L4A A;  4N1G A;  3TUY B;  1BOC A;  2JZI A;  3BOW A;  2KBM A;  1IH0 A;  3HCM A;  2KI6 D;  3VRN A;  3DD4 A;  4IL1 A;  1MQ1 A;  2WCH A;  1YR5 A;  4YGC B;  2JWW A;  2FCE A;  2LLT A;  5HKZ A;  4QJ5 B;  1IWQ A;  1QIV A;  2L4H A;  2WCL A;  3PAL A;  3PAT A;  4YI9 A;  3TS5 B;  2WND A;  4WQ2 A;  1TNQ A;  2GGM A;  4JPZ B;  5I2L A;  1H4B A;  5CSF A;  2QAC A;  3I5F B;  5I2O A;  1XK4 A;  4CFR A;  2MLF C;  1NYA A;  4CFQ A;  1CMG A;  1TNW A;  3O4Y A;  3HX4 A;  1XK4 C;  2BCA A;  2ZN8 A;  3OB2 B;  1K9K A;  2H61 A;  2WCE A;  1M45 A;  1IJ5 A;  3SG6 A;  1DTL A;  1QX2 A;  1R2U A;  4WQ3 A;  1UHH A;  4INW A;  4U8D A;  4A4C A;  2JUL A;  5G08 A;  2H61 C;  3VB1 A;  1Z2C B;  2FCD A;  4D1E A;  4PE4 A;  4F0Z B;  1KK7 Y;  2BE4 A;  1UHN A;  2VRG A;  1KWO C;  2NZ0 A;  2M3W A;  3OP0 A;  1QX5 B;  1KFX S;  1Y6W A;  3PM8 A;  1F8H A;  3ICB A;  2EC6 B;  1CDN A;  2JT8 A;  2JNX A;  2CBL A;  3RM1 A;  3IVT A;  2FOT A;  4YRU A;  1SPY A;  1AJ5 A;  3SIA A;  3KF9 A;  1OSA A;  4ORC B;  4OKH A;  3SG3 A;  1C3Y A;  4JKT A;  1SCV A;  3EK8 A;  1WY9 A;  1BR4 B;  5TNC A;  3TDI A;  1TTX A;  3SJS A;  2LUC A;  3GOF A;  4I5J A;  1K93 D;  1K2H A;  1MXL C;  3QRX A;  1PUL A;  3BQ3 A;  3NXA A;  1ORG A;  1GM0 A;  1PSB A;  1FBV A;  1RRO A;  4PT1 A;  3M0W A;  2GV5 A;  1TUJ A;  2PYQ A;  1YRU B;  2OS8 C;  1NX0 A;  3B88 A;  3CGA A;  3CS1 A;  1BJF A;  1SL8 A;  3CAB A;  3D76 A;  1AP4 A;  4I5N B;  4NDC A;  1BG1 A;  1XFV O;  1QVI Z;  3VRQ A;  1MR8 A;  1LIN A;  1TWO A;  2SCP A;  1YVL A;  2F8P A;  2SAS A;  4FTG A;  4GNK B;  1L2O B;  5DKQ A;  1AK8 A;  1OOG A;  2CTN A;  3EVR A;  3L47 A;  3O6B A;  1ZOT B;  4ZCU A;  1J7Q A;  2L5X B;  1M31 A;  1DF0 B;  3OX5 A;  2CT9 A;  3UO9 A;  4DUQ A;  2KNE A;  2JPT A;  2WCM A;  1KFU S;  1OMR A;  1L7Z A;  4ICB A;  2LCP A;  5DKN A;  1K8U A;  2PAL A;  3V2L A;  5AAN A;  1VRK A;  1DC1 A;  3R1O A;  3SS5 A;  1CLB A;  2LV7 A;  2QDI A;  2IS9 A;  1S1E A;  2LLS A;  2P71 A;  1J7P A;  2Y4Q A;  2KFH A;  2BAP A;  1Y1X A;  1SW8 A;  1S6I A;  3BUM B;  2WCF A;  2K61 A;  4XJK A;  2H8V A;  2MBX A;  1KQM B;  2P70 A;  2JU0 A;  1SR6 B;  4AQI A;  4CPV A;  1ALV A;  2K7C A;  2KYF A;  4OV2 A;  1BT6 A;  3IQO A;  2TN4 A;  5HL1 A;  2WCB A;  2M1K B;  1OZO A;  3NSI A;  1IJ6 A;  1KSO A;  3D78 A;  4MN0 A;  2ZFD A;  1OQP A;  1TRF A;  1SL9 A;  1DJZ A;  2BKH B;  1Z4H A;  3AAJ A;  2JT3 A;  3FS7 A;  1UUR A;  2KPH A;  4UPG A;  3I5H B;  1WDC C;  1K96 A;  3H4S E;  3PN7 B;  4AQJ A;  1FI6 A;  3DXL A;  1NCY A;  3OB1 B;  1CFF A;  1U5I B;  2KOT A;  1SCM C;  1ZUZ A;  4MEW A;  2F3Y A;  1A75 A;  4ORB B;  1CKK A;  2A4J A;  1IGV A;  3BUN B;  1DGU A;  4CLN A;  1BMO A;  3KO0 A;  4M2Q A;  3S0F A;  2KAV A;  2L4I A;  3I5F C;  3JTD C;  4PHJ A;  4QJ3 B;  3PSR A;  2LHL A;  4ETO A;  3KPX A;  2F2O A;  2M7N A;  2M49 B;  1N0Y A;  2CCM A;  1CFD A;  1SNL A;  4MRX A;  3Q8I A;  3NSO A;  1UHK A;  5AER A;  3DVK A;  2AAO A;  1F54 A;  3R1V A;  3I5I B;  1KFU L;  2P6B B;  2M29 A;  1KSM A;  1WRL A;  5CSI A;  1DQE A;  2Y1N A;  2K2A A;  4YI8 A;  3SS4 A;  1DJI A;  2PQL A;  2BL0 B;  4R1E A;  3S0A A;  1LS8 A;  1TUZ A;  2WCK A;  1B7T Z;  4WRI A;  1SMG A;  1CB1 A;  2COL B;  4JWQ A;  3SS3 A;  2DOQ A;  1J1E A;  1P28 A;  1F71 A;  2LAP A;  3B87 A;  3WXA A;  2LMU A;  2L0P A;  3GK2 A;  3OGN A;  2L5Y A;  1BU3 A;  5D7F A;  2K7D A;  1MXE A;  3DZT A;  1H8B A;  3JVT B;  5AFP A;  1JUO A;  2MA2 A;  1MWN A;  3RLZ A;  2JTT A;  3OBV A;  1EXR A;  1SBJ A;  1FF1 A;  4MZK A;  3FE6 A;  2H2K A;  1Y1U A;  2L50 A;  1B47 A;  5FI6 A;  3BFH A;  3BUX B;  1UHI A;  3I5G B;  2KDH A;  4YGE B;  1SY9 A;  2D8N A;  3VRO A;  1CNP A;  1XVJ A;  4CID A;  4JQ0 D;  1S5G Y;  2I2R E;  3AKB A;  1QV0 A;  3DF0 B;  5I8N A;  3D0Y B;  1PRW A;  3R1P A;  1DF0 A;  1L2O C;  1CTR A;  2E6W A;  2HET A;  1S26 D;  2ZNE A;  3RZS A;  3EK4 A;  1B1G A;  4GGF A;  1N65 A;  2KAX A;  1NPQ A;  5KSZ A;  1QWV A;  2KLD A;  1XFR A;  1M63 B;  2M0R A;  5CSN A;  3WHT B;  4DS7 A;  1CFP A;  2MLE C;  2JRF A;  4GGF C;  4YBH B;  1K90 D;  1ZFS A;  3AAK A;  1TNX A;  3EKH A;  3CZT X;  1SSE B;  4MVF A;  5DKR A;  1EL4 A;  1N2D A;  5F6T A;  1A29 A;  4PE0 A;  2OTG C;  2PRU A;  2JOJ A;  4C0J A;  4HRE E;  1S6J A;  2MRD A;  2KQY A;  1YUU A;  2LP2 A;  1JWD A;  1ODB A;  3UNW A;  1K9P A;  3D74 A;  2I18 A;  4NQG A;  3BOW B;  2M1U A;  3S0D A;  1IQ5 A;  4F7F A;  1ZMZ A;  1PVA A;  2WC5 A;  1OOF A;  4MRY A;  1Q80 A;  3A4U B;  3CDN A;  3F45 A;  4QJ4 B;  3FE9 A;  1DEL A;  1OOI X;  2I7A A;  1EG3 A;  1GGW A;  1OZS A;  2MAZ A;  4YGB B;  1TOP A;  4M2O A;  4INX A;  2GGZ A;  1CLM A;  1NP8 A;  1DJW A;  1YX7 A;  2K7O A;  1F4O A;  1CM4 A;  2LUX A;  4MSP A;  4TNC A;  2LVK A;  4C0L A;  3CYZ A;  3LK0 A;  1A2X A;  1J7O A;  1XFZ O;  3NHT A;  1YX8 A;  2Y5I A;  1UUS A;  2NCO A;  3LK1 A;  4PHN A;  2L51 A;  2BCB A;  2K2F A;  5HKW A;  4USL A;  3CZ0 A;  2KSP A;  1SRA A;  3BYA A;  2JTZ A;  2Q4U A;  1DEK A;  1ZAC A;  2BBN A;  4P2Y B;  1KK8 C;  1V1F A;  1X02 A;  2KI4 C;  1JFK A;  2LVV A;  5D69 A;  1KWO B;  5I2Q A;  5IBW A;  2QPT A;  1XFY O;  2F33 A;  2JNF A;  2BCX A;  4BY4 A;  1PVB A;  1OMV A;  4XYN A;  1AJ4 A;  3BFB A;  3NSL A;  2KGB C;  1OOH A;  3BXK A;  3FE8 A;  4HSZ A;  1WLZ A;  3I5I C;  5K89 A;  1MHO A;  1S3P A;  1J55 A;  1XFX O;  1CDM A;  1XA5 A;  2LMT A;  3CTN A;  3TUY C;  1TCO B;  4MBE A;  2BL0 C;  1ALW A;  2ZND A;  3CR4 X;  2F2P A;  4BY5 A;  3IQQ A;  1CDL A;  1GQM A;  3B6X A;  1A4P A;  4PE1 A;  1JC2 A;  2LMV A;  4GBA A;  2R2I A;  3K1E A;  1S6C A;  1CLL A;  1KK7 Z;  4PHM A;  3EK7 A;  1XFU O;  3TS5 C;  4C0K A;  4N5X A;  1LXF C;  1PSR A;  1XYD A;  3N7H A;  3SG4 A;  4Q04 A;  1YVH A;  2LC5 A;  3DVE A;  5HLO A;  3SG2 A;  4DIR A;  1CDP A;  5AXI A;  3A8R A;  1GJY A;  1RTP 1;  4IJ7 A;  4OZD A;  1K94 A;  2BBM A;  2WOS A;  1CMF A;  3LCP C;  1QTX A;  2K8M B;  1S36 A;  5I94 A;  1WRK A;  3SG7 A;  1IIO A;  2M97 A;  1C7W A;  3D73 A;  3DF0 A;  3D0Y A;  1C3Z A;  1DJH A;  3I5G C;  2QEH A;  3KHE A;  1F70 A;  1G4Y R;  2KBI A;  2NXQ A;  1M46 A;  3VRR A; 
#chains in the Genus database with same CATH homology
 2HQ8 A;  1QAT A;  1YUR A;  2JQ6 A;  1CM1 A;  1NCX A;  1R6P A;  2EC6 C;  2JT0 A;  1YUS A;  1OE9 B;  2EGD A;  1G33 A;  2O60 A;  3VGO A;  1QVI Y;  2G2B A;  2KGR A;  1PAL A;  1F55 A;  1NSH A;  1LA0 A;  1K95 A;  2JC2 A;  1JSA A;  1YTZ C;  1FW4 A;  1KQV A;  4MZJ A;  4XJK B;  1OMD A;  5JJG A;  1A03 A;  2KHN A;  3EVV A;  1BR1 B;  1SK6 D;  2PVB A;  1LKJ A;  2HQW A;  2LNK A;  1QV1 A;  1WDC B;  5ER4 X;  1JF2 A;  4N1F A;  4NDD A;  1CFC A;  1GGZ A;  1SCM B;  1RK9 A;  1IRJ A;  2ISD A;  3FWB A;  3O78 A;  2E30 A;  2WC8 A;  3DVJ A;  3LLE A;  1QLS A;  4P5O E;  1FI5 A;  3GK4 X;  4DCK A;  2L98 A;  2HF5 A;  1A75 B;  3JTD B;  3TDZ A;  1DJG A;  1NWD A;  1KCY A;  3BUO B;  1K9U A;  4FQO A;  4HRH A;  4PE7 A;  1RJV A;  4GUK A;  1G8I A;  3SIB A;  1WLM A;  1B8C A;  1HT9 A;  3IF7 A;  4YGD B;  1IG5 A;  1J7R A;  1W7J B;  3OX6 A;  5ER5 A;  2Q91 A;  5AEQ A;  2B1U A;  1SKT A;  2WOR A;  1J1D A;  1XFW O;  2LAN A;  2EHB A;  1C07 A;  2AUC A;  4YGA A;  2LVI A;  1XO5 A;  1KQM C;  4I5K A;  1SR6 C;  1WRZ A;  3GK1 A;  5HYD A;  2KFG A;  4MLW A;  2LE9 B;  4M2P A;  2BKI B;  4DRW A;  1TIZ A;  2M7L A;  3NSK A;  4ZCV A;  1BOD A;  1LA3 A;  1B9A A;  2RGI A;  4PHK A;  1NIW A;  1C7V A;  1MUX A;  3CLN A;  3ZNI A;  1AUI B;  1U5I A;  1EG4 A;  3I5H C;  3PN7 C;  1QX7 A;  1QAS A;  4L9M A;  1QS7 A;  4PAL A;  1NX1 A;  5BPJ A;  3DVM A;  1IQ3 A;  4ORA B;  4AOM A;  2KI6 C;  1DJX A;  4PCW A;  3O2P A;  1V1G A;  3D10 A;  2CNP A;  1B7T Y;  3LL8 B;  5CSJ A;  5B8I B;  4GPL B;  3AKA A;  4GAO A;  1NX2 A;  2G9B A;  3K21 A;  5HLV A;  5FYX A;  3SG5 A;  1UHJ A;  3CWG A;  2NCP A;  3PLF B;  5KU1 A;  5HKY A;  4GGN A;  1RFJ A;  1W7I B;  2KFF A;  1EH2 A;  3E3R A;  2ZN9 A;  1B4C A;  1REC A;  1EJ3 A;  2ZKM X;  1Y1A A;  2NLN A;  1DMO A;  5PAL A;  3KEV A;  4OR9 B;  2AMI A;  3ZWH A;  2LHI A;  3EVU A;  3FWC A;  1UWO A;  1QXP A;  1QJT A;  3PFV A;  1PK0 D;  2FJU B;  2ZRS A;  3MSE B;  1YRT B;  2LLU A;  2K7B A;  2MHH A;  2PSR A;  1NX3 A;  1RWY A;  2KQ6 A;  3TDU A;  2M9G A;  3C1V A;  1NUB A;  1UP5 A;  2OTG B;  4MZL A;  5JOL A;  1JFJ A;  2F3Z A;  3EKJ A;  1LVC D;  2HPS A;  2LM5 A;  4HRG A;  2MJW B;  2LP3 A;  1TN4 A;  4E68 A;  1S5G Z;  1KFX L;  5GQQ C;  1DGV A;  2JXC A;  2JXL A;  2K0J A;  1QLK A;  2OS8 B;  4NDB A;  2I94 A;  2KYC A;  4PDZ A;  1IKU A;  1BLQ A;  2PAS A;  4A4B A;  2L2E A;  1QIW A;  1D1O A;  1HQV A;  3CR5 X;  3JVT C;  4OVN F;  1YUT A;  4GFT A;  3WHU B;  1FPW A;  1DJY A;  2M8U A;  4OCI A;  2BE6 A;  3VRP A;  1DVI A;  1SYM A;  1OOJ A;  1BF5 A;  1TNP A;  2LVJ A;  2V53 A;  1TCF A;  3OHM B;  2OPO A;  1NCZ A;  1SL7 A;  2Y1M A;  1AVS A;  5J3X A;  5CPV A;  3BUW B;  2O5G A;  1JF0 A;  1KK8 B;  2KI4 B;  1B8L A;  3TZ1 A;  2KAY A;  4I5L B;  1E8A A;  2CXJ A;  2ZRT A;  5KTY A;  3WNX B;  1F4Q A;  1AHR A;  1B8R A;  2PMY A;  3CR2 A;  1MF8 B;  1JBA A;  3FIA A;  1Y0V H;  1M39 A;  1DT7 B;  2BEC A;  4N1G A;  3TUY B;  1BOC A;  2JZI A;  3BOW A;  2KBM A;  1IH0 A;  3HCM A;  2KI6 D;  3VRN A;  3DD4 A;  4IL1 A;  1MQ1 A;  4YGC B;  1YR5 A;  2JWW A;  2FCE A;  2LLT A;  5HKZ A;  4QJ5 B;  1IWQ A;  1QIV A;  2L4H A;  3PAL A;  3PAT A;  4YI9 A;  3TS5 B;  2WND A;  4WQ2 A;  1TNQ A;  2GGM A;  4JPZ B;  5I2L A;  5CSF A;  2QAC A;  3I5F B;  5I2O A;  1XK4 A;  4CFR A;  2MLF C;  1NYA A;  4CFQ A;  1CMG A;  1TNW A;  3O4Y A;  3HX4 A;  1XK4 C;  2BCA A;  2ZN8 A;  3OB2 B;  1K9K A;  2H61 A;  2WCE A;  1M45 A;  1IJ5 A;  3SG6 A;  1DTL A;  1QX2 A;  1R2U A;  4WQ3 A;  1UHH A;  4U8D A;  4A4C A;  2JUL A;  5G08 A;  2H61 C;  2FCD A;  4D1E A;  4PE4 A;  4F0Z B;  1KK7 Y;  2BE4 A;  1UHN A;  2VRG A;  1KWO C;  2NZ0 A;  2M3W A;  3OP0 A;  1QX5 B;  1KFX S;  1Y6W A;  3PM8 A;  1F8H A;  3ICB A;  2EC6 B;  1CDN A;  2JT8 A;  2JNX A;  2CBL A;  3RM1 A;  2FOT A;  4YRU A;  1SPY A;  1AJ5 A;  3SIA A;  3KF9 A;  1OSA A;  4ORC B;  4OKH A;  3SG3 A;  1SCV A;  3EK8 A;  1WY9 A;  1BR4 B;  5TNC A;  3TDI A;  1TTX A;  3SJS A;  2LUC A;  3GOF A;  4I5J A;  1K93 D;  1K2H A;  1MXL C;  3QRX A;  1PUL A;  3BQ3 A;  3NXA A;  1PSB A;  1FBV A;  1RRO A;  3M0W A;  2GV5 A;  1YRU B;  2OS8 C;  1NX0 A;  3CGA A;  3CS1 A;  1BJF A;  1SL8 A;  1AP4 A;  4I5N B;  4NDC A;  1BG1 A;  1XFV O;  1QVI Z;  3VRQ A;  1MR8 A;  1LIN A;  2SCP A;  2SAS A;  1YVL A;  2F8P A;  4FTG A;  5DKQ A;  4GNK B;  1L2O B;  1AK8 A;  1H4B A;  2CTN A;  3EVR A;  4ZCU A;  3O6B A;  1ZOT B;  1J7Q A;  2L5X B;  1M31 A;  1DF0 B;  3OX5 A;  2CT9 A;  4DUQ A;  2KNE A;  2JPT A;  4ICB A;  1KFU S;  1OMR A;  1L7Z A;  5DKN A;  2LCP A;  1K8U A;  2PAL A;  5AAN A;  1VRK A;  1CLB A;  2LV7 A;  2IS9 A;  1S1E A;  2LLS A;  1J7P A;  2Y4Q A;  2KFH A;  1Y1X A;  1SW8 A;  1S6I A;  3BUM B;  2WCF A;  2K61 A;  4XJK A;  2MBX A;  1KQM B;  4AQI A;  2JU0 A;  1SR6 B;  4CPV A;  1ALV A;  2K7C A;  2KYF A;  4OV2 A;  1BT6 A;  3IQO A;  2TN4 A;  2WCB A;  2M1K B;  1OZO A;  3NSI A;  1IJ6 A;  1KSO A;  4MN0 A;  2ZFD A;  1OQP A;  1TRF A;  1SL9 A;  1DJZ A;  2BKH B;  3AAJ A;  2JT3 A;  3FS7 A;  1UUR A;  4UPG A;  3I5H B;  1WDC C;  1K96 A;  3H4S E;  3PN7 B;  4AQJ A;  1FI6 A;  1NCY A;  3OB1 B;  1CFF A;  1U5I B;  2KOT A;  1SCM C;  1ZUZ A;  4MEW A;  2F3Y A;  1A75 A;  4ORB B;  1CKK A;  2A4J A;  1IGV A;  3BUN B;  1DGU A;  4CLN A;  1BMO A;  3KO0 A;  4M2Q A;  2KAV A;  2L4I A;  3I5F C;  3JTD C;  4PHJ A;  4QJ3 B;  3PSR A;  2LHL A;  4ETO A;  3KPX A;  2F2O A;  2M7N A;  2M49 B;  1N0Y A;  2CCM A;  1CFD A;  1SNL A;  4MRX A;  3NSO A;  1UHK A;  5AER A;  3DVK A;  2AAO A;  1F54 A;  3I5I B;  1KFU L;  2P6B B;  2M29 A;  1KSM A;  1WRL A;  5CSI A;  2Y1N A;  2K2A A;  4YI8 A;  1DJI A;  4R1E A;  2BL0 B;  1B7T Z;  4WRI A;  1SMG A;  1CB1 A;  2COL B;  4JWQ A;  2DOQ A;  1J1E A;  1F71 A;  2LAP A;  3WXA A;  2LMU A;  2L0P A;  3GK2 A;  1BU3 A;  5D7F A;  2K7D A;  1MXE A;  1H8B A;  3JVT B;  5AFP A;  1JUO A;  2MA2 A;  1MWN A;  3RLZ A;  2JTT A;  1EXR A;  1SBJ A;  1FF1 A;  4MZK A;  2H2K A;  1Y1U A;  2L50 A;  1B47 A;  3BUX B;  3I5G B;  1UHI A;  4YGE B;  2KDH A;  1SY9 A;  2D8N A;  3VRO A;  1CNP A;  1XVJ A;  4CID A;  4JQ0 D;  1S5G Y;  2I2R E;  3AKB A;  1QV0 A;  3DF0 B;  5I8N A;  3D0Y B;  1PRW A;  1DF0 A;  1L2O C;  1CTR A;  2E6W A;  2HET A;  1S26 D;  2ZNE A;  3EK4 A;  1B1G A;  4GGF A;  1N65 A;  2KAX A;  1NPQ A;  5KSZ A;  5CSN A;  2M0R A;  3WHT B;  1M63 B;  4DS7 A;  1CFP A;  2MLE C;  2JRF A;  4GGF C;  4YBH B;  1K90 D;  1ZFS A;  3AAK A;  1TNX A;  3EKH A;  3CZT X;  4MVF A;  5DKR A;  1EL4 A;  1N2D A;  5F6T A;  1A29 A;  4PE0 A;  2OTG C;  2PRU A;  2JOJ A;  4C0J A;  4HRE E;  1S6J A;  2MRD A;  2KQY A;  1YUU A;  2LP2 A;  1JWD A;  1ODB A;  1K9P A;  2I18 A;  4NQG A;  3BOW B;  2M1U A;  1IQ5 A;  1ZMZ A;  1PVA A;  4MRY A;  1Q80 A;  3A4U B;  3F45 A;  4QJ4 B;  2I7A A;  1EG3 A;  1GGW A;  1OZS A;  2MAZ A;  4YGB B;  1TOP A;  4M2O A;  2GGZ A;  1CLM A;  1NP8 A;  1DJW A;  1YX7 A;  2K7O A;  1F4O A;  1CM4 A;  2LUX A;  4MSP A;  4TNC A;  2LVK A;  4C0L A;  3LK0 A;  1A2X A;  1J7O A;  1XFZ O;  1YX8 A;  2Y5I A;  1UUS A;  2NCO A;  3LK1 A;  4PHN A;  2L51 A;  2BCB A;  2K2F A;  5HKW A;  4USL A;  2KSP A;  1SRA A;  3BYA A;  2JTZ A;  2Q4U A;  1ZAC A;  2BBN A;  4P2Y B;  1KK8 C;  1V1F A;  1X02 A;  2KI4 C;  1JFK A;  2LVV A;  5D69 A;  1KWO B;  5I2Q A;  5IBW A;  2QPT A;  1XFY O;  2F33 A;  2JNF A;  2BCX A;  4BY4 A;  1PVB A;  1OMV A;  4XYN A;  1AJ4 A;  3NSL A;  2KGB C;  3BXK A;  4HSZ A;  5K89 A;  1WLZ A;  3I5I C;  1MHO A;  1S3P A;  1J55 A;  1XFX O;  1CDM A;  1XA5 A;  2LMT A;  3CTN A;  3TUY C;  1TCO B;  4MBE A;  2BL0 C;  1ALW A;  2ZND A;  3CR4 X;  2F2P A;  4BY5 A;  3IQQ A;  1CDL A;  1GQM A;  4PE1 A;  1A4P A;  1JC2 A;  2LMV A;  4GBA A;  2R2I A;  1S6C A;  1CLL A;  1KK7 Z;  4PHM A;  3EK7 A;  1XFU O;  3TS5 C;  4C0K A;  4N5X A;  1LXF C;  1PSR A;  1XYD A;  3SG4 A;  4Q04 A;  1YVH A;  2LC5 A;  3DVE A;  5HLO A;  3SG2 A;  4DIR A;  1CDP A;  5AXI A;  3A8R A;  1GJY A;  1RTP 1;  1K94 A;  2BBM A;  2WOS A;  1CMF A;  3LCP C;  1QTX A;  2K8M B;  1S36 A;  1WRK A;  3SG7 A;  2M97 A;  1C7W A;  3DF0 A;  3D0Y A;  1DJH A;  1F70 A;  3I5G C;  3KHE A;  1G4Y R;  2KBI A;  2NXQ A;  1M46 A;  3VRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...