1KQVA

Family of nmr solution structures of ca ln calbindin d9k
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
75
structure length
75
Chain Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords VITAMIN D-DEPENDENT CALCIUM-BINDING PROTEIN
publication title Paramagnetism-based versus classical constraints: an analysis of the solution structure of Ca Ln calbindin D9k.
pubmed doi rcsb
source organism Bos taurus
total genus 19
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00036 EF-hand_1 EF hand
A PF01023 S_100 S-100/ICaBP type calcium binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 1kqvA00
3I5IC 2LHIA 1BU3A 2SCPA 1M46A 1QATA 1R6PA 2KI6D 4PHJA 1YRTB 4OCIA 3VRQA 1B9AA 1HT9A 5CSJA 4N1FA 3FIAA 5JJGA 1QX5B 1OMRA 4GBAA 1QX7A 3VRRA 3SG2A 2LLTA 1CFDA 2PMYA 3BUOB 2BL0C 4OR9B 2KQYA 2K7BA 2F2OA 2LNKA 3SIAA 5FYXA 5HLVA 3NSIA 2CCMA 1QVIY 1R2UA 2Y1MA 4YGBB 1C7VA 1EH2A 1SR6B 1QXPA 2PSRA 2I18A 3DVKA 1EJ3A 1N65A 2BCXA 2M3WA 2ZNEA 2Q4UA 3BQ3A 4N5XA 4PDZA 1N2DA 2QACA 1H8BA 4M2PA 1OSAA 2ZN8A 1WDCC 1DF0A 1KFXL 1QX2A 4ORAB 3AAKA 1YUTA 2JTZA 2HF5A 3K21A 2KYFA 5PALA 1B7TY 2KGBC 2M1KB 1BT6A 1DVIA 3KO0A 1QS7A 1SCMB 4ETOA 2FJUB 1JFJA 3BUXB 1H4BA 3CTNA 1ODBA 5KSZA 5HKZA 2Y5IA 4I5JA 2WCFA 1G33A 4GGNA 2OS8B 4CPVA 1NPQA 2NLNA 3CR2A 2K2FA 1BOCA 2JT3A 1Y1AA 1KK7Z 3OB1B 1F71A 2KDHA 2AMIA 4YI8A 5CSFA 2KYCA 3TUYB 1KCYA 4MRYA 1TIZA 1TNXA 1OMVA 1NCZA 3BXKA 3NXAA 4CIDA 3JVTB 3O2PA 1NX0A 2LMUA 4MEWA 2TN4A 2EHBA 2KI6C 5TNCA 1DT7B 2CXJA 1DJGA 5DKQA 2JPTA 4P5OE 4HRHA 1AK8A 1S36A 1FI6A 1YUSA 4HREE 3TS5B 1EG3A 1GGWA 4NDBA 3EKJA 1MXEA 1M45A 3KEVA 2MBXA 1NCXA 2KI4C 1J7PA 4MZKA 1XYDA 1VRKA 1K96A 5AFPA 2K61A 3LK1A 1NCYA 1RK9A 3WHTB 1B1GA 1SCMC 3PATA 1MXLC 2VRGA 4L9MA 1AP4A 1PVBA 2L51A 4YGEB 4GUKA 1QV1A 2EC6B 1QLKA 1TN4A 2G2BA 1F54A 2M0RA 4QJ5B 3OP0A 4YRUA 1XK4A 3FWBA 1YX8A 4AQIA 1AUIB 1SPYA 1KFXS 1GQMA 1WRZA 1NX1A 2LM5A 2Y1NA 3TUYC 2LLUA 3DVJA 1RJVA 3TZ1A 1IQ5A 1J1EA 3PFVA 3JVTC 1OMDA 3VRNA 1LINA 2L50A 1V1FA 1IWQA 3OX5A 4FTGA 4OVNF 3RLZA 1PULA 1CMGA 3F45A 1B8RA 1W7IB 2CNPA 4MLWA 1KWOB 2FCDA 3PLFB 4MN0A 3SG6A 1NP8A 4NQGA 2K2AA 1S26D 1U5IA 2L4HA 3LLEA 3PM8A 5GQQC 1DGVA 2L0PA 5HLOA 3TS5C 2JXLA 1TCFA 1KK8C 2LP2A 2K7CA 4I5KA 4YBHB 4PE0A 1RROA 1ALWA 1QIVA 1SK6D 4I5NB 2E30A 1JF0A 4PE4A 2RGIA 5K89A 2K7DA 3HX4A 5B8IB 2O60A 5AEQA 2JT0A 1MHOA 2F33A 2AUCA 2LLSA 1S6CA 3CGAA 2ZRSA 1A29A 1SMGA 1DJXA 3I5GB 4MRXA 4YGAA 1AVSA 1C7WA 1SCVA 2EC6C 1XFWO 2F3YA 3CZTX 1WLMA 2Y4QA 1IKUA 1U5IB 1DJHA 1B8CA 5AANA 3O6BA 2ZNDA 2LANA 3CLNA 4CLNA 1G4YR 5HKYA 1X02A 1SY9A 1IH0A 3PSRA 1M39A 3AKAA 1HQVA 1L7ZA 1XFZO 2H61A 1RTP1 3CR4X 3IQOA 3LL8B 4GNKB 1OQPA 4HRGA 1KWOC 2KOTA 3JTDB 1IRJA 1XA5A 3CS1A 4PHMA 2A4JA 3GK2A 1QIWA 1XK4C 3BUWB 2JZIA 3FWCA 2OPOA 1K9UA 3IQQA 2MRDA 1SRAA 1UHJA 1NX3A 2HETA 2OTGB 3ICBA 1M63B 1E8AA 3SG5A 1S1EA 2ZRTA 3TDZA 1GJYA 2JQ6A 1D1OA 2JOJA 1PRWA 1Y1XA 1DJIA 2KBIA 1RECA 3D10A 2DOQA 1AJ5A 1AHRA 3BUNB 3C1VA 1F55A 2F3ZA 1K94A 1UHKA 2HQWA 3DF0A 2KFGA 1QASA 2ZFDA 1SBJA 1JFKA 1UWOA 2JC2A 1YR5A 4XJKA 1EXRA 5I2LA 2WC8A 3SJSA 3DD4A 1KFUL 1TRFA 4NDCA 1ZMZA 4MVFA 2JXCA 3WHUB 1IGVA 1WRLA 3EVUA 5ER5A 4BY5A 1L2OB 1XFYO 2L98A 3GOFA 2MLFC 1UUSA 3PALA 4FQOA 2M9GA 1LA0A 2JU0A 1J55A 2BE4A 3I5FB 3D0YB 4MSPA 4C0KA 2G9BA 5HKWA 1Y6WA 2NXQA 2WCEA 1PSRA 1YURA 2MHHA 4DUQA 2L5XB 2BCAA 4CFQA 1TNQA 4YI9A 1UP5A 2M8UA 3DF0B 1CDLA 1SR6C 2LUXA 3EK7A 5CSIA 1S5GZ 2LV7A 5DKNA 4PHNA 1JSAA 2LAPA 1Y0VH 1FPWA 4XJKB 2M29A 2HPSA 2LC5A 3OB2B 2EGDA 3CR5X 2KAVA 2L2EA 5I2OA 1J7QA 1K9PA 1IG5A 4M2OA 1NUBA 2ZN9A 3MSEB 2H61C 3LCPC 2JNFA 1MR8A 1UHIA 2LHLA 3QRXA 4JWQA 3AAJA 2OS8C 2MAZA 3I5HB 1ZFSA 3DVEA 1LXFC 1N0YA 3OHMB 1QVIZ 4Q04A 1UHNA 1A75B 1BR4B 1YVHA 2FOTA 2KFFA 3EKHA 1SL8A 2BKIB 1CLBA 4UPGA 1F70A 1J7RA 1SNLA 1L2OC 1CFFA 1JWDA 1LKJA 2E6WA 2F2PA 3O4YA 5CPVA 2R2IA 3KF9A 1OOJA 2CTNA 2LMTA 3CWGA 1BF5A 1DJWA 1YUUA 2ZKMX 3I5IB 1QJTA 1B7TZ 2LCPA 1XO5A 4PHKA 3VROA 4DCKA 1SYMA 3KHEA 4PALA 1V1GA 3M0WA 2LVKA 4N1GA 1MQ1A 4USLA 4CFRA 3VRPA 3HCMA 1DGUA 2MA2A 1QLSA 1K9KA 1PSBA 2GV5A 4PCWA 4WQ2A 1PALA 3A8RA 1A2XA 2GGZA 2I7AA 2NCPA 1B4CA 1ALVA 2KHNA 1F4QA 1JC2A 1GGZA 2KNEA 3A4UB 2KQ6A 1KK7Y 2KBMA 2BECA 1SL7A 1Q80A 3DVMA 4PE7A 5F6TA 2K7OA 3I5HC 1A4PA 1BG1A 1CNPA 5J3XA 1NYAA 4MBEA 2MLEC 1G8IA 2CBLA 1SW8A 1ZOTB 3VGOA 3LK0A 4GGFA 3BOWB 3H4SE 4D1EA 4GPLB 2M7LA 3WNXB 1K2HA 2COLB 3SG7A 2JT8A 3PN7B 1W7JB 1AJ4A 2NCOA 1K8UA 2KGRA 1F4OA 2LE9B 1PVAA 4C0JA 1JF2A 2HQ8A 3KPXA 1WRKA 3SG3A 2LVVA 1K95A 1EL4A 3NSOA 5D69A 1J7OA 1LA3A 5ER4X 2LVIA 1NSHA 4ORBB 4TNCA 1CMFA 1DJYA 2M7NA 4JQ0D 3NSKA 1JBAA 2LVJA 3D0YA 4AQJA 1FW4A 5KU1A 2CT9A 2K8MB 2K0JA 3RM1A 2F8PA 3I5GC 1CFCA 1B47A 4DS7A 2M97A 5KTYA 1KSMA 2QPTA 3WXAA 3E3RA 2GGMA 2BBMA 2LMVA 2JWWA 1WLZA 2L4IA 2KI4B 1S3PA 2KSPA 2SASA 3BYAA 4ORCB 4IL1A 4MZJA 4WRIA 3EVVA 2PVBA 4AOMA 1RWYA 1K90D 3PN7C 4I5LB 1CLMA 1J1DA 4P2YB 1OE9B 4QJ4B 1B8LA 4ZCVA 5BPJA 5CSNA 1S6IA 2H2KA 2JULA 1UURA 4ZCUA 2PASA 4MZLA 1NIWA 1NX2A 4YGDB 2WNDA 3JTDC 4JPZB 1MWNA 4R1EA 1A75A 1BR1B 4HSZA 4U8DA 4WQ3A 2BBNA 1F8HA 1S6JA 3EVRA 2JRFA 1CDMA 2M1UA 4GGFC 4BY4A 1KQVA 2AAOA 1EG4A 5D7FA 1K93D 1UHHA 2OTGC 3EK4A 3ZNIA 5DKRA 4QJ3B 1DF0B 2MJWB 4YGCB 5AERA 1MF8B 1CKKA 2LP3A 3TDUA 1CTRA 3GK1A 5IBWA 4M2QA 1FF1A 5JOLA 2WOSA 2IS9A 1JUOA 1KQMB 2P6BB 1CLLA 3NSLA 1KK8B 1CM4A 4NDDA 1BODA 4PE1A 5G08A 3ZWHA 1FBVA 1CDPA 1QV0A 3AKBA 3GK4X 5HYDA 1ZUZA 1SKTA 3O78A 2PALA 1LVCD 3I5FC 1IQ3A 1XVJA 1OZOA 1FI5A 2M49B 1CFPA 1YX7A 4DRWA 5I2QA 2KAXA 4A4CA 2Q91A 3TDIA 4GFTA 1CM1A 4OV2A 4XYNA 1KFUS 2ISDA 2BCBA 3BOWA 5AXIA 1IJ5A 1OZSA 2O5GA 3EK8A 1RFJA 1KSOA 1CDNA 2LUCA 4ICBA 2FCEA 4F0ZB 1YRUB 4A4BA 1TCOB 4DIRA 1BMOA 2BL0B 4E68A 1WY9A 1CB1A 1NWDA 4C0LA 2BKHB 3SG4A 1DTLA 1TNWA 2WORA 2B1UA 1DMOA 1M31A 1DJZA 1BJFA 1A03A 1XFXO 2PRUA 1PK0D 1IJ6A 1KQMC 2D8NA 2I94A 1TTXA 3BUMB 2JNXA 2WCBA 1XFUO 2KAYA 1ZACA 3SIBA 1WDCB 1YTZC 1SL9A 2BE6A 1MUXA 3IF7A 1QTXA 2I2RE 2JTTA 4OKHA 3OX6A 2KFHA 3FS7A 2NZ0A 1C07A 1XFVO 4GAOA 1BLQA 1TOPA 1TNPA 5I8NA 1YVLA 2V53A 1Y1UA 1S5GY
chains in the Genus database with same CATH superfamily
3I5IC 2LHIA 1BU3A 2SCPA 1M46A 3L47A 1QATA 1DELA 1R6PA 2KI6D 4PHJA 1YRTB 3R72A 4OCIA 3VRQA 1B9AA 1HT9A 3CZ2A 5CSJA 4N1FA 3FIAA 5JJGA 1QX5B 1OMRA 5EL2A 4GBAA 1QX7A 3VRRA 3SG2A 2LLTA 1CFDA 2PMYA 2YGUA 3BUOB 2BL0C 4OR9B 3R1VA 2JPOA 2KQYA 2K7BA 2F2OA 2LNKA 3OBVA 3SIAA 5FYXA 5HLVA 3NSIA 4PT1A 2CCMA 1QVIY 1R2UA 2Y1MA 4YGBB 1C7VA 1EH2A 1SR6B 1QXPA 2PSRA 2I18A 3DVKA 1EJ3A 1N65A 2BCXA 2M3WA 1W9ZA 2ZNEA 2Q4UA 3BQ3A 2BAPA 1TUJA 1N2DA 2QACA 4N5XA 4M2PA 4PDZA 1OSAA 2ZN8A 1WDCC 1DF0A 1KFXL 1QX2A 4ORAB 3AAKA 1YUTA 2JTZA 2HF5A 3B7AA 3K21A 2KYFA 2QEVA 5PALA 1B7TY 2KGBC 1OOIX 2M1KB 1BT6A 2FJYA 3N7HA 3SS3A 1DVIA 3KO0A 1QS7A 1SCMB 4ETOA 2FJUB 1JFJA 3BUXB 1H4BA 3CTNA 1ODBA 5KSZA 5HKZA 2Y5IA 4I5JA 2WCFA 1G33A 4GGNA 2OS8B 4CPVA 1NPQA 2NLNA 3CR2A 2K2FA 1BOCA 2JT3A 1Y1AA 1KK7Z 3OB1B 1F71A 2KDHA 2AMIA 4YI8A 5D3OA 5CSFA 2KYCA 3TUYB 1KCYA 4MRYA 1TIZA 1TNXA 1OMVA 1NCZA 3BXKA 3NXAA 4CIDA 3JVTB 3O2PA 1NX0A 2LMUA 3B88A 4MEWA 2TN4A 2EHBA 3RZSA 2KI6C 3BFAA 5TNCA 1DT7B 2CXJA 1P28A 1DJGA 5DKQA 2JPTA 3NGVA 4HRHA 4P5OE 1S36A 1AK8A 1FI6A 1OOFA 1YUSA 4HREE 3TS5B 1EG3A 1GGWA 4NDBA 3EKJA 1MXEA 1M45A 3KEVA 2MBXA 1NCXA 2KI4C 1J7PA 4MZKA 1XYDA 1VRKA 1K96A 5AFPA 2K61A 3LK1A 1NCYA 1RK9A 3WHTB 1B1GA 1SCMC 3PATA 1MXLC 2VRGA 4L9MA 1AP4A 1PVBA 2L51A 4YGEB 4GUKA 1QV1A 2EC6B 1QLKA 1TN4A 2WCHA 2G2BA 1F54A 2M0RA 4QJ5B 3OP0A 4YRUA 1XK4A 3FWBA 2QDIA 1YX8A 4AQIA 1AUIB 2L2CA 1SPYA 1KFXS 1GQMA 1WRZA 1NX1A 2LM5A 2Y1NA 3TUYC 2LLUA 3DVJA 1RJVA 3DXLA 3TZ1A 1IQ5A 1J1EA 3PFVA 3JVTC 1OMDA 3VRNA 5I94A 1LINA 2L50A 1V1FA 1IWQA 3OX5A 4FTGA 4OVNF 3RLZA 1PULA 1CMGA 3F45A 1B8RA 1W7IB 2CNPA 4MLWA 1KWOB 2FCDA 3PLFB 2P71A 4MN0A 3SG6A 1NP8A 3DZTA 1C3ZA 2K2AA 1S26D 1U5IA 2L4HA 3LLEA 3PM8A 4NQGA 1DGVA 5GQQC 2L0PA 2QEHA 5HLOA 3TS5C 2JXLA 1TCFA 1KK8C 3DY9A 2LP2A 2K7CA 4I5KA 4YBHB 4PE0A 1RROA 1OW4A 1ALWA 1QIVA 1SK6D 4I5NB 2E30A 1JF0A 4PE4A 2RGIA 5K89A 2K7DA 3HX4A 5B8IB 2O60A 5AEQA 3B86A 3PM2A 2JT0A 3OGNA 1MHOA 2F33A 2AUCA 3S0DA 2LLSA 1S6CA 3CGAA 2ZRSA 1A29A 1SMGA 2ERBA 3QMEA 1DJXA 3I5GB 4MRXA 4YGAA 1AVSA 1C7WA 1SCVA 2EC6C 1XFWO 2F3YA 3CZTX 3D76A 1WLMA 1OOGA 2Y4QA 1IKUA 1U5IB 3B87A 1DJHA 1B8CA 5AANA 3O6BA 2ZNDA 2LANA 3CLNA 3S0GA 1G4YR 4CLNA 5HKYA 1X02A 1SY9A 1IH0A 3PSRA 2KLDA 1M39A 3AKAA 1HQVA 1L7ZA 1XFZO 2H61A 2H8VA 1RTP1 4INXA 3CR4X 3IQOA 3LL8B 4GNKB 1OQPA 1H8BA 4HRGA 1KWOC 5DICA 2KOTA 1DQEA 3JTDB 1IRJA 1XA5A 3CS1A 3D73A 4PHMA 1C3YA 1DEKA 2A4JA 3GK2A 3S0EA 1QIWA 1XK4C 3BUWB 2JZIA 3FWCA 2PQLA 2OPOA 1K9UA 3CZ1A 3IQQA 2MRDA 1SRAA 1UHJA 1NX3A 2HETA 2OTGB 3ICBA 1M63B 1E8AA 3SG5A 1IIOA 1S1EA 1DC1A 2ZRTA 3TDZA 1GJYA 2JQ6A 1D1OA 2JOJA 1PRWA 1Y1XA 1DJIA 2KBIA 1RECA 3D10A 2DOQA 1AJ5A 1AHRA 3BUNB 3C1VA 1F55A 3Q8IA 2F3ZA 1K94A 1UHKA 2HQWA 3O4XA 3DF0A 1ORGA 2KFGA 1QASA 2ZFDA 1SBJA 1JFKA 3R1OA 1UWOA 2JC2A 1YR5A 4XJKA 1EXRA 5I2LA 2WC8A 3SJSA 3DD4A 1KFUL 1TRFA 4NDCA 1ZMZA 4MVFA 2JXCA 4FQTA 1IGVA 1WRLA 3EVUA 5ER5A 3WHUB 4BY5A 1L2OB 1XFYO 2L98A 3GOFA 2MLFC 1UUSA 3L4LA 3PALA 4FQOA 2M9GA 1LA0A 2JU0A 1J55A 2BE4A 3I5FB 4INWA 3D0YB 4MSPA 4C0KA 2G9BA 5HKWA 1Y6WA 2NXQA 2WCEA 1PSRA 1YURA 2MHHA 4DUQA 2L5XB 2BCAA 4CFQA 1TNQA 4YI9A 1UP5A 2M8UA 3DF0B 1CDLA 1SR6C 2LUXA 3EK7A 5CSIA 1S5GZ 2LV7A 4JD9A 4PHNA 5DKNA 1JSAA 2LAPA 1Y0VH 1FPWA 4XJKB 2M29A 2HPSA 2LC5A 3D77A 3OB2B 2EGDA 3UO9A 3CR5X 2KAVA 2L2EA 5I2OA 1J7QA 1K9PA 1IG5A 4M2OA 1NUBA 2ZN9A 3MSEB 2H61C 3LCPC 2JNFA 1MR8A 1UHIA 2LHLA 3QRXA 4JWQA 3AAJA 2PYQA 1Z2CB 1GM0A 2OS8C 2MAZA 3I5HB 1ZFSA 3DVEA 1LXFC 1N0YA 3OHMB 1QVIZ 4Q04A 1UHNA 1A75B 1BR4B 1YVHA 2FOTA 2KFFA 3EKHA 1SL8A 2BKIB 1CLBA 4UPGA 1F70A 1J7RA 1SNLA 1L2OC 1CFFA 1QWVA 1JWDA 2L5YA 1T14A 1LKJA 2E6WA 2F2PA 2WC5A 1LS8A 3O4YA 5CPVA 2R2IA 3KF9A 1OOJA 2CTNA 2KPHA 2LMTA 3CWGA 1BF5A 5HL1A 1DJWA 1YUUA 2ZKMX 3I5IB 4OZDA 1QJTA 1B7TZ 2LCPA 1XO5A 4PHKA 3VROA 4DCKA 1SYMA 3KHEA 4PALA 1V1GA 3M0WA 2LVKA 4N1GA 1MQ1A 4USLA 4CFRA 3VRPA 1OOHA 3S0BA 3V2LA 3HCMA 3R1PA 1DGUA 2MA2A 1TUZA 2K60A 1QLSA 1K9KA 1PSBA 2GV5A 5FI2A 4PCWA 4WQ2A 2GTEA 1PALA 3A8RA 1A2XA 2GGZA 2I7AA 2NCPA 1B4CA 1ALVA 2KHNA 1F4QA 1JC2A 1GGZA 2KNEA 3A4UB 2KQ6A 1KK7Y 2KBMA 1SL7A 1Q80A 2BECA 3DVMA 4PE7A 5F6TA 2K7OA 3I5HC 1A4PA 1BG1A 1CNPA 5J3XA 1NYAA 4MBEA 2MLEC 1G8IA 2CBLA 1SW8A 1ZOTB 3VGOA 3LK0A 4GGFA 3S0FA 3BOWB 3H4SE 4D1EA 4GPLB 2M7LA 3WNXB 1K2HA 2COLB 3UNWA 2QEOA 3NHIA 3SG7A 2JT8A 3PN7B 1W7JB 3CDNA 1TWOA 1AJ4A 2NCOA 1K8UA 2KGRA 1F4OA 2LE9B 1PVAA 4C0JA 2WCJA 1JF2A 1SSEB 2HQ8A 3KPXA 1WRKA 3SG3A 2LVVA 1K95A 1EL4A 3NSOA 5D69A 1J7OA 1LA3A 5ER4X 2LVIA 1NSHA 4ORBB 4TNCA 1CMFA 1DJYA 2M7NA 4JQ0D 3NSKA 1JBAA 2LVJA 3D0YA 4AQJA 1FW4A 5KU1A 2CT9A 2K8MB 2K0JA 3EG5B 3RM1A 2F8PA 3CABA 3I5GC 2BNXA 1CFCA 1B47A 4DS7A 2M97A 1XFRA 5KTYA 1KSMA 2QPTA 3WXAA 3E3RA 2GGMA 2BBMA 2LMVA 2JWWA 4IJ7A 3CYZA 2KLEA 3FE8A 1WLZA 2L4IA 2KI4B 1S3PA 2KSPA 2SASA 3BYAA 3D74A 4ORCB 4IL1A 4MZJA 4F7FA 4WRIA 3EVVA 2PVBA 3D78A 1RWYA 4AOMA 1K90D 3PN7C 4I5LB 1CLMA 1J1DA 4P2YB 1OE9B 4QJ4B 1B8LA 4ZCVA 5BPJA 3BFHA 5CSNA 1S6IA 2H2KA 2JULA 1UURA 3L4AA 4ZCUA 2PASA 4MZLA 4JKTA 1NIWA 1NX2A 4YGDB 2WNDA 3JTDC 3VB1A 4JPZB 1MWNA 4R1EA 1A75A 1BR1B 4HSZA 4U8DA 4WQ3A 2BBNA 5FI6A 3SS5A 1F8HA 1S6JA 3EVRA 2JRFA 1CDMA 2M1UA 4GGFC 4BY4A 1KQVA 2AAOA 1EG4A 5D7FA 1K93D 1UHHA 2OTGC 3EK4A 4KYNA 5DKRA 3ZNIA 3IVTA 4QJ3B 1DF0B 2MJWB 3FE6A 4YGCB 1MF8B 5AERA 2WCKA 1CKKA 2LP3A 3NHTA 3TDUA 1CTRA 3GK1A 5IBWA 3BFBA 4M2QA 5JOLA 1FF1A 2WOSA 2IS9A 3SS4A 5FI7A 1JUOA 1KQMB 2P6BB 1CLLA 3NSLA 1KK8B 1CM4A 4NDDA 1BODA 3B6XA 3CZ0A 4PE1A 5G08A 3ZWHA 1FBVA 1CDPA 1QV0A 3AKBA 3GK4X 5HYDA 1ZUZA 2WCMA 1SKTA 3O78A 2PALA 1LVCD 3I5FC 1IQ3A 1XVJA 1OZOA 1FI5A 3PJIA 2M49B 1CFPA 3D75A 1YX7A 4DRWA 5I2QA 2KAXA 4A4CA 2Q91A 3K1EA 3TDIA 4GFTA 1CM1A 4OV2A 4XYNA 1KFUS 2ISDA 2BCBA 3BOWA 5AXIA 1IJ5A 2QEBA 1OZSA 2O5GA 3EK8A 1RFJA 1KSOA 1CDNA 2LUCA 4ICBA 2FCEA 4F0ZB 1YRUB 4A4BA 1TCOB 3DYEA 4DIRA 1BMOA 2BL0B 4E68A 1WY9A 1CB1A 1NWDA 4C0LA 3BJHA 2BKHB 2WC6A 3SG4A 1Z4HA 1DTLA 1TNWA 3S0AA 2WORA 2B1UA 1DMOA 1M31A 1DJZA 1BJFA 1A03A 1XFXO 2PRUA 1PK0D 2WCLA 1IJ6A 1KQMC 2D8NA 2I94A 1TTXA 3BUMB 2JNXA 2WCBA 1XFUO 2KAYA 1ZACA 3SIBA 1WDCB 1YTZC 1SL9A 2BE6A 1MUXA 3IF7A 3FE9A 1QTXA 2I2RE 2JTTA 2P70A 4OKHA 3OX6A 2KFHA 3FS7A 2NZ0A 1C07A 1XFVO 4GAOA 1BLQA 1TOPA 1TNPA 5I8NA 1YVLA 2V53A 1Y1UA 1S5GY
chains in the Genus database with same CATH topology
3I5IC 2LHIA 1BU3A 2SCPA 1M46A 1QATA 1R6PA 2KI6D 4PHJA 1YRTB 4OCIA 3VRQA 1B9AA 1HT9A 5CSJA 4N1FA 3FIAA 5JJGA 1QX5B 1OMRA 4GBAA 1QX7A 3VRRA 3SG2A 2LLTA 1CFDA 2PMYA 3BUOB 2BL0C 4OR9B 2KQYA 2K7BA 2F2OA 2LNKA 3SIAA 5FYXA 5HLVA 3NSIA 2CCMA 1QVIY 1R2UA 2Y1MA 4YGBB 1C7VA 1EH2A 1SR6B 1QXPA 2PSRA 2I18A 3DVKA 1EJ3A 1N65A 2BCXA 2M3WA 2ZNEA 2Q4UA 3BQ3A 4N5XA 4PDZA 1N2DA 2QACA 1H8BA 4M2PA 1OSAA 2ZN8A 1WDCC 1DF0A 1KFXL 1QX2A 4ORAB 3AAKA 1YUTA 2JTZA 2HF5A 3K21A 2KYFA 5PALA 1B7TY 2KGBC 2M1KB 1BT6A 1DVIA 3KO0A 1QS7A 1SCMB 4ETOA 2FJUB 1JFJA 3BUXB 1H4BA 3CTNA 1ODBA 5KSZA 5HKZA 2Y5IA 4I5JA 2WCFA 1G33A 4GGNA 2OS8B 4CPVA 1NPQA 2NLNA 3CR2A 2K2FA 1BOCA 2JT3A 1Y1AA 1KK7Z 3OB1B 1F71A 2KDHA 2AMIA 4YI8A 5CSFA 2KYCA 3TUYB 1KCYA 4MRYA 1TIZA 1TNXA 1OMVA 1NCZA 3BXKA 3NXAA 4CIDA 3JVTB 3O2PA 1NX0A 2LMUA 4MEWA 2TN4A 2EHBA 2KI6C 5TNCA 1DT7B 2CXJA 1DJGA 5DKQA 2JPTA 4P5OE 4HRHA 1AK8A 1S36A 1FI6A 1YUSA 4HREE 3TS5B 1EG3A 1GGWA 4NDBA 3EKJA 1MXEA 1M45A 3KEVA 2MBXA 1NCXA 2KI4C 1J7PA 4MZKA 1XYDA 1VRKA 1K96A 5AFPA 2K61A 3LK1A 1NCYA 1RK9A 3WHTB 1B1GA 1SCMC 3PATA 1MXLC 2VRGA 4L9MA 1AP4A 1PVBA 2L51A 4YGEB 4GUKA 1QV1A 2EC6B 1QLKA 1TN4A 2G2BA 1F54A 2M0RA 4QJ5B 3OP0A 4YRUA 1XK4A 3FWBA 1YX8A 4AQIA 1AUIB 1SPYA 1KFXS 1GQMA 1WRZA 1NX1A 2LM5A 2Y1NA 3TUYC 2LLUA 3DVJA 1RJVA 3TZ1A 1IQ5A 1J1EA 3PFVA 3JVTC 1OMDA 3VRNA 1LINA 2L50A 1V1FA 1IWQA 3OX5A 4FTGA 4OVNF 3RLZA 1PULA 1CMGA 3F45A 1B8RA 1W7IB 2CNPA 4MLWA 1KWOB 2FCDA 3PLFB 4MN0A 3SG6A 1NP8A 4NQGA 2K2AA 1S26D 1U5IA 2L4HA 3LLEA 3PM8A 5GQQC 1DGVA 2L0PA 5HLOA 3TS5C 2JXLA 1TCFA 1KK8C 2LP2A 2K7CA 4I5KA 4YBHB 4PE0A 1RROA 1ALWA 1QIVA 1SK6D 4I5NB 2E30A 1JF0A 4PE4A 2RGIA 5K89A 2K7DA 3HX4A 5B8IB 2O60A 5AEQA 2JT0A 1MHOA 2F33A 2AUCA 2LLSA 1S6CA 3CGAA 2ZRSA 1A29A 1SMGA 1DJXA 3I5GB 4MRXA 4YGAA 1AVSA 1C7WA 1SCVA 2EC6C 1XFWO 2F3YA 3CZTX 1WLMA 2Y4QA 1IKUA 1U5IB 1DJHA 1B8CA 5AANA 3O6BA 2ZNDA 2LANA 3CLNA 4CLNA 1G4YR 5HKYA 1X02A 1SY9A 1IH0A 3PSRA 1M39A 3AKAA 1HQVA 1L7ZA 1XFZO 2H61A 1RTP1 3CR4X 3IQOA 3LL8B 4GNKB 1OQPA 4HRGA 1KWOC 2KOTA 3JTDB 1IRJA 1XA5A 3CS1A 4PHMA 2A4JA 3GK2A 1QIWA 1XK4C 3BUWB 2JZIA 3FWCA 2OPOA 1K9UA 3IQQA 2MRDA 1SRAA 1UHJA 1NX3A 2HETA 2OTGB 3ICBA 1M63B 1E8AA 3SG5A 1S1EA 2ZRTA 3TDZA 1GJYA 2JQ6A 1D1OA 2JOJA 1PRWA 1Y1XA 1DJIA 2KBIA 1RECA 3D10A 2DOQA 1AJ5A 1AHRA 3BUNB 3C1VA 1F55A 2F3ZA 1K94A 1UHKA 2HQWA 3DF0A 2KFGA 1QASA 2ZFDA 1SBJA 1JFKA 1UWOA 2JC2A 1YR5A 4XJKA 1EXRA 5I2LA 2WC8A 3SJSA 3DD4A 1KFUL 1TRFA 4NDCA 1ZMZA 4MVFA 2JXCA 3WHUB 1IGVA 1WRLA 3EVUA 5ER5A 4BY5A 1L2OB 1XFYO 2L98A 3GOFA 2MLFC 1UUSA 3PALA 4FQOA 2M9GA 1LA0A 2JU0A 1J55A 2BE4A 3I5FB 3D0YB 4MSPA 4C0KA 2G9BA 5HKWA 1Y6WA 2NXQA 2WCEA 1PSRA 1YURA 2MHHA 4DUQA 2L5XB 2BCAA 4CFQA 1TNQA 4YI9A 1UP5A 2M8UA 3DF0B 1CDLA 1SR6C 2LUXA 3EK7A 5CSIA 1S5GZ 2LV7A 5DKNA 4PHNA 1JSAA 2LAPA 1Y0VH 1FPWA 4XJKB 2M29A 2HPSA 2LC5A 3OB2B 2EGDA 3CR5X 2KAVA 2L2EA 5I2OA 1J7QA 1K9PA 1IG5A 4M2OA 1NUBA 2ZN9A 3MSEB 2H61C 3LCPC 2JNFA 1MR8A 1UHIA 2LHLA 3QRXA 4JWQA 3AAJA 2OS8C 2MAZA 3I5HB 1ZFSA 3DVEA 1LXFC 1N0YA 3OHMB 1QVIZ 4Q04A 1UHNA 1A75B 1BR4B 1YVHA 2FOTA 2KFFA 3EKHA 1SL8A 2BKIB 1CLBA 4UPGA 1F70A 1J7RA 1SNLA 1L2OC 1CFFA 1JWDA 1LKJA 2E6WA 2F2PA 3O4YA 5CPVA 2R2IA 3KF9A 1OOJA 2CTNA 2LMTA 3CWGA 1BF5A 1DJWA 1YUUA 2ZKMX 3I5IB 1QJTA 1B7TZ 2LCPA 1XO5A 4PHKA 3VROA 4DCKA 1SYMA 3KHEA 4PALA 1V1GA 3M0WA 2LVKA 4N1GA 1MQ1A 4USLA 4CFRA 3VRPA 3HCMA 1DGUA 2MA2A 1QLSA 1K9KA 1PSBA 2GV5A 4PCWA 4WQ2A 1PALA 3A8RA 1A2XA 2GGZA 2I7AA 2NCPA 1B4CA 1ALVA 2KHNA 1F4QA 1JC2A 1GGZA 2KNEA 3A4UB 2KQ6A 1KK7Y 2KBMA 2BECA 1SL7A 1Q80A 3DVMA 4PE7A 5F6TA 2K7OA 3I5HC 1A4PA 1BG1A 1CNPA 5J3XA 1NYAA 4MBEA 2MLEC 1G8IA 2CBLA 1SW8A 1ZOTB 3VGOA 3LK0A 4GGFA 3BOWB 3H4SE 4D1EA 4GPLB 2M7LA 3WNXB 1K2HA 2COLB 3SG7A 2JT8A 3PN7B 1W7JB 1AJ4A 2NCOA 1K8UA 2KGRA 1F4OA 2LE9B 1PVAA 4C0JA 1JF2A 2HQ8A 3KPXA 1WRKA 3SG3A 2LVVA 1K95A 1EL4A 3NSOA 5D69A 1J7OA 1LA3A 5ER4X 2LVIA 1NSHA 4ORBB 4TNCA 1CMFA 1DJYA 2M7NA 4JQ0D 3NSKA 1JBAA 2LVJA 3D0YA 4AQJA 1FW4A 5KU1A 2CT9A 2K8MB 2K0JA 3RM1A 2F8PA 3I5GC 1CFCA 1B47A 4DS7A 2M97A 5KTYA 1KSMA 2QPTA 3WXAA 3E3RA 2GGMA 2BBMA 2LMVA 2JWWA 1WLZA 2L4IA 2KI4B 1S3PA 2KSPA 2SASA 3BYAA 4ORCB 4IL1A 4MZJA 4WRIA 3EVVA 2PVBA 4AOMA 1RWYA 1K90D 3PN7C 4I5LB 1CLMA 1J1DA 4P2YB 1OE9B 4QJ4B 1B8LA 4ZCVA 5BPJA 5CSNA 1S6IA 2H2KA 2JULA 1UURA 4ZCUA 2PASA 4MZLA 1NIWA 1NX2A 4YGDB 2WNDA 3JTDC 4JPZB 1MWNA 4R1EA 1A75A 1BR1B 4HSZA 4U8DA 4WQ3A 2BBNA 1F8HA 1S6JA 3EVRA 2JRFA 1CDMA 2M1UA 4GGFC 4BY4A 1KQVA 2AAOA 1EG4A 5D7FA 1K93D 1UHHA 2OTGC 3EK4A 3ZNIA 5DKRA 4QJ3B 1DF0B 2MJWB 4YGCB 5AERA 1MF8B 1CKKA 2LP3A 3TDUA 1CTRA 3GK1A 5IBWA 4M2QA 1FF1A 5JOLA 2WOSA 2IS9A 1JUOA 1KQMB 2P6BB 1CLLA 3NSLA 1KK8B 1CM4A 4NDDA 1BODA 4PE1A 5G08A 3ZWHA 1FBVA 1CDPA 1QV0A 3AKBA 3GK4X 5HYDA 1ZUZA 1SKTA 3O78A 2PALA 1LVCD 3I5FC 1IQ3A 1XVJA 1OZOA 1FI5A 2M49B 1CFPA 1YX7A 4DRWA 5I2QA 2KAXA 4A4CA 2Q91A 3TDIA 4GFTA 1CM1A 4OV2A 4XYNA 1KFUS 2ISDA 2BCBA 3BOWA 5AXIA 1IJ5A 1OZSA 2O5GA 3EK8A 1RFJA 1KSOA 1CDNA 2LUCA 4ICBA 2FCEA 4F0ZB 1YRUB 4A4BA 1TCOB 4DIRA 1BMOA 2BL0B 4E68A 1WY9A 1CB1A 1NWDA 4C0LA 2BKHB 3SG4A 1DTLA 1TNWA 2WORA 2B1UA 1DMOA 1M31A 1DJZA 1BJFA 1A03A 1XFXO 2PRUA 1PK0D 1IJ6A 1KQMC 2D8NA 2I94A 1TTXA 3BUMB 2JNXA 2WCBA 1XFUO 2KAYA 1ZACA 3SIBA 1WDCB 1YTZC 1SL9A 2BE6A 1MUXA 3IF7A 1QTXA 2I2RE 2JTTA 4OKHA 3OX6A 2KFHA 3FS7A 2NZ0A 1C07A 1XFVO 4GAOA 1BLQA 1TOPA 1TNPA 5I8NA 1YVLA 2V53A 1Y1UA 1S5GY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5I C;  2LHI A;  1BU3 A;  2SCP A;  1M46 A;  1QAT A;  1R6P A;  2KI6 D;  4PHJ A;  1YRT B;  4OCI A;  3VRQ A;  1B9A A;  1HT9 A;  5CSJ A;  4N1F A;  3FIA A;  5JJG A;  1QX5 B;  1OMR A;  4GBA A;  1QX7 A;  3VRR A;  3SG2 A;  2LLT A;  1CFD A;  2PMY A;  3BUO B;  2BL0 C;  4OR9 B;  2KQY A;  2K7B A;  2F2O A;  2LNK A;  3SIA A;  5FYX A;  5HLV A;  3NSI A;  2CCM A;  1QVI Y;  1R2U A;  2Y1M A;  4YGB B;  1C7V A;  1EH2 A;  1SR6 B;  1QXP A;  2PSR A;  2I18 A;  3DVK A;  1EJ3 A;  1N65 A;  2BCX A;  2M3W A;  2ZNE A;  2Q4U A;  3BQ3 A;  4N5X A;  4PDZ A;  1N2D A;  2QAC A;  1H8B A;  4M2P A;  1OSA A;  2ZN8 A;  1WDC C;  1DF0 A;  1KFX L;  1QX2 A;  4ORA B;  3AAK A;  1YUT A;  2JTZ A;  2HF5 A;  3K21 A;  2KYF A;  5PAL A;  1B7T Y;  2KGB C;  2M1K B;  1BT6 A;  1DVI A;  3KO0 A;  1QS7 A;  1SCM B;  4ETO A;  2FJU B;  1JFJ A;  3BUX B;  1H4B A;  3CTN A;  1ODB A;  5KSZ A;  5HKZ A;  2Y5I A;  4I5J A;  2WCF A;  1G33 A;  4GGN A;  2OS8 B;  4CPV A;  1NPQ A;  2NLN A;  3CR2 A;  2K2F A;  1BOC A;  2JT3 A;  1Y1A A;  1KK7 Z;  3OB1 B;  1F71 A;  2KDH A;  2AMI A;  4YI8 A;  5CSF A;  2KYC A;  3TUY B;  1KCY A;  4MRY A;  1TIZ A;  1TNX A;  1OMV A;  1NCZ A;  3BXK A;  3NXA A;  4CID A;  3JVT B;  3O2P A;  1NX0 A;  2LMU A;  4MEW A;  2TN4 A;  2EHB A;  2KI6 C;  5TNC A;  1DT7 B;  2CXJ A;  1DJG A;  5DKQ A;  2JPT A;  4P5O E;  4HRH A;  1AK8 A;  1S36 A;  1FI6 A;  1YUS A;  4HRE E;  3TS5 B;  1EG3 A;  1GGW A;  4NDB A;  3EKJ A;  1MXE A;  1M45 A;  3KEV A;  2MBX A;  1NCX A;  2KI4 C;  1J7P A;  4MZK A;  1XYD A;  1VRK A;  1K96 A;  5AFP A;  2K61 A;  3LK1 A;  1NCY A;  1RK9 A;  3WHT B;  1B1G A;  1SCM C;  3PAT A;  1MXL C;  2VRG A;  4L9M A;  1AP4 A;  1PVB A;  2L51 A;  4YGE B;  4GUK A;  1QV1 A;  2EC6 B;  1QLK A;  1TN4 A;  2G2B A;  1F54 A;  2M0R A;  4QJ5 B;  3OP0 A;  4YRU A;  1XK4 A;  3FWB A;  1YX8 A;  4AQI A;  1AUI B;  1SPY A;  1KFX S;  1GQM A;  1WRZ A;  1NX1 A;  2LM5 A;  2Y1N A;  3TUY C;  2LLU A;  3DVJ A;  1RJV A;  3TZ1 A;  1IQ5 A;  1J1E A;  3PFV A;  3JVT C;  1OMD A;  3VRN A;  1LIN A;  2L50 A;  1V1F A;  1IWQ A;  3OX5 A;  4FTG A;  4OVN F;  3RLZ A;  1PUL A;  1CMG A;  3F45 A;  1B8R A;  1W7I B;  2CNP A;  4MLW A;  1KWO B;  2FCD A;  3PLF B;  4MN0 A;  3SG6 A;  1NP8 A;  4NQG A;  2K2A A;  1S26 D;  1U5I A;  2L4H A;  3LLE A;  3PM8 A;  5GQQ C;  1DGV A;  2L0P A;  5HLO A;  3TS5 C;  2JXL A;  1TCF A;  1KK8 C;  2LP2 A;  2K7C A;  4I5K A;  4YBH B;  4PE0 A;  1RRO A;  1ALW A;  1QIV A;  1SK6 D;  4I5N B;  2E30 A;  1JF0 A;  4PE4 A;  2RGI A;  5K89 A;  2K7D A;  3HX4 A;  5B8I B;  2O60 A;  5AEQ A;  2JT0 A;  1MHO A;  2F33 A;  2AUC A;  2LLS A;  1S6C A;  3CGA A;  2ZRS A;  1A29 A;  1SMG A;  1DJX A;  3I5G B;  4MRX A;  4YGA A;  1AVS A;  1C7W A;  1SCV A;  2EC6 C;  1XFW O;  2F3Y A;  3CZT X;  1WLM A;  2Y4Q A;  1IKU A;  1U5I B;  1DJH A;  1B8C A;  5AAN A;  3O6B A;  2ZND A;  2LAN A;  3CLN A;  4CLN A;  1G4Y R;  5HKY A;  1X02 A;  1SY9 A;  1IH0 A;  3PSR A;  1M39 A;  3AKA A;  1HQV A;  1L7Z A;  1XFZ O;  2H61 A;  1RTP 1;  3CR4 X;  3IQO A;  3LL8 B;  4GNK B;  1OQP A;  4HRG A;  1KWO C;  2KOT A;  3JTD B;  1IRJ A;  1XA5 A;  3CS1 A;  4PHM A;  2A4J A;  3GK2 A;  1QIW A;  1XK4 C;  3BUW B;  2JZI A;  3FWC A;  2OPO A;  1K9U A;  3IQQ A;  2MRD A;  1SRA A;  1UHJ A;  1NX3 A;  2HET A;  2OTG B;  3ICB A;  1M63 B;  1E8A A;  3SG5 A;  1S1E A;  2ZRT A;  3TDZ A;  1GJY A;  2JQ6 A;  1D1O A;  2JOJ A;  1PRW A;  1Y1X A;  1DJI A;  2KBI A;  1REC A;  3D10 A;  2DOQ A;  1AJ5 A;  1AHR A;  3BUN B;  3C1V A;  1F55 A;  2F3Z A;  1K94 A;  1UHK A;  2HQW A;  3DF0 A;  2KFG A;  1QAS A;  2ZFD A;  1SBJ A;  1JFK A;  1UWO A;  2JC2 A;  1YR5 A;  4XJK A;  1EXR A;  5I2L A;  2WC8 A;  3SJS A;  3DD4 A;  1KFU L;  1TRF A;  4NDC A;  1ZMZ A;  4MVF A;  2JXC A;  3WHU B;  1IGV A;  1WRL A;  3EVU A;  5ER5 A;  4BY5 A;  1L2O B;  1XFY O;  2L98 A;  3GOF A;  2MLF C;  1UUS A;  3PAL A;  4FQO A;  2M9G A;  1LA0 A;  2JU0 A;  1J55 A;  2BE4 A;  3I5F B;  3D0Y B;  4MSP A;  4C0K A;  2G9B A;  5HKW A;  1Y6W A;  2NXQ A;  2WCE A;  1PSR A;  1YUR A;  2MHH A;  4DUQ A;  2L5X B;  2BCA A;  4CFQ A;  1TNQ A;  4YI9 A;  1UP5 A;  2M8U A;  3DF0 B;  1CDL A;  1SR6 C;  2LUX A;  3EK7 A;  5CSI A;  1S5G Z;  2LV7 A;  5DKN A;  4PHN A;  1JSA A;  2LAP A;  1Y0V H;  1FPW A;  4XJK B;  2M29 A;  2HPS A;  2LC5 A;  3OB2 B;  2EGD A;  3CR5 X;  2KAV A;  2L2E A;  5I2O A;  1J7Q A;  1K9P A;  1IG5 A;  4M2O A;  1NUB A;  2ZN9 A;  3MSE B;  2H61 C;  3LCP C;  2JNF A;  1MR8 A;  1UHI A;  2LHL A;  3QRX A;  4JWQ A;  3AAJ A;  2OS8 C;  2MAZ A;  3I5H B;  1ZFS A;  3DVE A;  1LXF C;  1N0Y A;  3OHM B;  1QVI Z;  4Q04 A;  1UHN A;  1A75 B;  1BR4 B;  1YVH A;  2FOT A;  2KFF A;  3EKH A;  1SL8 A;  2BKI B;  1CLB A;  4UPG A;  1F70 A;  1J7R A;  1SNL A;  1L2O C;  1CFF A;  1JWD A;  1LKJ A;  2E6W A;  2F2P A;  3O4Y A;  5CPV A;  2R2I A;  3KF9 A;  1OOJ A;  2CTN A;  2LMT A;  3CWG A;  1BF5 A;  1DJW A;  1YUU A;  2ZKM X;  3I5I B;  1QJT A;  1B7T Z;  2LCP A;  1XO5 A;  4PHK A;  3VRO A;  4DCK A;  1SYM A;  3KHE A;  4PAL A;  1V1G A;  3M0W A;  2LVK A;  4N1G A;  1MQ1 A;  4USL A;  4CFR A;  3VRP A;  3HCM A;  1DGU A;  2MA2 A;  1QLS A;  1K9K A;  1PSB A;  2GV5 A;  4PCW A;  4WQ2 A;  1PAL A;  3A8R A;  1A2X A;  2GGZ A;  2I7A A;  2NCP A;  1B4C A;  1ALV A;  2KHN A;  1F4Q A;  1JC2 A;  1GGZ A;  2KNE A;  3A4U B;  2KQ6 A;  1KK7 Y;  2KBM A;  2BEC A;  1SL7 A;  1Q80 A;  3DVM A;  4PE7 A;  5F6T A;  2K7O A;  3I5H C;  1A4P A;  1BG1 A;  1CNP A;  5J3X A;  1NYA A;  4MBE A;  2MLE C;  1G8I A;  2CBL A;  1SW8 A;  1ZOT B;  3VGO A;  3LK0 A;  4GGF A;  3BOW B;  3H4S E;  4D1E A;  4GPL B;  2M7L A;  3WNX B;  1K2H A;  2COL B;  3SG7 A;  2JT8 A;  3PN7 B;  1W7J B;  1AJ4 A;  2NCO A;  1K8U A;  2KGR A;  1F4O A;  2LE9 B;  1PVA A;  4C0J A;  1JF2 A;  2HQ8 A;  3KPX A;  1WRK A;  3SG3 A;  2LVV A;  1K95 A;  1EL4 A;  3NSO A;  5D69 A;  1J7O A;  1LA3 A;  5ER4 X;  2LVI A;  1NSH A;  4ORB B;  4TNC A;  1CMF A;  1DJY A;  2M7N A;  4JQ0 D;  3NSK A;  1JBA A;  2LVJ A;  3D0Y A;  4AQJ A;  1FW4 A;  5KU1 A;  2CT9 A;  2K8M B;  2K0J A;  3RM1 A;  2F8P A;  3I5G C;  1CFC A;  1B47 A;  4DS7 A;  2M97 A;  5KTY A;  1KSM A;  2QPT A;  3WXA A;  3E3R A;  2GGM A;  2BBM A;  2LMV A;  2JWW A;  1WLZ A;  2L4I A;  2KI4 B;  1S3P A;  2KSP A;  2SAS A;  3BYA A;  4ORC B;  4IL1 A;  4MZJ A;  4WRI A;  3EVV A;  2PVB A;  4AOM A;  1RWY A;  1K90 D;  3PN7 C;  4I5L B;  1CLM A;  1J1D A;  4P2Y B;  1OE9 B;  4QJ4 B;  1B8L A;  4ZCV A;  5BPJ A;  5CSN A;  1S6I A;  2H2K A;  2JUL A;  1UUR A;  4ZCU A;  2PAS A;  4MZL A;  1NIW A;  1NX2 A;  4YGD B;  2WND A;  3JTD C;  4JPZ B;  1MWN A;  4R1E A;  1A75 A;  1BR1 B;  4HSZ A;  4U8D A;  4WQ3 A;  2BBN A;  1F8H A;  1S6J A;  3EVR A;  2JRF A;  1CDM A;  2M1U A;  4GGF C;  4BY4 A;  1KQV A;  2AAO A;  1EG4 A;  5D7F A;  1K93 D;  1UHH A;  2OTG C;  3EK4 A;  3ZNI A;  5DKR A;  4QJ3 B;  1DF0 B;  2MJW B;  4YGC B;  5AER A;  1MF8 B;  1CKK A;  2LP3 A;  3TDU A;  1CTR A;  3GK1 A;  5IBW A;  4M2Q A;  1FF1 A;  5JOL A;  2WOS A;  2IS9 A;  1JUO A;  1KQM B;  2P6B B;  1CLL A;  3NSL A;  1KK8 B;  1CM4 A;  4NDD A;  1BOD A;  4PE1 A;  5G08 A;  3ZWH A;  1FBV A;  1CDP A;  1QV0 A;  3AKB A;  3GK4 X;  5HYD A;  1ZUZ A;  1SKT A;  3O78 A;  2PAL A;  1LVC D;  3I5F C;  1IQ3 A;  1XVJ A;  1OZO A;  1FI5 A;  2M49 B;  1CFP A;  1YX7 A;  4DRW A;  5I2Q A;  2KAX A;  4A4C A;  2Q91 A;  3TDI A;  4GFT A;  1CM1 A;  4OV2 A;  4XYN A;  1KFU S;  2ISD A;  2BCB A;  3BOW A;  5AXI A;  1IJ5 A;  1OZS A;  2O5G A;  3EK8 A;  1RFJ A;  1KSO A;  1CDN A;  2LUC A;  4ICB A;  2FCE A;  4F0Z B;  1YRU B;  4A4B A;  1TCO B;  4DIR A;  1BMO A;  2BL0 B;  4E68 A;  1WY9 A;  1CB1 A;  1NWD A;  4C0L A;  2BKH B;  3SG4 A;  1DTL A;  1TNW A;  2WOR A;  2B1U A;  1DMO A;  1M31 A;  1DJZ A;  1BJF A;  1A03 A;  1XFX O;  2PRU A;  1PK0 D;  1IJ6 A;  1KQM C;  2D8N A;  2I94 A;  1TTX A;  3BUM B;  2JNX A;  2WCB A;  1XFU O;  2KAY A;  1ZAC A;  3SIB A;  1WDC B;  1YTZ C;  1SL9 A;  2BE6 A;  1MUX A;  3IF7 A;  1QTX A;  2I2R E;  2JTT A;  4OKH A;  3OX6 A;  2KFH A;  3FS7 A;  2NZ0 A;  1C07 A;  1XFV O;  4GAO A;  1BLQ A;  1TOP A;  1TNP A;  5I8N A;  1YVL A;  2V53 A;  1Y1U A;  1S5G Y; 
#chains in the Genus database with same CATH topology
 3I5I C;  2LHI A;  1BU3 A;  2SCP A;  1M46 A;  3L47 A;  1QAT A;  1DEL A;  1R6P A;  2KI6 D;  4PHJ A;  1YRT B;  3R72 A;  4OCI A;  3VRQ A;  1B9A A;  1HT9 A;  3CZ2 A;  5CSJ A;  4N1F A;  3FIA A;  5JJG A;  1QX5 B;  1OMR A;  5EL2 A;  4GBA A;  1QX7 A;  3VRR A;  3SG2 A;  2LLT A;  1CFD A;  2PMY A;  2YGU A;  3BUO B;  2BL0 C;  4OR9 B;  3R1V A;  2JPO A;  2KQY A;  2K7B A;  2F2O A;  2LNK A;  3OBV A;  3SIA A;  5FYX A;  5HLV A;  3NSI A;  4PT1 A;  2CCM A;  1QVI Y;  1R2U A;  2Y1M A;  4YGB B;  1C7V A;  1EH2 A;  1SR6 B;  1QXP A;  2PSR A;  2I18 A;  3DVK A;  1EJ3 A;  1N65 A;  2BCX A;  2M3W A;  1W9Z A;  2ZNE A;  2Q4U A;  3BQ3 A;  2BAP A;  1TUJ A;  1N2D A;  2QAC A;  4N5X A;  4M2P A;  4PDZ A;  1OSA A;  2ZN8 A;  1WDC C;  1DF0 A;  1KFX L;  1QX2 A;  4ORA B;  3AAK A;  1YUT A;  2JTZ A;  2HF5 A;  3B7A A;  3K21 A;  2KYF A;  2QEV A;  5PAL A;  1B7T Y;  2KGB C;  1OOI X;  2M1K B;  1BT6 A;  2FJY A;  3N7H A;  3SS3 A;  1DVI A;  3KO0 A;  1QS7 A;  1SCM B;  4ETO A;  2FJU B;  1JFJ A;  3BUX B;  1H4B A;  3CTN A;  1ODB A;  5KSZ A;  5HKZ A;  2Y5I A;  4I5J A;  2WCF A;  1G33 A;  4GGN A;  2OS8 B;  4CPV A;  1NPQ A;  2NLN A;  3CR2 A;  2K2F A;  1BOC A;  2JT3 A;  1Y1A A;  1KK7 Z;  3OB1 B;  1F71 A;  2KDH A;  2AMI A;  4YI8 A;  5D3O A;  5CSF A;  2KYC A;  3TUY B;  1KCY A;  4MRY A;  1TIZ A;  1TNX A;  1OMV A;  1NCZ A;  3BXK A;  3NXA A;  4CID A;  3JVT B;  3O2P A;  1NX0 A;  2LMU A;  3B88 A;  4MEW A;  2TN4 A;  2EHB A;  3RZS A;  2KI6 C;  3BFA A;  5TNC A;  1DT7 B;  2CXJ A;  1P28 A;  1DJG A;  5DKQ A;  2JPT A;  3NGV A;  4HRH A;  4P5O E;  1S36 A;  1AK8 A;  1FI6 A;  1OOF A;  1YUS A;  4HRE E;  3TS5 B;  1EG3 A;  1GGW A;  4NDB A;  3EKJ A;  1MXE A;  1M45 A;  3KEV A;  2MBX A;  1NCX A;  2KI4 C;  1J7P A;  4MZK A;  1XYD A;  1VRK A;  1K96 A;  5AFP A;  2K61 A;  3LK1 A;  1NCY A;  1RK9 A;  3WHT B;  1B1G A;  1SCM C;  3PAT A;  1MXL C;  2VRG A;  4L9M A;  1AP4 A;  1PVB A;  2L51 A;  4YGE B;  4GUK A;  1QV1 A;  2EC6 B;  1QLK A;  1TN4 A;  2WCH A;  2G2B A;  1F54 A;  2M0R A;  4QJ5 B;  3OP0 A;  4YRU A;  1XK4 A;  3FWB A;  2QDI A;  1YX8 A;  4AQI A;  1AUI B;  2L2C A;  1SPY A;  1KFX S;  1GQM A;  1WRZ A;  1NX1 A;  2LM5 A;  2Y1N A;  3TUY C;  2LLU A;  3DVJ A;  1RJV A;  3DXL A;  3TZ1 A;  1IQ5 A;  1J1E A;  3PFV A;  3JVT C;  1OMD A;  3VRN A;  5I94 A;  1LIN A;  2L50 A;  1V1F A;  1IWQ A;  3OX5 A;  4FTG A;  4OVN F;  3RLZ A;  1PUL A;  1CMG A;  3F45 A;  1B8R A;  1W7I B;  2CNP A;  4MLW A;  1KWO B;  2FCD A;  3PLF B;  2P71 A;  4MN0 A;  3SG6 A;  1NP8 A;  3DZT A;  1C3Z A;  2K2A A;  1S26 D;  1U5I A;  2L4H A;  3LLE A;  3PM8 A;  4NQG A;  1DGV A;  5GQQ C;  2L0P A;  2QEH A;  5HLO A;  3TS5 C;  2JXL A;  1TCF A;  1KK8 C;  3DY9 A;  2LP2 A;  2K7C A;  4I5K A;  4YBH B;  4PE0 A;  1RRO A;  1OW4 A;  1ALW A;  1QIV A;  1SK6 D;  4I5N B;  2E30 A;  1JF0 A;  4PE4 A;  2RGI A;  5K89 A;  2K7D A;  3HX4 A;  5B8I B;  2O60 A;  5AEQ A;  3B86 A;  3PM2 A;  2JT0 A;  3OGN A;  1MHO A;  2F33 A;  2AUC A;  3S0D A;  2LLS A;  1S6C A;  3CGA A;  2ZRS A;  1A29 A;  1SMG A;  2ERB A;  3QME A;  1DJX A;  3I5G B;  4MRX A;  4YGA A;  1AVS A;  1C7W A;  1SCV A;  2EC6 C;  1XFW O;  2F3Y A;  3CZT X;  3D76 A;  1WLM A;  1OOG A;  2Y4Q A;  1IKU A;  1U5I B;  3B87 A;  1DJH A;  1B8C A;  5AAN A;  3O6B A;  2ZND A;  2LAN A;  3CLN A;  3S0G A;  1G4Y R;  4CLN A;  5HKY A;  1X02 A;  1SY9 A;  1IH0 A;  3PSR A;  2KLD A;  1M39 A;  3AKA A;  1HQV A;  1L7Z A;  1XFZ O;  2H61 A;  2H8V A;  1RTP 1;  4INX A;  3CR4 X;  3IQO A;  3LL8 B;  4GNK B;  1OQP A;  1H8B A;  4HRG A;  1KWO C;  5DIC A;  2KOT A;  1DQE A;  3JTD B;  1IRJ A;  1XA5 A;  3CS1 A;  3D73 A;  4PHM A;  1C3Y A;  1DEK A;  2A4J A;  3GK2 A;  3S0E A;  1QIW A;  1XK4 C;  3BUW B;  2JZI A;  3FWC A;  2PQL A;  2OPO A;  1K9U A;  3CZ1 A;  3IQQ A;  2MRD A;  1SRA A;  1UHJ A;  1NX3 A;  2HET A;  2OTG B;  3ICB A;  1M63 B;  1E8A A;  3SG5 A;  1IIO A;  1S1E A;  1DC1 A;  2ZRT A;  3TDZ A;  1GJY A;  2JQ6 A;  1D1O A;  2JOJ A;  1PRW A;  1Y1X A;  1DJI A;  2KBI A;  1REC A;  3D10 A;  2DOQ A;  1AJ5 A;  1AHR A;  3BUN B;  3C1V A;  1F55 A;  3Q8I A;  2F3Z A;  1K94 A;  1UHK A;  2HQW A;  3O4X A;  3DF0 A;  1ORG A;  2KFG A;  1QAS A;  2ZFD A;  1SBJ A;  1JFK A;  3R1O A;  1UWO A;  2JC2 A;  1YR5 A;  4XJK A;  1EXR A;  5I2L A;  2WC8 A;  3SJS A;  3DD4 A;  1KFU L;  1TRF A;  4NDC A;  1ZMZ A;  4MVF A;  2JXC A;  4FQT A;  1IGV A;  1WRL A;  3EVU A;  5ER5 A;  3WHU B;  4BY5 A;  1L2O B;  1XFY O;  2L98 A;  3GOF A;  2MLF C;  1UUS A;  3L4L A;  3PAL A;  4FQO A;  2M9G A;  1LA0 A;  2JU0 A;  1J55 A;  2BE4 A;  3I5F B;  4INW A;  3D0Y B;  4MSP A;  4C0K A;  2G9B A;  5HKW A;  1Y6W A;  2NXQ A;  2WCE A;  1PSR A;  1YUR A;  2MHH A;  4DUQ A;  2L5X B;  2BCA A;  4CFQ A;  1TNQ A;  4YI9 A;  1UP5 A;  2M8U A;  3DF0 B;  1CDL A;  1SR6 C;  2LUX A;  3EK7 A;  5CSI A;  1S5G Z;  2LV7 A;  4JD9 A;  4PHN A;  5DKN A;  1JSA A;  2LAP A;  1Y0V H;  1FPW A;  4XJK B;  2M29 A;  2HPS A;  2LC5 A;  3D77 A;  3OB2 B;  2EGD A;  3UO9 A;  3CR5 X;  2KAV A;  2L2E A;  5I2O A;  1J7Q A;  1K9P A;  1IG5 A;  4M2O A;  1NUB A;  2ZN9 A;  3MSE B;  2H61 C;  3LCP C;  2JNF A;  1MR8 A;  1UHI A;  2LHL A;  3QRX A;  4JWQ A;  3AAJ A;  2PYQ A;  1Z2C B;  1GM0 A;  2OS8 C;  2MAZ A;  3I5H B;  1ZFS A;  3DVE A;  1LXF C;  1N0Y A;  3OHM B;  1QVI Z;  4Q04 A;  1UHN A;  1A75 B;  1BR4 B;  1YVH A;  2FOT A;  2KFF A;  3EKH A;  1SL8 A;  2BKI B;  1CLB A;  4UPG A;  1F70 A;  1J7R A;  1SNL A;  1L2O C;  1CFF A;  1QWV A;  1JWD A;  2L5Y A;  1T14 A;  1LKJ A;  2E6W A;  2F2P A;  2WC5 A;  1LS8 A;  3O4Y A;  5CPV A;  2R2I A;  3KF9 A;  1OOJ A;  2CTN A;  2KPH A;  2LMT A;  3CWG A;  1BF5 A;  5HL1 A;  1DJW A;  1YUU A;  2ZKM X;  3I5I B;  4OZD A;  1QJT A;  1B7T Z;  2LCP A;  1XO5 A;  4PHK A;  3VRO A;  4DCK A;  1SYM A;  3KHE A;  4PAL A;  1V1G A;  3M0W A;  2LVK A;  4N1G A;  1MQ1 A;  4USL A;  4CFR A;  3VRP A;  1OOH A;  3S0B A;  3V2L A;  3HCM A;  3R1P A;  1DGU A;  2MA2 A;  1TUZ A;  2K60 A;  1QLS A;  1K9K A;  1PSB A;  2GV5 A;  5FI2 A;  4PCW A;  4WQ2 A;  2GTE A;  1PAL A;  3A8R A;  1A2X A;  2GGZ A;  2I7A A;  2NCP A;  1B4C A;  1ALV A;  2KHN A;  1F4Q A;  1JC2 A;  1GGZ A;  2KNE A;  3A4U B;  2KQ6 A;  1KK7 Y;  2KBM A;  1SL7 A;  1Q80 A;  2BEC A;  3DVM A;  4PE7 A;  5F6T A;  2K7O A;  3I5H C;  1A4P A;  1BG1 A;  1CNP A;  5J3X A;  1NYA A;  4MBE A;  2MLE C;  1G8I A;  2CBL A;  1SW8 A;  1ZOT B;  3VGO A;  3LK0 A;  4GGF A;  3S0F A;  3BOW B;  3H4S E;  4D1E A;  4GPL B;  2M7L A;  3WNX B;  1K2H A;  2COL B;  3UNW A;  2QEO A;  3NHI A;  3SG7 A;  2JT8 A;  3PN7 B;  1W7J B;  3CDN A;  1TWO A;  1AJ4 A;  2NCO A;  1K8U A;  2KGR A;  1F4O A;  2LE9 B;  1PVA A;  4C0J A;  2WCJ A;  1JF2 A;  1SSE B;  2HQ8 A;  3KPX A;  1WRK A;  3SG3 A;  2LVV A;  1K95 A;  1EL4 A;  3NSO A;  5D69 A;  1J7O A;  1LA3 A;  5ER4 X;  2LVI A;  1NSH A;  4ORB B;  4TNC A;  1CMF A;  1DJY A;  2M7N A;  4JQ0 D;  3NSK A;  1JBA A;  2LVJ A;  3D0Y A;  4AQJ A;  1FW4 A;  5KU1 A;  2CT9 A;  2K8M B;  2K0J A;  3EG5 B;  3RM1 A;  2F8P A;  3CAB A;  3I5G C;  2BNX A;  1CFC A;  1B47 A;  4DS7 A;  2M97 A;  1XFR A;  5KTY A;  1KSM A;  2QPT A;  3WXA A;  3E3R A;  2GGM A;  2BBM A;  2LMV A;  2JWW A;  4IJ7 A;  3CYZ A;  2KLE A;  3FE8 A;  1WLZ A;  2L4I A;  2KI4 B;  1S3P A;  2KSP A;  2SAS A;  3BYA A;  3D74 A;  4ORC B;  4IL1 A;  4MZJ A;  4F7F A;  4WRI A;  3EVV A;  2PVB A;  3D78 A;  1RWY A;  4AOM A;  1K90 D;  3PN7 C;  4I5L B;  1CLM A;  1J1D A;  4P2Y B;  1OE9 B;  4QJ4 B;  1B8L A;  4ZCV A;  5BPJ A;  3BFH A;  5CSN A;  1S6I A;  2H2K A;  2JUL A;  1UUR A;  3L4A A;  4ZCU A;  2PAS A;  4MZL A;  4JKT A;  1NIW A;  1NX2 A;  4YGD B;  2WND A;  3JTD C;  3VB1 A;  4JPZ B;  1MWN A;  4R1E A;  1A75 A;  1BR1 B;  4HSZ A;  4U8D A;  4WQ3 A;  2BBN A;  5FI6 A;  3SS5 A;  1F8H A;  1S6J A;  3EVR A;  2JRF A;  1CDM A;  2M1U A;  4GGF C;  4BY4 A;  1KQV A;  2AAO A;  1EG4 A;  5D7F A;  1K93 D;  1UHH A;  2OTG C;  3EK4 A;  4KYN A;  5DKR A;  3ZNI A;  3IVT A;  4QJ3 B;  1DF0 B;  2MJW B;  3FE6 A;  4YGC B;  1MF8 B;  5AER A;  2WCK A;  1CKK A;  2LP3 A;  3NHT A;  3TDU A;  1CTR A;  3GK1 A;  5IBW A;  3BFB A;  4M2Q A;  5JOL A;  1FF1 A;  2WOS A;  2IS9 A;  3SS4 A;  5FI7 A;  1JUO A;  1KQM B;  2P6B B;  1CLL A;  3NSL A;  1KK8 B;  1CM4 A;  4NDD A;  1BOD A;  3B6X A;  3CZ0 A;  4PE1 A;  5G08 A;  3ZWH A;  1FBV A;  1CDP A;  1QV0 A;  3AKB A;  3GK4 X;  5HYD A;  1ZUZ A;  2WCM A;  1SKT A;  3O78 A;  2PAL A;  1LVC D;  3I5F C;  1IQ3 A;  1XVJ A;  1OZO A;  1FI5 A;  3PJI A;  2M49 B;  1CFP A;  3D75 A;  1YX7 A;  4DRW A;  5I2Q A;  2KAX A;  4A4C A;  2Q91 A;  3K1E A;  3TDI A;  4GFT A;  1CM1 A;  4OV2 A;  4XYN A;  1KFU S;  2ISD A;  2BCB A;  3BOW A;  5AXI A;  1IJ5 A;  2QEB A;  1OZS A;  2O5G A;  3EK8 A;  1RFJ A;  1KSO A;  1CDN A;  2LUC A;  4ICB A;  2FCE A;  4F0Z B;  1YRU B;  4A4B A;  1TCO B;  3DYE A;  4DIR A;  1BMO A;  2BL0 B;  4E68 A;  1WY9 A;  1CB1 A;  1NWD A;  4C0L A;  3BJH A;  2BKH B;  2WC6 A;  3SG4 A;  1Z4H A;  1DTL A;  1TNW A;  3S0A A;  2WOR A;  2B1U A;  1DMO A;  1M31 A;  1DJZ A;  1BJF A;  1A03 A;  1XFX O;  2PRU A;  1PK0 D;  2WCL A;  1IJ6 A;  1KQM C;  2D8N A;  2I94 A;  1TTX A;  3BUM B;  2JNX A;  2WCB A;  1XFU O;  2KAY A;  1ZAC A;  3SIB A;  1WDC B;  1YTZ C;  1SL9 A;  2BE6 A;  1MUX A;  3IF7 A;  3FE9 A;  1QTX A;  2I2R E;  2JTT A;  2P70 A;  4OKH A;  3OX6 A;  2KFH A;  3FS7 A;  2NZ0 A;  1C07 A;  1XFV O;  4GAO A;  1BLQ A;  1TOP A;  1TNP A;  5I8N A;  1YVL A;  2V53 A;  1Y1U A;  1S5G Y; 
#chains in the Genus database with same CATH homology
 3I5I C;  2LHI A;  1BU3 A;  2SCP A;  1M46 A;  1QAT A;  1R6P A;  2KI6 D;  4PHJ A;  1YRT B;  4OCI A;  3VRQ A;  1B9A A;  1HT9 A;  5CSJ A;  4N1F A;  3FIA A;  5JJG A;  1QX5 B;  1OMR A;  4GBA A;  1QX7 A;  3VRR A;  3SG2 A;  2LLT A;  1CFD A;  2PMY A;  3BUO B;  2BL0 C;  4OR9 B;  2KQY A;  2K7B A;  2F2O A;  2LNK A;  3SIA A;  5FYX A;  5HLV A;  3NSI A;  2CCM A;  1QVI Y;  1R2U A;  2Y1M A;  4YGB B;  1C7V A;  1EH2 A;  1SR6 B;  1QXP A;  2PSR A;  2I18 A;  3DVK A;  1EJ3 A;  1N65 A;  2BCX A;  2M3W A;  2ZNE A;  2Q4U A;  3BQ3 A;  4N5X A;  4PDZ A;  1N2D A;  2QAC A;  1H8B A;  4M2P A;  1OSA A;  2ZN8 A;  1WDC C;  1DF0 A;  1KFX L;  1QX2 A;  4ORA B;  3AAK A;  1YUT A;  2JTZ A;  2HF5 A;  3K21 A;  2KYF A;  5PAL A;  1B7T Y;  2KGB C;  2M1K B;  1BT6 A;  1DVI A;  3KO0 A;  1QS7 A;  1SCM B;  4ETO A;  2FJU B;  1JFJ A;  3BUX B;  1H4B A;  3CTN A;  1ODB A;  5KSZ A;  5HKZ A;  2Y5I A;  4I5J A;  2WCF A;  1G33 A;  4GGN A;  2OS8 B;  4CPV A;  1NPQ A;  2NLN A;  3CR2 A;  2K2F A;  1BOC A;  2JT3 A;  1Y1A A;  1KK7 Z;  3OB1 B;  1F71 A;  2KDH A;  2AMI A;  4YI8 A;  5CSF A;  2KYC A;  3TUY B;  1KCY A;  4MRY A;  1TIZ A;  1TNX A;  1OMV A;  1NCZ A;  3BXK A;  3NXA A;  4CID A;  3JVT B;  3O2P A;  1NX0 A;  2LMU A;  4MEW A;  2TN4 A;  2EHB A;  2KI6 C;  5TNC A;  1DT7 B;  2CXJ A;  1DJG A;  5DKQ A;  2JPT A;  4P5O E;  4HRH A;  1AK8 A;  1S36 A;  1FI6 A;  1YUS A;  4HRE E;  3TS5 B;  1EG3 A;  1GGW A;  4NDB A;  3EKJ A;  1MXE A;  1M45 A;  3KEV A;  2MBX A;  1NCX A;  2KI4 C;  1J7P A;  4MZK A;  1XYD A;  1VRK A;  1K96 A;  5AFP A;  2K61 A;  3LK1 A;  1NCY A;  1RK9 A;  3WHT B;  1B1G A;  1SCM C;  3PAT A;  1MXL C;  2VRG A;  4L9M A;  1AP4 A;  1PVB A;  2L51 A;  4YGE B;  4GUK A;  1QV1 A;  2EC6 B;  1QLK A;  1TN4 A;  2G2B A;  1F54 A;  2M0R A;  4QJ5 B;  3OP0 A;  4YRU A;  1XK4 A;  3FWB A;  1YX8 A;  4AQI A;  1AUI B;  1SPY A;  1KFX S;  1GQM A;  1WRZ A;  1NX1 A;  2LM5 A;  2Y1N A;  3TUY C;  2LLU A;  3DVJ A;  1RJV A;  3TZ1 A;  1IQ5 A;  1J1E A;  3PFV A;  3JVT C;  1OMD A;  3VRN A;  1LIN A;  2L50 A;  1V1F A;  1IWQ A;  3OX5 A;  4FTG A;  4OVN F;  3RLZ A;  1PUL A;  1CMG A;  3F45 A;  1B8R A;  1W7I B;  2CNP A;  4MLW A;  1KWO B;  2FCD A;  3PLF B;  4MN0 A;  3SG6 A;  1NP8 A;  4NQG A;  2K2A A;  1S26 D;  1U5I A;  2L4H A;  3LLE A;  3PM8 A;  5GQQ C;  1DGV A;  2L0P A;  5HLO A;  3TS5 C;  2JXL A;  1TCF A;  1KK8 C;  2LP2 A;  2K7C A;  4I5K A;  4YBH B;  4PE0 A;  1RRO A;  1ALW A;  1QIV A;  1SK6 D;  4I5N B;  2E30 A;  1JF0 A;  4PE4 A;  2RGI A;  5K89 A;  2K7D A;  3HX4 A;  5B8I B;  2O60 A;  5AEQ A;  2JT0 A;  1MHO A;  2F33 A;  2AUC A;  2LLS A;  1S6C A;  3CGA A;  2ZRS A;  1A29 A;  1SMG A;  1DJX A;  3I5G B;  4MRX A;  4YGA A;  1AVS A;  1C7W A;  1SCV A;  2EC6 C;  1XFW O;  2F3Y A;  3CZT X;  1WLM A;  2Y4Q A;  1IKU A;  1U5I B;  1DJH A;  1B8C A;  5AAN A;  3O6B A;  2ZND A;  2LAN A;  3CLN A;  4CLN A;  1G4Y R;  5HKY A;  1X02 A;  1SY9 A;  1IH0 A;  3PSR A;  1M39 A;  3AKA A;  1HQV A;  1L7Z A;  1XFZ O;  2H61 A;  1RTP 1;  3CR4 X;  3IQO A;  3LL8 B;  4GNK B;  1OQP A;  4HRG A;  1KWO C;  2KOT A;  3JTD B;  1IRJ A;  1XA5 A;  3CS1 A;  4PHM A;  2A4J A;  3GK2 A;  1QIW A;  1XK4 C;  3BUW B;  2JZI A;  3FWC A;  2OPO A;  1K9U A;  3IQQ A;  2MRD A;  1SRA A;  1UHJ A;  1NX3 A;  2HET A;  2OTG B;  3ICB A;  1M63 B;  1E8A A;  3SG5 A;  1S1E A;  2ZRT A;  3TDZ A;  1GJY A;  2JQ6 A;  1D1O A;  2JOJ A;  1PRW A;  1Y1X A;  1DJI A;  2KBI A;  1REC A;  3D10 A;  2DOQ A;  1AJ5 A;  1AHR A;  3BUN B;  3C1V A;  1F55 A;  2F3Z A;  1K94 A;  1UHK A;  2HQW A;  3DF0 A;  2KFG A;  1QAS A;  2ZFD A;  1SBJ A;  1JFK A;  1UWO A;  2JC2 A;  1YR5 A;  4XJK A;  1EXR A;  5I2L A;  2WC8 A;  3SJS A;  3DD4 A;  1KFU L;  1TRF A;  4NDC A;  1ZMZ A;  4MVF A;  2JXC A;  3WHU B;  1IGV A;  1WRL A;  3EVU A;  5ER5 A;  4BY5 A;  1L2O B;  1XFY O;  2L98 A;  3GOF A;  2MLF C;  1UUS A;  3PAL A;  4FQO A;  2M9G A;  1LA0 A;  2JU0 A;  1J55 A;  2BE4 A;  3I5F B;  3D0Y B;  4MSP A;  4C0K A;  2G9B A;  5HKW A;  1Y6W A;  2NXQ A;  2WCE A;  1PSR A;  1YUR A;  2MHH A;  4DUQ A;  2L5X B;  2BCA A;  4CFQ A;  1TNQ A;  4YI9 A;  1UP5 A;  2M8U A;  3DF0 B;  1CDL A;  1SR6 C;  2LUX A;  3EK7 A;  5CSI A;  1S5G Z;  2LV7 A;  5DKN A;  4PHN A;  1JSA A;  2LAP A;  1Y0V H;  1FPW A;  4XJK B;  2M29 A;  2HPS A;  2LC5 A;  3OB2 B;  2EGD A;  3CR5 X;  2KAV A;  2L2E A;  5I2O A;  1J7Q A;  1K9P A;  1IG5 A;  4M2O A;  1NUB A;  2ZN9 A;  3MSE B;  2H61 C;  3LCP C;  2JNF A;  1MR8 A;  1UHI A;  2LHL A;  3QRX A;  4JWQ A;  3AAJ A;  2OS8 C;  2MAZ A;  3I5H B;  1ZFS A;  3DVE A;  1LXF C;  1N0Y A;  3OHM B;  1QVI Z;  4Q04 A;  1UHN A;  1A75 B;  1BR4 B;  1YVH A;  2FOT A;  2KFF A;  3EKH A;  1SL8 A;  2BKI B;  1CLB A;  4UPG A;  1F70 A;  1J7R A;  1SNL A;  1L2O C;  1CFF A;  1JWD A;  1LKJ A;  2E6W A;  2F2P A;  3O4Y A;  5CPV A;  2R2I A;  3KF9 A;  1OOJ A;  2CTN A;  2LMT A;  3CWG A;  1BF5 A;  1DJW A;  1YUU A;  2ZKM X;  3I5I B;  1QJT A;  1B7T Z;  2LCP A;  1XO5 A;  4PHK A;  3VRO A;  4DCK A;  1SYM A;  3KHE A;  4PAL A;  1V1G A;  3M0W A;  2LVK A;  4N1G A;  1MQ1 A;  4USL A;  4CFR A;  3VRP A;  3HCM A;  1DGU A;  2MA2 A;  1QLS A;  1K9K A;  1PSB A;  2GV5 A;  4PCW A;  4WQ2 A;  1PAL A;  3A8R A;  1A2X A;  2GGZ A;  2I7A A;  2NCP A;  1B4C A;  1ALV A;  2KHN A;  1F4Q A;  1JC2 A;  1GGZ A;  2KNE A;  3A4U B;  2KQ6 A;  1KK7 Y;  2KBM A;  2BEC A;  1SL7 A;  1Q80 A;  3DVM A;  4PE7 A;  5F6T A;  2K7O A;  3I5H C;  1A4P A;  1BG1 A;  1CNP A;  5J3X A;  1NYA A;  4MBE A;  2MLE C;  1G8I A;  2CBL A;  1SW8 A;  1ZOT B;  3VGO A;  3LK0 A;  4GGF A;  3BOW B;  3H4S E;  4D1E A;  4GPL B;  2M7L A;  3WNX B;  1K2H A;  2COL B;  3SG7 A;  2JT8 A;  3PN7 B;  1W7J B;  1AJ4 A;  2NCO A;  1K8U A;  2KGR A;  1F4O A;  2LE9 B;  1PVA A;  4C0J A;  1JF2 A;  2HQ8 A;  3KPX A;  1WRK A;  3SG3 A;  2LVV A;  1K95 A;  1EL4 A;  3NSO A;  5D69 A;  1J7O A;  1LA3 A;  5ER4 X;  2LVI A;  1NSH A;  4ORB B;  4TNC A;  1CMF A;  1DJY A;  2M7N A;  4JQ0 D;  3NSK A;  1JBA A;  2LVJ A;  3D0Y A;  4AQJ A;  1FW4 A;  5KU1 A;  2CT9 A;  2K8M B;  2K0J A;  3RM1 A;  2F8P A;  3I5G C;  1CFC A;  1B47 A;  4DS7 A;  2M97 A;  5KTY A;  1KSM A;  2QPT A;  3WXA A;  3E3R A;  2GGM A;  2BBM A;  2LMV A;  2JWW A;  1WLZ A;  2L4I A;  2KI4 B;  1S3P A;  2KSP A;  2SAS A;  3BYA A;  4ORC B;  4IL1 A;  4MZJ A;  4WRI A;  3EVV A;  2PVB A;  4AOM A;  1RWY A;  1K90 D;  3PN7 C;  4I5L B;  1CLM A;  1J1D A;  4P2Y B;  1OE9 B;  4QJ4 B;  1B8L A;  4ZCV A;  5BPJ A;  5CSN A;  1S6I A;  2H2K A;  2JUL A;  1UUR A;  4ZCU A;  2PAS A;  4MZL A;  1NIW A;  1NX2 A;  4YGD B;  2WND A;  3JTD C;  4JPZ B;  1MWN A;  4R1E A;  1A75 A;  1BR1 B;  4HSZ A;  4U8D A;  4WQ3 A;  2BBN A;  1F8H A;  1S6J A;  3EVR A;  2JRF A;  1CDM A;  2M1U A;  4GGF C;  4BY4 A;  1KQV A;  2AAO A;  1EG4 A;  5D7F A;  1K93 D;  1UHH A;  2OTG C;  3EK4 A;  3ZNI A;  5DKR A;  4QJ3 B;  1DF0 B;  2MJW B;  4YGC B;  5AER A;  1MF8 B;  1CKK A;  2LP3 A;  3TDU A;  1CTR A;  3GK1 A;  5IBW A;  4M2Q A;  1FF1 A;  5JOL A;  2WOS A;  2IS9 A;  1JUO A;  1KQM B;  2P6B B;  1CLL A;  3NSL A;  1KK8 B;  1CM4 A;  4NDD A;  1BOD A;  4PE1 A;  5G08 A;  3ZWH A;  1FBV A;  1CDP A;  1QV0 A;  3AKB A;  3GK4 X;  5HYD A;  1ZUZ A;  1SKT A;  3O78 A;  2PAL A;  1LVC D;  3I5F C;  1IQ3 A;  1XVJ A;  1OZO A;  1FI5 A;  2M49 B;  1CFP A;  1YX7 A;  4DRW A;  5I2Q A;  2KAX A;  4A4C A;  2Q91 A;  3TDI A;  4GFT A;  1CM1 A;  4OV2 A;  4XYN A;  1KFU S;  2ISD A;  2BCB A;  3BOW A;  5AXI A;  1IJ5 A;  1OZS A;  2O5G A;  3EK8 A;  1RFJ A;  1KSO A;  1CDN A;  2LUC A;  4ICB A;  2FCE A;  4F0Z B;  1YRU B;  4A4B A;  1TCO B;  4DIR A;  1BMO A;  2BL0 B;  4E68 A;  1WY9 A;  1CB1 A;  1NWD A;  4C0L A;  2BKH B;  3SG4 A;  1DTL A;  1TNW A;  2WOR A;  2B1U A;  1DMO A;  1M31 A;  1DJZ A;  1BJF A;  1A03 A;  1XFX O;  2PRU A;  1PK0 D;  1IJ6 A;  1KQM C;  2D8N A;  2I94 A;  1TTX A;  3BUM B;  2JNX A;  2WCB A;  1XFU O;  2KAY A;  1ZAC A;  3SIB A;  1WDC B;  1YTZ C;  1SL9 A;  2BE6 A;  1MUX A;  3IF7 A;  1QTX A;  2I2R E;  2JTT A;  4OKH A;  3OX6 A;  2KFH A;  3FS7 A;  2NZ0 A;  1C07 A;  1XFV O;  4GAO A;  1BLQ A;  1TOP A;  1TNP A;  5I8N A;  1YVL A;  2V53 A;  1Y1U A;  1S5G Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...