3RZSA

Apis mellifera obp14 in complex with ta6br14
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
molecule keywords OBP14
molecule tags Transport protein
source organism Apis mellifera
total genus 43
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3rzsA00
1OOIX 3FE9A 4JD9A 4INWA 3PJIA 2QEHA 3D75A 3DYEA 3DZTA 3B87A 3CABA 1T14A 1QWVA 3DY9A 2H8VA 3OGNA 3B88A 3FE6A 3N7HA 2KPHA 3CZ2A 3D73A 2QEOA 3S0DA 1LS8A 3BJHA 3CYZA 2QEBA 3CZ1A 1GM0A 3S0FA 5DICA 3B7AA 2L2CA 3S0GA 2ERBA 2WCLA 2GTEA 2P70A 2JPOA 3L4LA 4INXA 3BFBA 3R1VA 2WC5A 2WCKA 3NHTA 1C3YA 3VB1A 3V2LA 2QEVA 2WCHA 3NHIA 2PQLA 1OOGA 4F7FA 3D78A 3L47A 1OW4A 1OOFA 1ORGA 3BFAA 4FQTA 2QDIA 2FJYA 1XFRA 3D77A 4PT1A 1TUJA 3S0BA 3K1EA 3RZSA 3FE8A 1DQEA 3NGVA 1C3ZA 3B86A 2WCMA 3L4AA 2P71A 3CDNA 1P28A 3S0EA 5EL2A 4OZDA 3CZ0A 3BFHA 3DXLA 3B6XA 3S0AA 3D74A 2WC6A 3R1PA 3Q8IA 1OOHA 3QMEA 3R72A 1TWOA 3D76A 2WCJA 3R1OA
chains in the Genus database with same CATH superfamily
1OOIX 1QS7A 3FE9A 1R2UA 4OKHA 3JTDC 3H4SE 2BCXA 5I94A 3PJIA 2M29A 2QEHA 5GQQC 3DYEA 4U8DA 1XA5A 1OMRA 3IQOA 3FIAA 5DKRA 1BLQA 1YUTA 2ZRSA 1DGUA 2OS8C 1OQPA 1UHNA 3FE6A 1NUBA 1L2OC 5K89A 1EG3A 4ZCUA 1AHRA 1RFJA 3K21A 4GGFC 2H61C 3F45A 5HLVA 4OV2A 1OOJA 1A03A 2QEOA 4N1GA 1KFUL 5HL1A 1U5IA 3EKHA 2JQ6A 3E3RA 1UWOA 2NLNA 3GK4X 3LCPC 1ALVA 4JKTA 2F33A 1Y1UA 2JWWA 1AVSA 4MN0A 1K2HA 2O5GA 3DF0B 3PM2A 3OB2B 1TUZA 3AAJA 3LL8B 3B7AA 2OPOA 4OVNF 1TCFA 2ERBA 2KGBC 4MRYA 3WXAA 3AKAA 4MZLA 1F4QA 1MR8A 4PCWA 3HCMA 2JPOA 2PASA 3OP0A 4INXA 5F6TA 5FYXA 5CSIA 3D10A 1WRZA 4NDDA 3I5FC 1F55A 2M7NA 1OMVA 3BFBA 1D1OA 4YRUA 2LLTA 3OX5A 3PN7C 1K93D 4QJ3B 1NX0A 2HQ8A 1DT7B 4AQIA 1F54A 4AQJA 1UUSA 1G4YR 5HKWA 1WRKA 1EJ3A 2QEVA 1QV1A 3NHIA 3PATA 1IIOA 1OOGA 3BOWA 3D78A 2TN4A 2Y1MA 1K9PA 1S6CA 4I5LB 3L47A 4BY5A 1XK4A 3BYAA 1PULA 1F70A 1GGWA 3OB1B 2NCOA 3IQQA 3JVTB 2CXJA 2PMYA 1LKJA 4FQTA 3C1VA 4PE4A 1AJ4A 3SIAA 5BPJA 1DJXA 1CM4A 4YGEB 3D77A 2MJWB 3SS4A 1NCXA 1BOCA 1ZUZA 1CDPA 2V53A 1X02A 1OE9B 4QJ5B 1BR1B 1PVAA 1SL7A 2F3YA 4I5KA 4Q04A 1KFXL 1DVIA 2EC6C 4YI9A 1KK7Z 2LC5A 2BNXA 3I5HB 5TNCA 3RLZA 3B86A 3VRRA 2NXQA 3JTDB 1EH2A 2GV5A 1NYAA 2KFHA 1K9UA 3I5GB 2JU0A 3BUNB 1UURA 3PALA 1G33A 4CIDA 2M1KB 2M1UA 3CS1A 1SCVA 2ZRTA 1WDCC 3S0EA 1NSHA 2OS8B 2JNFA 4M2OA 3DD4A 2CT9A 3BQ3A 3FWCA 1XVJA 3KPXA 4PE1A 2WC6A 2EGDA 1SSEB 2ZKMX 4UPGA 4M2PA 1A75A 4N5XA 3QMEA 5KTYA 1DC1A 1TWOA 1JFKA 1CNPA 2WC8A 1TOPA 1KFUS 2KGRA 2ZN9A 4C0KA 1B8LA 2SASA 4MZKA 1S5GZ 1CDNA 2L5YA 1JC2A 1K94A 1M39A 2LNKA 1XFYO 3GK2A 3CR5X 4XYNA 1TIZA 1RJVA 4JD9A 2LLSA 3KHEA 4JQ0D 1SR6B 2NZ0A 1KSMA 2L2EA 5JOLA 3D75A 2JTZA 3EVUA 2BE4A 1XK4C 2PALA 3DZTA 4YI8A 1QX2A 4PHKA 2QACA 2HPSA 1N0YA 3DY9A 2M49B 3MSEB 2ISDA 2Q4UA 3OGNA 3LK0A 4MRXA 4PDZA 5CSFA 3N7HA 5PALA 3JVTC 1MUXA 1LA0A 1OZOA 2LHLA 3O4YA 2G2BA 2KAVA 3CZ2A 1XFWO 2I18A 2LVVA 1QVIY 4PE7A 3EK4A 3M0WA 3BUXB 2BBNA 2KFGA 1LS8A 2AMIA 4C0JA 2K7DA 3UNWA 2JT0A 2NCPA 1C7WA 1QJTA 2LMUA 3CZ1A 1IG5A 1K90D 2I2RE 1RWYA 2JT3A 1XFXO 1GM0A 1SBJA 2CTNA 2BBMA 3I5HC 5DICA 3VRNA 2R2IA 1DTLA 2JULA 2KI6D 2MAZA 1FI5A 4XJKB 3I5GC 2ZNEA 2BKHB 4GPLB 1DJYA 2P70A 4XJKA 2BAPA 2KYCA 3SG2A 2KBIA 1V1FA 4NDBA 5DKNA 5D3OA 1QIVA 2JZIA 2EC6B 4HRHA 3GK1A 2HQWA 2WCKA 1U5IB 3SS5A 1LA3A 1SCMC 4DRWA 1VRKA 5AXIA 3EK7A 3WHTB 1S1EA 3CLNA 1AJ5A 2L98A 2FCDA 3BXKA 3CR2A 1WDCB 2WCHA 2YGUA 1Z2CB 1TN4A 4GBAA 1OW4A 4YBHB 5B8IB 2JOJA 1DMOA 3VGOA 1J1DA 3TZ1A 1IJ5A 2PSRA 4I5JA 4DUQA 3BFAA 1K9KA 2BCBA 4ZCVA 1SR6C 4IJ7A 4M2QA 5HLOA 2JNXA 4PHJA 3CTNA 4YGAA 1Y0VH 5I2LA 1TNPA 1ZFSA 2SCPA 1KK8C 2I94A 3FE8A 2LV7A 2Y1NA 1DQEA 4GAOA 3NGVA 1BG1A 5D69A 5FI7A 2IS9A 2O60A 2AAOA 2B1UA 1MXLC 1B7TZ 3EKJA 1IRJA 2LVIA 4MZJA 2WCMA 3BOWB 4C0LA 4BY4A 5I8NA 1J55A 3SG6A 1JF0A 1ZMZA 2P71A 1TNXA 1ZACA 1QATA 3HX4A 1N65A 1NCYA 2LE9B 3QRXA 2WOSA 4KYNA 4MBEA 2P6BB 5AEQA 2KQYA 2KYFA 1KWOC 2LANA 1YR5A 3DXLA 1BR4B 4NDCA 1IKUA 3B6XA 3S0AA 1PSBA 1H4BA 1B47A 1YVHA 1KSOA 2PRUA 1AUIB 1DJWA 2F2PA 1DGVA 1FW4A 3CZTX 3WNXB 2FCEA 1LXFC 2BL0C 1NIWA 1SW8A 3LLEA 3IVTA 2KHNA 1JSAA 3TDZA 1FBVA 2JRFA 1BT6A 1L7ZA 4PHNA 3ZNIA 4R1EA 1JF2A 1JUOA 1JBAA 5KSZA 2CCMA 2BKIB 3PM8A 2D8NA 2KOTA 3IF7A 4ICBA 2Y4QA 3CABA 2KI4B 2K7OA 2LVKA 4JWQA 4AOMA 2H8VA 1J7OA 1A75B 3TDIA 2HETA 1CLMA 2ZFDA 3SG7A 1EL4A 1SCMB 1TRFA 1W7IB 2K7BA 1SRAA 1BF5A 1PSRA 1J1EA 1CM1A 3D73A 4GNKB 2EHBA 4P2YB 5G08A 1DF0B 3KO0A 3TS5B 5IBWA 1K95A 1RTP1 2PVBA 2E30A 1B8CA 1F8HA 4PALA 3DVEA 2AUCA 5HKYA 1DF0A 1OZSA 1CDMA 3VRPA 3S0FA 2JXCA 3O4XA 2WNDA 1S26D 3SJSA 4D1EA 1J7RA 3DVMA 1UHIA 2L2CA 3S0GA 1CLLA 1NCZA 1QXPA 4JPZB 1J7PA 1KK8B 1XFVO 2QPTA 1QTXA 1CFFA 1MQ1A 1CTRA 1S36A 1V1GA 3BUWB 5AANA 2H61A 5KU1A 1KQMB 1ZOTB 2LAPA 3BUOB 3R1VA 2L4HA 2MLEC 2LMVA 1H8BA 2LM5A 2WC5A 2ZNDA 3SIBA 1M31A 1BU3A 3I5IB 5CPVA 4CFRA 1DJHA 1MXEA 3O78A 5HKZA 3FS7A 3VB1A 5ER4X 1PRWA 1IJ6A 1F4OA 3NXAA 2LCPA 5DKQA 1B1GA 4YGCB 2PQLA 1KWOB 1BJFA 2COLB 2KLEA 4I5NB 1IQ3A 2K8MB 1NPQA 3EG5B 1SL8A 1RECA 1KK7Y 2K7CA 4GFTA 1NP8A 1HQVA 1ORGA 3AKBA 3RM1A 3SG5A 4ETOA 1UHJA 2LMTA 3DVJA 1YX7A 1YUUA 2LP2A 3KF9A 5ER5A 5AFPA 2BL0B 2LUCA 2RGIA 2K2FA 2KI6C 2KI4C 1W7JB 1PVBA 1A4PA 1DELA 2JTTA 2M8UA 2FJUB 1A29A 4P5OE 1B9AA 2F8PA 1YVLA 2KAYA 2WORA 1KFXS 4DCKA 3WHUB 1NX2A 5J3XA 1XFZO 1CB1A 2KLDA 3D0YA 5FI2A 3L4AA 3OX6A 3TS5C 5FI6A 4PE0A 1ODBA 3CDNA 4DS7A 1P28A 5AERA 2F2OA 2ZN8A 2K2AA 1AP4A 5CSJA 2LP3A 5EL2A 4OZDA 1FF1A 1QX5B 1XO5A 3CZ0A 3TDUA 1F71A 1YX8A 3BFHA 4QJ4B 2LVJA 1CLBA 3PLFB 1A2XA 4NQGA 3ICBA 1S5GY 2WCBA 1IWQA 1M45A 2CBLA 4HSZA 1TNWA 2F3ZA 1XFUO 1OSAA 1RK9A 3R1PA 4WRIA 1AK8A 2CNPA 2L5XB 3Q8IA 1KQVA 1UP5A 3CWGA 1IQ5A 1TCOB 4FQOA 3KEVA 1CMFA 1KQMC 2KDHA 2LUXA 3NSOA 1IGVA 1FPWA 2WCJA 5D7FA 3I5IC 5CSNA 2E6WA 1PK0D 1QV0A 4PHMA 4IL1A 3R1OA 1S6JA 2LLUA 3TUYB 2GGMA 4USLA 4INWA 1S3PA 2Q91A 1UHHA 2K0JA 2M9GA 3DF0A 1TNQA 1K8UA 1C7VA 4TNCA 3VRQA 1Z4HA 3B87A 1HT9A 1T14A 1QWVA 3SG4A 2JXLA 4DIRA 1C07A 1QASA 3B88A 4CFQA 1Q80A 1FI6A 2KPHA 1EG4A 1EXRA 2KNEA 4GUKA 2FOTA 2L50A 3FWBA 4FTGA 3SS3A 1G8IA 3S0DA 2MA2A 3BJHA 3CYZA 4L9MA 5I2QA 4OCIA 2QEBA 2BE6A 4MEWA 3A4UB 1J7QA 1YUSA 2JT8A 1Y1AA 1JWDA 2JC2A 2OTGC 2HF5A 1Y6WA 4YGDB 1BODA 2Y5IA 2LHIA 1DJZA 1QVIZ 1SMGA 1SL9A 1QX7A 1NWDA 3A8RA 1B4CA 2G9BA 1E8AA 2WCLA 2GTEA 2A4JA 1K96A 3L4LA 1Y1XA 1MF8B 4HREE 1LINA 1M63B 1GQMA 2M0RA 1CDLA 1QLKA 4E68A 1SKTA 4A4CA 1YRUB 1OMDA 1GJYA 3NSIA 1DJIA 3EVRA 5HYDA 1YTZC 1NX1A 2MRDA 1N2DA 3NHTA 1W9ZA 3ZWHA 1PALA 2K61A 1TTXA 2KFFA 1C3YA 3PSRA 1SPYA 5I2OA 3V2LA 1KCYA 5JJGA 1YRTB 1SY9A 1WRLA 3LK1A 2KAXA 1UHKA 1QIWA 4F7FA 3EVVA 1RROA 3NSKA 3O6BA 4CLNA 3SG3A 1QLSA 1SYMA 1DJGA 1L2OB 1CFPA 1OOFA 2MHHA 1XYDA 2QDIA 3TUYC 2FJYA 1B7TY 1XFRA 2M3WA 2L4IA 4PT1A 2WCEA 2H2KA 2BECA 2MLFC 1TUJA 3OBVA 1CFDA 2PYQA 4GGFA 2WCFA 3S0BA 1NX3A 3UO9A 3K1EA 1WLMA 2M7LA 3RZSA 2BCAA 3AAKA 3EK8A 1C3ZA 4N1FA 2I7AA 4MLWA 1MWNA 2DOQA 1SK6D 3GOFA 3O2PA 1WY9A 1CKKA 2VRGA 4YGBB 1MHOA 4OR9B 4ORAB 1R6PA 1YURA 2L0PA 4WQ2A 4GGNA 4MSPA 3BUMB 3I5FB 1S6IA 4F0ZB 2GGZA 4HRGA 2L51A 1WLZA 3NSLA 1B8RA 3PN7B 1JFJA 1M46A 3D74A 4A4BA 1IH0A 4ORBB 1SNLA 4MVFA 4WQ3A 3CR4X 1ALWA 1OOHA 3OHMB 3R72A 3VROA 4CPVA 1GGZA 2KBMA 2KSPA 3PFVA 2M97A 1LVCD 1DEKA 1BMOA 2KQ6A 3CGAA 2K60A 3D0YB 3D76A 3DVKA 4ORCB 2MBXA 2OTGB 1CFCA 1CMGA 2JPTA
chains in the Genus database with same CATH topology
1OOIX 3FE9A 4JD9A 4INWA 3PJIA 2QEHA 3D75A 3DYEA 3DZTA 3B87A 3CABA 1T14A 1QWVA 3DY9A 2H8VA 3OGNA 3B88A 3FE6A 3N7HA 2KPHA 3CZ2A 3D73A 2QEOA 3S0DA 1LS8A 3BJHA 3CYZA 2QEBA 3CZ1A 1GM0A 3S0FA 5DICA 3B7AA 2L2CA 3S0GA 2ERBA 2WCLA 2GTEA 2P70A 2JPOA 3L4LA 4INXA 3BFBA 3R1VA 2WC5A 2WCKA 3NHTA 1C3YA 3VB1A 3V2LA 2QEVA 2WCHA 3NHIA 2PQLA 1OOGA 4F7FA 3D78A 3L47A 1OW4A 1OOFA 1ORGA 3BFAA 4FQTA 2QDIA 2FJYA 1XFRA 3D77A 4PT1A 1TUJA 3S0BA 3K1EA 3RZSA 3FE8A 1DQEA 3NGVA 1C3ZA 3B86A 2WCMA 3L4AA 2P71A 3CDNA 1P28A 3S0EA 5EL2A 4OZDA 3CZ0A 3BFHA 3DXLA 3B6XA 3S0AA 3D74A 2WC6A 3R1PA 3Q8IA 1OOHA 3QMEA 3R72A 1TWOA 3D76A 2WCJA 3R1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOI X;  3FE9 A;  4JD9 A;  4INW A;  3PJI A;  2QEH A;  3D75 A;  3DYE A;  3DZT A;  3B87 A;  3CAB A;  1T14 A;  1QWV A;  3DY9 A;  2H8V A;  3OGN A;  3B88 A;  3FE6 A;  3N7H A;  2KPH A;  3CZ2 A;  3D73 A;  2QEO A;  3S0D A;  1LS8 A;  3BJH A;  3CYZ A;  2QEB A;  3CZ1 A;  1GM0 A;  3S0F A;  5DIC A;  3B7A A;  2L2C A;  3S0G A;  2ERB A;  2WCL A;  2GTE A;  2P70 A;  2JPO A;  3L4L A;  4INX A;  3BFB A;  3R1V A;  2WC5 A;  2WCK A;  3NHT A;  1C3Y A;  3VB1 A;  3V2L A;  2QEV A;  2WCH A;  3NHI A;  2PQL A;  1OOG A;  4F7F A;  3D78 A;  3L47 A;  1OW4 A;  1OOF A;  1ORG A;  3BFA A;  4FQT A;  2QDI A;  2FJY A;  1XFR A;  3D77 A;  4PT1 A;  1TUJ A;  3S0B A;  3K1E A;  3RZS A;  3FE8 A;  1DQE A;  3NGV A;  1C3Z A;  3B86 A;  2WCM A;  3L4A A;  2P71 A;  3CDN A;  1P28 A;  3S0E A;  5EL2 A;  4OZD A;  3CZ0 A;  3BFH A;  3DXL A;  3B6X A;  3S0A A;  3D74 A;  2WC6 A;  3R1P A;  3Q8I A;  1OOH A;  3QME A;  3R72 A;  1TWO A;  3D76 A;  2WCJ A;  3R1O A; 
#chains in the Genus database with same CATH topology
 1OOI X;  1QS7 A;  3FE9 A;  1R2U A;  4OKH A;  3JTD C;  3H4S E;  2BCX A;  5I94 A;  3PJI A;  2M29 A;  2QEH A;  5GQQ C;  3DYE A;  4U8D A;  1XA5 A;  1OMR A;  3IQO A;  3FIA A;  5DKR A;  1BLQ A;  1YUT A;  2ZRS A;  1DGU A;  2OS8 C;  1OQP A;  1UHN A;  3FE6 A;  1NUB A;  1L2O C;  5K89 A;  1EG3 A;  4ZCU A;  1AHR A;  1RFJ A;  3K21 A;  4GGF C;  2H61 C;  3F45 A;  5HLV A;  4OV2 A;  1OOJ A;  1A03 A;  2QEO A;  4N1G A;  1KFU L;  5HL1 A;  1U5I A;  3EKH A;  2JQ6 A;  3E3R A;  1UWO A;  2NLN A;  3GK4 X;  3LCP C;  1ALV A;  4JKT A;  2F33 A;  1Y1U A;  2JWW A;  1AVS A;  4MN0 A;  1K2H A;  2O5G A;  3DF0 B;  3PM2 A;  3OB2 B;  1TUZ A;  3AAJ A;  3LL8 B;  3B7A A;  2OPO A;  4OVN F;  1TCF A;  2ERB A;  2KGB C;  4MRY A;  3WXA A;  3AKA A;  4MZL A;  1F4Q A;  1MR8 A;  4PCW A;  3HCM A;  2JPO A;  2PAS A;  3OP0 A;  4INX A;  5F6T A;  5FYX A;  5CSI A;  3D10 A;  1WRZ A;  4NDD A;  3I5F C;  1F55 A;  2M7N A;  1OMV A;  3BFB A;  1D1O A;  4YRU A;  2LLT A;  3OX5 A;  3PN7 C;  1K93 D;  4QJ3 B;  1NX0 A;  2HQ8 A;  1DT7 B;  4AQI A;  1F54 A;  4AQJ A;  1UUS A;  1G4Y R;  5HKW A;  1WRK A;  1EJ3 A;  2QEV A;  1QV1 A;  3NHI A;  3PAT A;  1IIO A;  1OOG A;  3BOW A;  3D78 A;  2TN4 A;  2Y1M A;  1K9P A;  1S6C A;  4I5L B;  3L47 A;  4BY5 A;  1XK4 A;  3BYA A;  1PUL A;  1F70 A;  1GGW A;  3OB1 B;  2NCO A;  3IQQ A;  3JVT B;  2CXJ A;  2PMY A;  1LKJ A;  4FQT A;  3C1V A;  4PE4 A;  1AJ4 A;  3SIA A;  5BPJ A;  1DJX A;  1CM4 A;  4YGE B;  3D77 A;  2MJW B;  3SS4 A;  1NCX A;  1BOC A;  1ZUZ A;  1CDP A;  2V53 A;  1X02 A;  1OE9 B;  4QJ5 B;  1BR1 B;  1PVA A;  1SL7 A;  2F3Y A;  4I5K A;  4Q04 A;  1KFX L;  1DVI A;  2EC6 C;  4YI9 A;  1KK7 Z;  2LC5 A;  2BNX A;  3I5H B;  5TNC A;  3RLZ A;  3B86 A;  3VRR A;  2NXQ A;  3JTD B;  1EH2 A;  2GV5 A;  1NYA A;  2KFH A;  1K9U A;  3I5G B;  2JU0 A;  3BUN B;  1UUR A;  3PAL A;  1G33 A;  4CID A;  2M1K B;  2M1U A;  3CS1 A;  1SCV A;  2ZRT A;  1WDC C;  3S0E A;  1NSH A;  2OS8 B;  2JNF A;  4M2O A;  3DD4 A;  2CT9 A;  3BQ3 A;  3FWC A;  1XVJ A;  3KPX A;  4PE1 A;  2WC6 A;  2EGD A;  1SSE B;  2ZKM X;  4UPG A;  4M2P A;  1A75 A;  4N5X A;  3QME A;  5KTY A;  1DC1 A;  1TWO A;  1JFK A;  1CNP A;  2WC8 A;  1TOP A;  1KFU S;  2KGR A;  2ZN9 A;  4C0K A;  1B8L A;  2SAS A;  4MZK A;  1S5G Z;  1CDN A;  2L5Y A;  1JC2 A;  1K94 A;  1M39 A;  2LNK A;  1XFY O;  3GK2 A;  3CR5 X;  4XYN A;  1TIZ A;  1RJV A;  4JD9 A;  2LLS A;  3KHE A;  4JQ0 D;  1SR6 B;  2NZ0 A;  1KSM A;  2L2E A;  5JOL A;  3D75 A;  2JTZ A;  3EVU A;  2BE4 A;  1XK4 C;  2PAL A;  3DZT A;  4YI8 A;  1QX2 A;  4PHK A;  2QAC A;  2HPS A;  1N0Y A;  3DY9 A;  2M49 B;  3MSE B;  2ISD A;  2Q4U A;  3OGN A;  3LK0 A;  4MRX A;  4PDZ A;  5CSF A;  3N7H A;  5PAL A;  3JVT C;  1MUX A;  1LA0 A;  1OZO A;  2LHL A;  3O4Y A;  2G2B A;  2KAV A;  3CZ2 A;  1XFW O;  2I18 A;  2LVV A;  1QVI Y;  4PE7 A;  3EK4 A;  3M0W A;  3BUX B;  2BBN A;  2KFG A;  1LS8 A;  2AMI A;  4C0J A;  2K7D A;  3UNW A;  2JT0 A;  2NCP A;  1C7W A;  1QJT A;  2LMU A;  3CZ1 A;  1IG5 A;  1K90 D;  2I2R E;  1RWY A;  2JT3 A;  1XFX O;  1GM0 A;  1SBJ A;  2CTN A;  2BBM A;  3I5H C;  5DIC A;  3VRN A;  2R2I A;  1DTL A;  2JUL A;  2KI6 D;  2MAZ A;  1FI5 A;  4XJK B;  3I5G C;  2ZNE A;  2BKH B;  4GPL B;  1DJY A;  2P70 A;  4XJK A;  2BAP A;  2KYC A;  3SG2 A;  2KBI A;  1V1F A;  4NDB A;  5DKN A;  5D3O A;  1QIV A;  2JZI A;  2EC6 B;  4HRH A;  3GK1 A;  2HQW A;  2WCK A;  1U5I B;  3SS5 A;  1LA3 A;  1SCM C;  4DRW A;  1VRK A;  5AXI A;  3EK7 A;  3WHT B;  1S1E A;  3CLN A;  1AJ5 A;  2L98 A;  2FCD A;  3BXK A;  3CR2 A;  1WDC B;  2WCH A;  2YGU A;  1Z2C B;  1TN4 A;  4GBA A;  1OW4 A;  4YBH B;  5B8I B;  2JOJ A;  1DMO A;  3VGO A;  1J1D A;  3TZ1 A;  1IJ5 A;  2PSR A;  4I5J A;  4DUQ A;  3BFA A;  1K9K A;  2BCB A;  4ZCV A;  1SR6 C;  4IJ7 A;  4M2Q A;  5HLO A;  2JNX A;  4PHJ A;  3CTN A;  4YGA A;  1Y0V H;  5I2L A;  1TNP A;  1ZFS A;  2SCP A;  1KK8 C;  2I94 A;  3FE8 A;  2LV7 A;  2Y1N A;  1DQE A;  4GAO A;  3NGV A;  1BG1 A;  5D69 A;  5FI7 A;  2IS9 A;  2O60 A;  2AAO A;  2B1U A;  1MXL C;  1B7T Z;  3EKJ A;  1IRJ A;  2LVI A;  4MZJ A;  2WCM A;  3BOW B;  4C0L A;  4BY4 A;  5I8N A;  1J55 A;  3SG6 A;  1JF0 A;  1ZMZ A;  2P71 A;  1TNX A;  1ZAC A;  1QAT A;  3HX4 A;  1N65 A;  1NCY A;  2LE9 B;  3QRX A;  2WOS A;  4KYN A;  4MBE A;  2P6B B;  5AEQ A;  2KQY A;  2KYF A;  1KWO C;  2LAN A;  1YR5 A;  3DXL A;  1BR4 B;  4NDC A;  1IKU A;  3B6X A;  3S0A A;  1PSB A;  1H4B A;  1B47 A;  1YVH A;  1KSO A;  2PRU A;  1AUI B;  1DJW A;  2F2P A;  1DGV A;  1FW4 A;  3CZT X;  3WNX B;  2FCE A;  1LXF C;  2BL0 C;  1NIW A;  1SW8 A;  3LLE A;  3IVT A;  2KHN A;  1JSA A;  3TDZ A;  1FBV A;  2JRF A;  1BT6 A;  1L7Z A;  4PHN A;  3ZNI A;  4R1E A;  1JF2 A;  1JUO A;  1JBA A;  5KSZ A;  2CCM A;  2BKI B;  3PM8 A;  2D8N A;  2KOT A;  3IF7 A;  4ICB A;  2Y4Q A;  3CAB A;  2KI4 B;  2K7O A;  2LVK A;  4JWQ A;  4AOM A;  2H8V A;  1J7O A;  1A75 B;  3TDI A;  2HET A;  1CLM A;  2ZFD A;  3SG7 A;  1EL4 A;  1SCM B;  1TRF A;  1W7I B;  2K7B A;  1SRA A;  1BF5 A;  1PSR A;  1J1E A;  1CM1 A;  3D73 A;  4GNK B;  2EHB A;  4P2Y B;  5G08 A;  1DF0 B;  3KO0 A;  3TS5 B;  5IBW A;  1K95 A;  1RTP 1;  2PVB A;  2E30 A;  1B8C A;  1F8H A;  4PAL A;  3DVE A;  2AUC A;  5HKY A;  1DF0 A;  1OZS A;  1CDM A;  3VRP A;  3S0F A;  2JXC A;  3O4X A;  2WND A;  1S26 D;  3SJS A;  4D1E A;  1J7R A;  3DVM A;  1UHI A;  2L2C A;  3S0G A;  1CLL A;  1NCZ A;  1QXP A;  4JPZ B;  1J7P A;  1KK8 B;  1XFV O;  2QPT A;  1QTX A;  1CFF A;  1MQ1 A;  1CTR A;  1S36 A;  1V1G A;  3BUW B;  5AAN A;  2H61 A;  5KU1 A;  1KQM B;  1ZOT B;  2LAP A;  3BUO B;  3R1V A;  2L4H A;  2MLE C;  2LMV A;  1H8B A;  2LM5 A;  2WC5 A;  2ZND A;  3SIB A;  1M31 A;  1BU3 A;  3I5I B;  5CPV A;  4CFR A;  1DJH A;  1MXE A;  3O78 A;  5HKZ A;  3FS7 A;  3VB1 A;  5ER4 X;  1PRW A;  1IJ6 A;  1F4O A;  3NXA A;  2LCP A;  5DKQ A;  1B1G A;  4YGC B;  2PQL A;  1KWO B;  1BJF A;  2COL B;  2KLE A;  4I5N B;  1IQ3 A;  2K8M B;  1NPQ A;  3EG5 B;  1SL8 A;  1REC A;  1KK7 Y;  2K7C A;  4GFT A;  1NP8 A;  1HQV A;  1ORG A;  3AKB A;  3RM1 A;  3SG5 A;  4ETO A;  1UHJ A;  2LMT A;  3DVJ A;  1YX7 A;  1YUU A;  2LP2 A;  3KF9 A;  5ER5 A;  5AFP A;  2BL0 B;  2LUC A;  2RGI A;  2K2F A;  2KI6 C;  2KI4 C;  1W7J B;  1PVB A;  1A4P A;  1DEL A;  2JTT A;  2M8U A;  2FJU B;  1A29 A;  4P5O E;  1B9A A;  2F8P A;  1YVL A;  2KAY A;  2WOR A;  1KFX S;  4DCK A;  3WHU B;  1NX2 A;  5J3X A;  1XFZ O;  1CB1 A;  2KLD A;  3D0Y A;  5FI2 A;  3L4A A;  3OX6 A;  3TS5 C;  5FI6 A;  4PE0 A;  1ODB A;  3CDN A;  4DS7 A;  1P28 A;  5AER A;  2F2O A;  2ZN8 A;  2K2A A;  1AP4 A;  5CSJ A;  2LP3 A;  5EL2 A;  4OZD A;  1FF1 A;  1QX5 B;  1XO5 A;  3CZ0 A;  3TDU A;  1F71 A;  1YX8 A;  3BFH A;  4QJ4 B;  2LVJ A;  1CLB A;  3PLF B;  1A2X A;  4NQG A;  3ICB A;  1S5G Y;  2WCB A;  1IWQ A;  1M45 A;  2CBL A;  4HSZ A;  1TNW A;  2F3Z A;  1XFU O;  1OSA A;  1RK9 A;  3R1P A;  4WRI A;  1AK8 A;  2CNP A;  2L5X B;  3Q8I A;  1KQV A;  1UP5 A;  3CWG A;  1IQ5 A;  1TCO B;  4FQO A;  3KEV A;  1CMF A;  1KQM C;  2KDH A;  2LUX A;  3NSO A;  1IGV A;  1FPW A;  2WCJ A;  5D7F A;  3I5I C;  5CSN A;  2E6W A;  1PK0 D;  1QV0 A;  4PHM A;  4IL1 A;  3R1O A;  1S6J A;  2LLU A;  3TUY B;  2GGM A;  4USL A;  4INW A;  1S3P A;  2Q91 A;  1UHH A;  2K0J A;  2M9G A;  3DF0 A;  1TNQ A;  1K8U A;  1C7V A;  4TNC A;  3VRQ A;  1Z4H A;  3B87 A;  1HT9 A;  1T14 A;  1QWV A;  3SG4 A;  2JXL A;  4DIR A;  1C07 A;  1QAS A;  3B88 A;  4CFQ A;  1Q80 A;  1FI6 A;  2KPH A;  1EG4 A;  1EXR A;  2KNE A;  4GUK A;  2FOT A;  2L50 A;  3FWB A;  4FTG A;  3SS3 A;  1G8I A;  3S0D A;  2MA2 A;  3BJH A;  3CYZ A;  4L9M A;  5I2Q A;  4OCI A;  2QEB A;  2BE6 A;  4MEW A;  3A4U B;  1J7Q A;  1YUS A;  2JT8 A;  1Y1A A;  1JWD A;  2JC2 A;  2OTG C;  2HF5 A;  1Y6W A;  4YGD B;  1BOD A;  2Y5I A;  2LHI A;  1DJZ A;  1QVI Z;  1SMG A;  1SL9 A;  1QX7 A;  1NWD A;  3A8R A;  1B4C A;  2G9B A;  1E8A A;  2WCL A;  2GTE A;  2A4J A;  1K96 A;  3L4L A;  1Y1X A;  1MF8 B;  4HRE E;  1LIN A;  1M63 B;  1GQM A;  2M0R A;  1CDL A;  1QLK A;  4E68 A;  1SKT A;  4A4C A;  1YRU B;  1OMD A;  1GJY A;  3NSI A;  1DJI A;  3EVR A;  5HYD A;  1YTZ C;  1NX1 A;  2MRD A;  1N2D A;  3NHT A;  1W9Z A;  3ZWH A;  1PAL A;  2K61 A;  1TTX A;  2KFF A;  1C3Y A;  3PSR A;  1SPY A;  5I2O A;  3V2L A;  1KCY A;  5JJG A;  1YRT B;  1SY9 A;  1WRL A;  3LK1 A;  2KAX A;  1UHK A;  1QIW A;  4F7F A;  3EVV A;  1RRO A;  3NSK A;  3O6B A;  4CLN A;  3SG3 A;  1QLS A;  1SYM A;  1DJG A;  1L2O B;  1CFP A;  1OOF A;  2MHH A;  1XYD A;  2QDI A;  3TUY C;  2FJY A;  1B7T Y;  1XFR A;  2M3W A;  2L4I A;  4PT1 A;  2WCE A;  2H2K A;  2BEC A;  2MLF C;  1TUJ A;  3OBV A;  1CFD A;  2PYQ A;  4GGF A;  2WCF A;  3S0B A;  1NX3 A;  3UO9 A;  3K1E A;  1WLM A;  2M7L A;  3RZS A;  2BCA A;  3AAK A;  3EK8 A;  1C3Z A;  4N1F A;  2I7A A;  4MLW A;  1MWN A;  2DOQ A;  1SK6 D;  3GOF A;  3O2P A;  1WY9 A;  1CKK A;  2VRG A;  4YGB B;  1MHO A;  4OR9 B;  4ORA B;  1R6P A;  1YUR A;  2L0P A;  4WQ2 A;  4GGN A;  4MSP A;  3BUM B;  3I5F B;  1S6I A;  4F0Z B;  2GGZ A;  4HRG A;  2L51 A;  1WLZ A;  3NSL A;  1B8R A;  3PN7 B;  1JFJ A;  1M46 A;  3D74 A;  4A4B A;  1IH0 A;  4ORB B;  1SNL A;  4MVF A;  4WQ3 A;  3CR4 X;  1ALW A;  1OOH A;  3OHM B;  3R72 A;  3VRO A;  4CPV A;  1GGZ A;  2KBM A;  2KSP A;  3PFV A;  2M97 A;  1LVC D;  1DEK A;  1BMO A;  2KQ6 A;  3CGA A;  2K60 A;  3D0Y B;  3D76 A;  3DVK A;  4ORC B;  2MBX A;  2OTG B;  1CFC A;  1CMG A;  2JPT A; 
#chains in the Genus database with same CATH homology
 1OOI X;  3FE9 A;  4JD9 A;  4INW A;  3PJI A;  2QEH A;  3D75 A;  3DYE A;  3DZT A;  3B87 A;  3CAB A;  1T14 A;  1QWV A;  3DY9 A;  2H8V A;  3OGN A;  3B88 A;  3FE6 A;  3N7H A;  2KPH A;  3CZ2 A;  3D73 A;  2QEO A;  3S0D A;  1LS8 A;  3BJH A;  3CYZ A;  2QEB A;  3CZ1 A;  1GM0 A;  3S0F A;  5DIC A;  3B7A A;  2L2C A;  3S0G A;  2ERB A;  2WCL A;  2GTE A;  2P70 A;  2JPO A;  3L4L A;  4INX A;  3BFB A;  3R1V A;  2WC5 A;  2WCK A;  3NHT A;  1C3Y A;  3VB1 A;  3V2L A;  2QEV A;  2WCH A;  3NHI A;  2PQL A;  1OOG A;  4F7F A;  3D78 A;  3L47 A;  1OW4 A;  1OOF A;  1ORG A;  3BFA A;  4FQT A;  2QDI A;  2FJY A;  1XFR A;  3D77 A;  4PT1 A;  1TUJ A;  3S0B A;  3K1E A;  3RZS A;  3FE8 A;  1DQE A;  3NGV A;  1C3Z A;  3B86 A;  2WCM A;  3L4A A;  2P71 A;  3CDN A;  1P28 A;  3S0E A;  5EL2 A;  4OZD A;  3CZ0 A;  3BFH A;  3DXL A;  3B6X A;  3S0A A;  3D74 A;  2WC6 A;  3R1P A;  3Q8I A;  1OOH A;  3QME A;  3R72 A;  1TWO A;  3D76 A;  2WCJ A;  3R1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...