3S0AA

Apis mellifera obp14, native apo-protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
molecule keywords OBP14
molecule tags Transport protein
source organism Apis mellifera
total genus 49
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0aA00
3DY9A 3CZ2A 2ERBA 3D78A 2WC5A 1XFRA 1OW4A 1P28A 4F7FA 1LS8A 3S0DA 1OOFA 3FE8A 3L4LA 3N7HA 2GTEA 4INWA 3NHIA 5DICA 3B88A 3FE6A 4FQTA 3D73A 3QMEA 2WCJA 2QEHA 2P70A 3R72A 3S0AA 2KPHA 3DZTA 2PQLA 3BFBA 3R1OA 3FE9A 3BJHA 2WCHA 3PJIA 1DQEA 3OGNA 3NHTA 1OOHA 3V2LA 2WC6A 4JD9A 2QDIA 3D75A 3DYEA 3R1VA 3L47A 2QEVA 3B87A 1GM0A 4PT1A 3S0FA 3BFHA 2FJYA 2H8VA 3CZ0A 3BFAA 3B7AA 3D77A 1C3ZA 1QWVA 4OZDA 3L4AA 1ORGA 3K1EA 2WCLA 3S0GA 3NGVA 1T14A 3B86A 1OOIX 2P71A 3VB1A 3RZSA 3S0EA 3D76A 2JPOA 1TWOA 3B6XA 5EL2A 3S0BA 3CABA 3R1PA 2L2CA 1TUJA 3D74A 3Q8IA 2QEBA 1OOGA 2WCMA 3CZ1A 3CYZA 3CDNA 4INXA 3DXLA 1C3YA 2QEOA 2WCKA
chains in the Genus database with same CATH superfamily
1U5IA 2LNKA 3E3RA 1YR5A 3DY9A 1K96A 2RGIA 3TDUA 1SKTA 2K2FA 3OX6A 2ZRTA 1IH0A 3SIAA 1NCZA 2JPTA 4XJKA 2NCOA 5HKYA 4DUQA 1RWYA 2L50A 4GAOA 4ZCUA 5I2LA 4TNCA 1CFFA 1NSHA 1VRKA 1L2OB 2F2OA 1LS8A 2KSPA 1CKKA 1QIWA 1OOFA 1DMOA 3A4UB 4YRUA 1N65A 2L5YA 3BUNB 2PSRA 1K2HA 1SW8A 2K7BA 2KNEA 2LMTA 1SSEB 1BR4B 1JFKA 2GV5A 3L4LA 2KFHA 2LVKA 1RTP1 3EG5B 1K8UA 3O6BA 3PLFB 2JWWA 4MZLA 2P6BB 1MWNA 1BR1B 1PK0D 2VRGA 3FE6A 1OQPA 1Y1AA 1KWOB 2I7AA 3EVVA 3D73A 2CCMA 1QLSA 1IG5A 1TIZA 1WRZA 2WCJA 1JC2A 1NX1A 2P70A 5HKWA 1TNPA 3S0AA 4QJ5B 4A4BA 2CNPA 2KPHA 2K8MB 3DZTA 4PCWA 2KYFA 2MRDA 3VRPA 1IIOA 2HETA 2JC2A 3I5IC 3FE9A 2I94A 3GK2A 1J7RA 2H2KA 2LAPA 1AJ4A 2M1KB 2O5GA 2WCHA 3DVKA 4GNKB 1BU3A 3EKJA 1BF5A 1L7ZA 4YGDB 1M46A 1C07A 2JT0A 4PHNA 3OGNA 4HRHA 1OOHA 1XFUO 1YUSA 4I5JA 3V2LA 2BBNA 1F54A 1KQVA 4M2PA 2JT3A 2LLTA 2F33A 1DT7B 1NCXA 1NX3A 2LP2A 2WC6A 3GOFA 3NXAA 4YGEB 1WRKA 1KK7Z 2LM5A 3CR4X 4N1FA 3MSEB 1W7IB 2L98A 3R1VA 1GQMA 1M39A 4YGCB 1PULA 3RM1A 4JKTA 3IVTA 2PYQA 3JTDB 4MEWA 1OZSA 2R2IA 2F3ZA 1R2UA 1HQVA 1UHHA 1UUSA 4PT1A 1NCYA 5DKRA 3FIAA 2KQYA 2Y1NA 5G08A 2BCAA 2G9BA 2KQ6A 1IQ3A 1JBAA 1FI5A 2DOQA 3OB2B 2BKHB 3SIBA 2Y1MA 2YGUA 1BMOA 4CFQA 1XK4A 1OMVA 1KSOA 1NYAA 1DGUA 3O78A 4DS7A 2LHIA 1ORGA 2PALA 3PM8A 2WCBA 4XYNA 3SG5A 2ZRSA 1CFPA 2Y5IA 1SR6C 5I94A 1NX0A 3KF9A 3DVJA 2COLB 2NXQA 3AKBA 2OTGB 1DTLA 1TWOA 1UWOA 1YURA 2M29A 4GGFA 2BNXA 1N2DA 2KI4C 1MXEA 1MHOA 2JULA 1QLKA 2LP3A 1B47A 4HRGA 1AVSA 1TTXA 1SMGA 2LVJA 3GK1A 3CABA 5FYXA 2ISDA 1J7QA 2SASA 4A4CA 5FI7A 1A03A 1LA3A 1LA0A 3D74A 1M31A 3KEVA 1DJHA 2QEBA 2BE6A 1A2XA 1RK9A 3OB1B 4USLA 4GUKA 2QACA 1SY9A 2JRFA 2KFGA 2LC5A 1ODBA 1C7VA 4UPGA 2ZN8A 2K7DA 3DXLA 1IRJA 3EVRA 4CPVA 5HLOA 2BCBA 5AANA 1XFZO 2IS9A 1CDNA 4D1EA 2MLFC 1K9KA 3SG6A 1SNLA 2KAYA 3HCMA 2KYCA 2NZ0A 3CGAA 1GJYA 2O60A 5D3OA 2FOTA 3ZNIA 3CR2A 4C0LA 5HLVA 1PRWA 2LHLA 1KFXL 2ZFDA 3PALA 1QX5B 2OS8C 1OW4A 1P28A 2ZN9A 4F7FA 1G4YR 3F45A 3UO9A 4PE1A 3I5IB 5HYDA 2F8PA 5F6TA 4HREE 2G2BA 2L5XB 5CSJA 1NIWA 3BUMB 1IJ6A 4DIRA 3EK8A 4MZJA 4NQGA 5DICA 2K61A 2LUXA 3CTNA 3SG3A 3IQOA 1D1OA 1A4PA 1QXPA 1TNWA 2MAZA 1J7PA 5HL1A 1B8LA 1CFDA 1K9UA 3NSOA 1UHKA 1JUOA 1S6CA 2M9GA 3QMEA 4MVFA 4YI9A 3PN7C 1OE9B 2QEHA 5HKZA 2LVVA 1JWDA 3NSKA 2WOSA 3UNWA 5D7FA 2PQLA 1K95A 2LE9B 3WNXB 1FPWA 2M7NA 2NLNA 3DF0B 1ZUZA 1DQEA 1NP8A 2H61C 1TNQA 1QJTA 1JSAA 4YGAA 1S5GZ 3LK1A 4NDDA 5AXIA 1FW4A 1ZACA 2KFFA 1CDLA 4ORAB 1NPQA 1KSMA 2F3YA 2ZKMX 3BOWB 1EG3A 3D75A 4GFTA 3DYEA 4HSZA 4WRIA 1V1GA 1KFUS 3AAJA 3LK0A 4MZKA 1TCOB 2LV7A 1H4BA 3EK4A 1CDMA 1Y1XA 1Q80A 1FI6A 3WHUB 3LCPC 2QEVA 3SS4A 3B87A 1CMGA 1GM0A 1SR6B 1XVJA 1DVIA 2LLUA 3BOWA 1DC1A 4PDZA 2AUCA 3OHMB 3S0FA 4I5LB 2KBIA 1OZOA 1OOJA 3D0YB 2FJYA 1AHRA 1X02A 2H8VA 2JTTA 3CZ0A 3OX5A 4M2QA 4P5OE 4YBHB 3DVMA 2JQ6A 2KI4B 3PM2A 2JNFA 1GGZA 3IF7A 5DKNA 1CB1A 4DRWA 4ORBB 4U8DA 1KK8C 3D0YA 2A4JA 1XFWO 2GGZA 2CXJA 4OZDA 5BPJA 1KCYA 2KAXA 3VROA 5I2OA 2BCXA 2WCLA 2Q4UA 1K94A 2M0RA 1QX2A 1XFXO 2M49B 5AERA 2CT9A 2K60A 5JJGA 1EH2A 2WCFA 1B8RA 1PALA 2JU0A 2MLEC 3VB1A 1YUTA 1RJVA 2ZNDA 2EC6C 1BODA 2LMUA 1F55A 2HPSA 1G8IA 2LMVA 3KPXA 3D10A 4MLWA 3SS3A 4OV2A 4OKHA 2L2CA 3KO0A 2OS8B 1OOGA 2D8NA 4MRYA 2SCPA 2TN4A 3BQ3A 4PHMA 3CR5X 4JWQA 5KTYA 4Q04A 3NSIA 4GGNA 1CMFA 4INXA 2JZIA 3FWCA 2K2AA 2QEOA 4YI8A 5D69A 1DELA 2WORA 2KOTA 4JPZB 1TNXA 4R1EA 2KLDA 3DD4A 3HX4A 3PN7B 1QIVA 1IJ5A 2KHNA 2WC5A 2KAVA 2KI6D 2BECA 2BL0C 2LUCA 2ZNEA 3CS1A 5CSIA 1Y0VH 1MQ1A 4PHKA 1IWQA 3S0DA 1S3PA 3VGOA 1KK7Y 1S36A 3GK4X 1BT6A 3M0WA 2Q91A 4CFRA 1B7TZ 4P2YB 1A75B 3TDIA 2JT8A 2KGRA 3TS5C 4INWA 1XO5A 1Y6WA 3NHIA 3TUYC 2FJUB 1TRFA 1QX7A 1RFJA 4JQ0D 1AP4A 4DCKA 1QVIZ 1A75A 4FQTA 1SCMC 3OP0A 4MN0A 2H61A 2M7LA 5KSZA 1ALWA 3R72A 2EHBA 5CSFA 3QRXA 1F8HA 2BAPA 1QS7A 1MXLC 4ETOA 3ICBA 1UHJA 1SL9A 3BFBA 3R1OA 1F70A 3C1VA 1QV0A 4FTGA 2OPOA 5AFPA 5GQQC 3BXKA 3PJIA 4BY5A 1B1GA 1DGVA 1SL7A 1NWDA 4M2OA 1SCVA 1XYDA 1TOPA 3A8RA 3I5GC 1QASA 5CPVA 3TZ1A 1AUIB 3SS5A 3BUXB 1JF0A 3ZWHA 1KK8B 4JD9A 4OVNF 1MUXA 1E8AA 2LANA 3AAKA 4N1GA 1IQ5A 1UHIA 1EG4A 1DJIA 1PSBA 2E30A 4MRXA 1XK4C 1S26D 2KI6C 4CIDA 4QJ3B 1XFYO 1YRUB 4ZCVA 4YGBB 5KU1A 1CM1A 3SG4A 3BFHA 1DJXA 1SYMA 1TN4A 3B7AA 2MHHA 1M63B 1K90D 4NDCA 2MJWB 4WQ2A 2EC6B 2L2EA 4GGFC 3BYAA 1C3ZA 3DVEA 5ER5A 4I5KA 1TUZA 2JOJA 4ICBA 1QWVA 2GGMA 1BOCA 1EJ3A 2I18A 1W9ZA 4PE7A 3K1EA 2LCPA 1DJZA 4I5NB 2FCDA 1J55A 3DF0A 3S0GA 1XA5A 1YTZC 1PVAA 5B8IB 2BKIB 2QPTA 1IKUA 2HQWA 5CSNA 3B86A 3VRRA 2LLSA 1OOIX 1FBVA 2P71A 3BUWB 4GBAA 3D76A 2JPOA 1YVHA 1BLQA 3I5HC 1WY9A 4PE0A 1PVBA 3KHEA 4GPLB 3EVUA 1K9PA 2JTZA 1WDCC 1ZOTB 4IL1A 2CBLA 2I2RE 3CWGA 1EXRA 5FI6A 3R1PA 1SRAA 1YVLA 1KQMC 2L0PA 2BL0B 2KBMA 3SG2A 4BY4A 2BE4A 3Q8IA 1WLMA 1ZFSA 1F4QA 2WCMA 1AJ5A 1CLBA 1QATA 1GGWA 3CYZA 3O4YA 2JXCA 4F0ZB 2EGDA 3TS5B 2JNXA 3CLNA 3LL8B 1CLLA 2F2PA 1S6JA 4L9MA 3TUYB 1H8BA 2WCKA 1QV1A 4OCIA 5IBWA 2K7OA 2M3WA 2PVBA 1W7JB 2L51A 4OR9B 1V1FA 1SCMB 1ALVA 1S5GY 1LVCD 4E68A 3CZ2A 3BUOB 1DF0B 2ERBA 3D78A 1Z2CB 2E6WA 1XFRA 3SJSA 1DJGA 3K21A 3NSLA 4FQOA 1CDPA 1PSRA 3FE8A 1DJYA 3PSRA 4PHJA 3I5FC 4AQIA 1N0YA 1B8CA 1B4CA 3N7HA 1CTRA 1LKJA 1DF0A 2GTEA 4QJ4B 1XFVO 3B88A 2HQ8A 2BBMA 3O2PA 3JVTC 1RECA 4AOMA 3WXAA 3I5GB 3FS7A 4NDBA 3EK7A 1L2OC 5I8NA 3PFVA 1TCFA 2K0JA 1RROA 5AEQA 1CM4A 3BJHA 3LLEA 4C0KA 1YRTB 2AAOA 2M8UA 4KYNA 3IQQA 1F71A 1OMRA 3NHTA 2MBXA 1CFCA 2MA2A 4MBEA 1KWOC 4MSPA 1IGVA 2QDIA 2WNDA 1NUBA 1WLZA 1K93D 3RLZA 2PASA 3SG7A 4IJ7A 3L47A 3EKHA 3VRQA 1S1EA 3H4SE 2L4IA 3VRNA 2CTNA 5I2QA 1MR8A 5FI2A 5JOLA 2M1UA 2LVIA 2PRUA 3AKAA 2FCEA 1JFJA 1M45A 3O4XA 1S6IA 3BFAA 3I5HB 4N5XA 3D77A 3WHTB 1J1DA 3OBVA 1FF1A 1YX7A 3TDZA 1WDCB 1A29A 2PMYA 1SBJA 1B9AA 2B1UA 1KQMB 2KGBC 3L4AA 2K7CA 2V53A 1LINA 1QTXA 1G33A 1NX2A 2WCEA 5DKQA 3NGVA 1J1EA 3JTDC 1T14A 2M97A 1Z4HA 4C0JA 5K89A 2KDHA 1LXFC 1Y1UA 1MF8B 1EL4A 1OSAA 1HT9A 3RZSA 4WQ3A 3S0EA 1DJWA 1SPYA 1YUUA 1B7TY 4PALA 2NCPA 4CLNA 1CNPA 1KFXS 3B6XA 5ER4X 2L4HA 5EL2A 2AMIA 2HF5A 3S0BA 1BG1A 1DEKA 4PE4A 4ORCB 5TNCA 1J7OA 1QVIY 1TUJA 3CZTX 1AK8A 1OMDA 1UP5A 1SL8A 5J3XA 1UHNA 1C7WA 5PALA 1CLMA 2JXLA 4AQJA 1WRLA 1SK6D 1F4OA 1UURA 3CZ1A 1U5IB 2Y4QA 3FWBA 2WC8A 3CDNA 1ZMZA 3I5FB 1BJFA 1JF2A 3PATA 2OTGC 4XJKB 2KLEA 1C3YA 1YX8A 3JVTB 1KFUL 1R6PA
chains in the Genus database with same CATH topology
3DY9A 3CZ2A 2ERBA 3D78A 2WC5A 1XFRA 1OW4A 1P28A 4F7FA 1LS8A 3S0DA 1OOFA 3FE8A 3L4LA 3N7HA 2GTEA 4INWA 3NHIA 5DICA 3B88A 3FE6A 4FQTA 3D73A 3QMEA 2WCJA 2QEHA 2P70A 3R72A 3S0AA 2KPHA 3DZTA 2PQLA 3BFBA 3R1OA 3FE9A 3BJHA 2WCHA 3PJIA 1DQEA 3OGNA 3NHTA 1OOHA 3V2LA 2WC6A 4JD9A 2QDIA 3D75A 3DYEA 3R1VA 3L47A 2QEVA 3B87A 1GM0A 4PT1A 3S0FA 3BFHA 2FJYA 2H8VA 3CZ0A 3BFAA 3B7AA 3D77A 1C3ZA 1QWVA 4OZDA 3L4AA 1ORGA 3K1EA 2WCLA 3S0GA 3NGVA 1T14A 3B86A 1OOIX 2P71A 3VB1A 3RZSA 3S0EA 3D76A 2JPOA 1TWOA 3B6XA 5EL2A 3S0BA 3CABA 3R1PA 2L2CA 1TUJA 3D74A 3Q8IA 2QEBA 1OOGA 2WCMA 3CZ1A 3CYZA 3CDNA 4INXA 3DXLA 1C3YA 2QEOA 2WCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DY9 A;  3CZ2 A;  2ERB A;  3D78 A;  2WC5 A;  1XFR A;  1OW4 A;  1P28 A;  4F7F A;  1LS8 A;  3S0D A;  1OOF A;  3FE8 A;  3L4L A;  3N7H A;  2GTE A;  4INW A;  3NHI A;  5DIC A;  3B88 A;  3FE6 A;  4FQT A;  3D73 A;  3QME A;  2WCJ A;  2QEH A;  2P70 A;  3R72 A;  3S0A A;  2KPH A;  3DZT A;  2PQL A;  3BFB A;  3R1O A;  3FE9 A;  3BJH A;  2WCH A;  3PJI A;  1DQE A;  3OGN A;  3NHT A;  1OOH A;  3V2L A;  2WC6 A;  4JD9 A;  2QDI A;  3D75 A;  3DYE A;  3R1V A;  3L47 A;  2QEV A;  3B87 A;  1GM0 A;  4PT1 A;  3S0F A;  3BFH A;  2FJY A;  2H8V A;  3CZ0 A;  3BFA A;  3B7A A;  3D77 A;  1C3Z A;  1QWV A;  4OZD A;  3L4A A;  1ORG A;  3K1E A;  2WCL A;  3S0G A;  3NGV A;  1T14 A;  3B86 A;  1OOI X;  2P71 A;  3VB1 A;  3RZS A;  3S0E A;  3D76 A;  2JPO A;  1TWO A;  3B6X A;  5EL2 A;  3S0B A;  3CAB A;  3R1P A;  2L2C A;  1TUJ A;  3D74 A;  3Q8I A;  2QEB A;  1OOG A;  2WCM A;  3CZ1 A;  3CYZ A;  3CDN A;  4INX A;  3DXL A;  1C3Y A;  2QEO A;  2WCK A; 
#chains in the Genus database with same CATH topology
 1U5I A;  2LNK A;  3E3R A;  1YR5 A;  3DY9 A;  1K96 A;  2RGI A;  3TDU A;  1SKT A;  2K2F A;  3OX6 A;  2ZRT A;  1IH0 A;  3SIA A;  1NCZ A;  2JPT A;  4XJK A;  2NCO A;  5HKY A;  4DUQ A;  1RWY A;  2L50 A;  4GAO A;  4ZCU A;  5I2L A;  4TNC A;  1CFF A;  1NSH A;  1VRK A;  1L2O B;  2F2O A;  1LS8 A;  2KSP A;  1CKK A;  1QIW A;  1OOF A;  1DMO A;  3A4U B;  4YRU A;  1N65 A;  2L5Y A;  3BUN B;  2PSR A;  1K2H A;  1SW8 A;  2K7B A;  2KNE A;  2LMT A;  1SSE B;  1BR4 B;  1JFK A;  2GV5 A;  3L4L A;  2KFH A;  2LVK A;  1RTP 1;  3EG5 B;  1K8U A;  3O6B A;  3PLF B;  2JWW A;  4MZL A;  2P6B B;  1MWN A;  1BR1 B;  1PK0 D;  2VRG A;  3FE6 A;  1OQP A;  1Y1A A;  1KWO B;  2I7A A;  3EVV A;  3D73 A;  2CCM A;  1QLS A;  1IG5 A;  1TIZ A;  1WRZ A;  2WCJ A;  1JC2 A;  1NX1 A;  2P70 A;  5HKW A;  1TNP A;  3S0A A;  4QJ5 B;  4A4B A;  2CNP A;  2KPH A;  2K8M B;  3DZT A;  4PCW A;  2KYF A;  2MRD A;  3VRP A;  1IIO A;  2HET A;  2JC2 A;  3I5I C;  3FE9 A;  2I94 A;  3GK2 A;  1J7R A;  2H2K A;  2LAP A;  1AJ4 A;  2M1K B;  2O5G A;  2WCH A;  3DVK A;  4GNK B;  1BU3 A;  3EKJ A;  1BF5 A;  1L7Z A;  4YGD B;  1M46 A;  1C07 A;  2JT0 A;  4PHN A;  3OGN A;  4HRH A;  1OOH A;  1XFU O;  1YUS A;  4I5J A;  3V2L A;  2BBN A;  1F54 A;  1KQV A;  4M2P A;  2JT3 A;  2LLT A;  2F33 A;  1DT7 B;  1NCX A;  1NX3 A;  2LP2 A;  2WC6 A;  3GOF A;  3NXA A;  4YGE B;  1WRK A;  1KK7 Z;  2LM5 A;  3CR4 X;  4N1F A;  3MSE B;  1W7I B;  2L98 A;  3R1V A;  1GQM A;  1M39 A;  4YGC B;  1PUL A;  3RM1 A;  4JKT A;  3IVT A;  2PYQ A;  3JTD B;  4MEW A;  1OZS A;  2R2I A;  2F3Z A;  1R2U A;  1HQV A;  1UHH A;  1UUS A;  4PT1 A;  1NCY A;  5DKR A;  3FIA A;  2KQY A;  2Y1N A;  5G08 A;  2BCA A;  2G9B A;  2KQ6 A;  1IQ3 A;  1JBA A;  1FI5 A;  2DOQ A;  3OB2 B;  2BKH B;  3SIB A;  2Y1M A;  2YGU A;  1BMO A;  4CFQ A;  1XK4 A;  1OMV A;  1KSO A;  1NYA A;  1DGU A;  3O78 A;  4DS7 A;  2LHI A;  1ORG A;  2PAL A;  3PM8 A;  2WCB A;  4XYN A;  3SG5 A;  2ZRS A;  1CFP A;  2Y5I A;  1SR6 C;  5I94 A;  1NX0 A;  3KF9 A;  3DVJ A;  2COL B;  2NXQ A;  3AKB A;  2OTG B;  1DTL A;  1TWO A;  1UWO A;  1YUR A;  2M29 A;  4GGF A;  2BNX A;  1N2D A;  2KI4 C;  1MXE A;  1MHO A;  2JUL A;  1QLK A;  2LP3 A;  1B47 A;  4HRG A;  1AVS A;  1TTX A;  1SMG A;  2LVJ A;  3GK1 A;  3CAB A;  5FYX A;  2ISD A;  1J7Q A;  2SAS A;  4A4C A;  5FI7 A;  1A03 A;  1LA3 A;  1LA0 A;  3D74 A;  1M31 A;  3KEV A;  1DJH A;  2QEB A;  2BE6 A;  1A2X A;  1RK9 A;  3OB1 B;  4USL A;  4GUK A;  2QAC A;  1SY9 A;  2JRF A;  2KFG A;  2LC5 A;  1ODB A;  1C7V A;  4UPG A;  2ZN8 A;  2K7D A;  3DXL A;  1IRJ A;  3EVR A;  4CPV A;  5HLO A;  2BCB A;  5AAN A;  1XFZ O;  2IS9 A;  1CDN A;  4D1E A;  2MLF C;  1K9K A;  3SG6 A;  1SNL A;  2KAY A;  3HCM A;  2KYC A;  2NZ0 A;  3CGA A;  1GJY A;  2O60 A;  5D3O A;  2FOT A;  3ZNI A;  3CR2 A;  4C0L A;  5HLV A;  1PRW A;  2LHL A;  1KFX L;  2ZFD A;  3PAL A;  1QX5 B;  2OS8 C;  1OW4 A;  1P28 A;  2ZN9 A;  4F7F A;  1G4Y R;  3F45 A;  3UO9 A;  4PE1 A;  3I5I B;  5HYD A;  2F8P A;  5F6T A;  4HRE E;  2G2B A;  2L5X B;  5CSJ A;  1NIW A;  3BUM B;  1IJ6 A;  4DIR A;  3EK8 A;  4MZJ A;  4NQG A;  5DIC A;  2K61 A;  2LUX A;  3CTN A;  3SG3 A;  3IQO A;  1D1O A;  1A4P A;  1QXP A;  1TNW A;  2MAZ A;  1J7P A;  5HL1 A;  1B8L A;  1CFD A;  1K9U A;  3NSO A;  1UHK A;  1JUO A;  1S6C A;  2M9G A;  3QME A;  4MVF A;  4YI9 A;  3PN7 C;  1OE9 B;  2QEH A;  5HKZ A;  2LVV A;  1JWD A;  3NSK A;  2WOS A;  3UNW A;  5D7F A;  2PQL A;  1K95 A;  2LE9 B;  3WNX B;  1FPW A;  2M7N A;  2NLN A;  3DF0 B;  1ZUZ A;  1DQE A;  1NP8 A;  2H61 C;  1TNQ A;  1QJT A;  1JSA A;  4YGA A;  1S5G Z;  3LK1 A;  4NDD A;  5AXI A;  1FW4 A;  1ZAC A;  2KFF A;  1CDL A;  4ORA B;  1NPQ A;  1KSM A;  2F3Y A;  2ZKM X;  3BOW B;  1EG3 A;  3D75 A;  4GFT A;  3DYE A;  4HSZ A;  4WRI A;  1V1G A;  1KFU S;  3AAJ A;  3LK0 A;  4MZK A;  1TCO B;  2LV7 A;  1H4B A;  3EK4 A;  1CDM A;  1Y1X A;  1Q80 A;  1FI6 A;  3WHU B;  3LCP C;  2QEV A;  3SS4 A;  3B87 A;  1CMG A;  1GM0 A;  1SR6 B;  1XVJ A;  1DVI A;  2LLU A;  3BOW A;  1DC1 A;  4PDZ A;  2AUC A;  3OHM B;  3S0F A;  4I5L B;  2KBI A;  1OZO A;  1OOJ A;  3D0Y B;  2FJY A;  1AHR A;  1X02 A;  2H8V A;  2JTT A;  3CZ0 A;  3OX5 A;  4M2Q A;  4P5O E;  4YBH B;  3DVM A;  2JQ6 A;  2KI4 B;  3PM2 A;  2JNF A;  1GGZ A;  3IF7 A;  5DKN A;  1CB1 A;  4DRW A;  4ORB B;  4U8D A;  1KK8 C;  3D0Y A;  2A4J A;  1XFW O;  2GGZ A;  2CXJ A;  4OZD A;  5BPJ A;  1KCY A;  2KAX A;  3VRO A;  5I2O A;  2BCX A;  2WCL A;  2Q4U A;  1K94 A;  2M0R A;  1QX2 A;  1XFX O;  2M49 B;  5AER A;  2CT9 A;  2K60 A;  5JJG A;  1EH2 A;  2WCF A;  1B8R A;  1PAL A;  2JU0 A;  2MLE C;  3VB1 A;  1YUT A;  1RJV A;  2ZND A;  2EC6 C;  1BOD A;  2LMU A;  1F55 A;  2HPS A;  1G8I A;  2LMV A;  3KPX A;  3D10 A;  4MLW A;  3SS3 A;  4OV2 A;  4OKH A;  2L2C A;  3KO0 A;  2OS8 B;  1OOG A;  2D8N A;  4MRY A;  2SCP A;  2TN4 A;  3BQ3 A;  4PHM A;  3CR5 X;  4JWQ A;  5KTY A;  4Q04 A;  3NSI A;  4GGN A;  1CMF A;  4INX A;  2JZI A;  3FWC A;  2K2A A;  2QEO A;  4YI8 A;  5D69 A;  1DEL A;  2WOR A;  2KOT A;  4JPZ B;  1TNX A;  4R1E A;  2KLD A;  3DD4 A;  3HX4 A;  3PN7 B;  1QIV A;  1IJ5 A;  2KHN A;  2WC5 A;  2KAV A;  2KI6 D;  2BEC A;  2BL0 C;  2LUC A;  2ZNE A;  3CS1 A;  5CSI A;  1Y0V H;  1MQ1 A;  4PHK A;  1IWQ A;  3S0D A;  1S3P A;  3VGO A;  1KK7 Y;  1S36 A;  3GK4 X;  1BT6 A;  3M0W A;  2Q91 A;  4CFR A;  1B7T Z;  4P2Y B;  1A75 B;  3TDI A;  2JT8 A;  2KGR A;  3TS5 C;  4INW A;  1XO5 A;  1Y6W A;  3NHI A;  3TUY C;  2FJU B;  1TRF A;  1QX7 A;  1RFJ A;  4JQ0 D;  1AP4 A;  4DCK A;  1QVI Z;  1A75 A;  4FQT A;  1SCM C;  3OP0 A;  4MN0 A;  2H61 A;  2M7L A;  5KSZ A;  1ALW A;  3R72 A;  2EHB A;  5CSF A;  3QRX A;  1F8H A;  2BAP A;  1QS7 A;  1MXL C;  4ETO A;  3ICB A;  1UHJ A;  1SL9 A;  3BFB A;  3R1O A;  1F70 A;  3C1V A;  1QV0 A;  4FTG A;  2OPO A;  5AFP A;  5GQQ C;  3BXK A;  3PJI A;  4BY5 A;  1B1G A;  1DGV A;  1SL7 A;  1NWD A;  4M2O A;  1SCV A;  1XYD A;  1TOP A;  3A8R A;  3I5G C;  1QAS A;  5CPV A;  3TZ1 A;  1AUI B;  3SS5 A;  3BUX B;  1JF0 A;  3ZWH A;  1KK8 B;  4JD9 A;  4OVN F;  1MUX A;  1E8A A;  2LAN A;  3AAK A;  4N1G A;  1IQ5 A;  1UHI A;  1EG4 A;  1DJI A;  1PSB A;  2E30 A;  4MRX A;  1XK4 C;  1S26 D;  2KI6 C;  4CID A;  4QJ3 B;  1XFY O;  1YRU B;  4ZCV A;  4YGB B;  5KU1 A;  1CM1 A;  3SG4 A;  3BFH A;  1DJX A;  1SYM A;  1TN4 A;  3B7A A;  2MHH A;  1M63 B;  1K90 D;  4NDC A;  2MJW B;  4WQ2 A;  2EC6 B;  2L2E A;  4GGF C;  3BYA A;  1C3Z A;  3DVE A;  5ER5 A;  4I5K A;  1TUZ A;  2JOJ A;  4ICB A;  1QWV A;  2GGM A;  1BOC A;  1EJ3 A;  2I18 A;  1W9Z A;  4PE7 A;  3K1E A;  2LCP A;  1DJZ A;  4I5N B;  2FCD A;  1J55 A;  3DF0 A;  3S0G A;  1XA5 A;  1YTZ C;  1PVA A;  5B8I B;  2BKI B;  2QPT A;  1IKU A;  2HQW A;  5CSN A;  3B86 A;  3VRR A;  2LLS A;  1OOI X;  1FBV A;  2P71 A;  3BUW B;  4GBA A;  3D76 A;  2JPO A;  1YVH A;  1BLQ A;  3I5H C;  1WY9 A;  4PE0 A;  1PVB A;  3KHE A;  4GPL B;  3EVU A;  1K9P A;  2JTZ A;  1WDC C;  1ZOT B;  4IL1 A;  2CBL A;  2I2R E;  3CWG A;  1EXR A;  5FI6 A;  3R1P A;  1SRA A;  1YVL A;  1KQM C;  2L0P A;  2BL0 B;  2KBM A;  3SG2 A;  4BY4 A;  2BE4 A;  3Q8I A;  1WLM A;  1ZFS A;  1F4Q A;  2WCM A;  1AJ5 A;  1CLB A;  1QAT A;  1GGW A;  3CYZ A;  3O4Y A;  2JXC A;  4F0Z B;  2EGD A;  3TS5 B;  2JNX A;  3CLN A;  3LL8 B;  1CLL A;  2F2P A;  1S6J A;  4L9M A;  3TUY B;  1H8B A;  2WCK A;  1QV1 A;  4OCI A;  5IBW A;  2K7O A;  2M3W A;  2PVB A;  1W7J B;  2L51 A;  4OR9 B;  1V1F A;  1SCM B;  1ALV A;  1S5G Y;  1LVC D;  4E68 A;  3CZ2 A;  3BUO B;  1DF0 B;  2ERB A;  3D78 A;  1Z2C B;  2E6W A;  1XFR A;  3SJS A;  1DJG A;  3K21 A;  3NSL A;  4FQO A;  1CDP A;  1PSR A;  3FE8 A;  1DJY A;  3PSR A;  4PHJ A;  3I5F C;  4AQI A;  1N0Y A;  1B8C A;  1B4C A;  3N7H A;  1CTR A;  1LKJ A;  1DF0 A;  2GTE A;  4QJ4 B;  1XFV O;  3B88 A;  2HQ8 A;  2BBM A;  3O2P A;  3JVT C;  1REC A;  4AOM A;  3WXA A;  3I5G B;  3FS7 A;  4NDB A;  3EK7 A;  1L2O C;  5I8N A;  3PFV A;  1TCF A;  2K0J A;  1RRO A;  5AEQ A;  1CM4 A;  3BJH A;  3LLE A;  4C0K A;  1YRT B;  2AAO A;  2M8U A;  4KYN A;  3IQQ A;  1F71 A;  1OMR A;  3NHT A;  2MBX A;  1CFC A;  2MA2 A;  4MBE A;  1KWO C;  4MSP A;  1IGV A;  2QDI A;  2WND A;  1NUB A;  1WLZ A;  1K93 D;  3RLZ A;  2PAS A;  3SG7 A;  4IJ7 A;  3L47 A;  3EKH A;  3VRQ A;  1S1E A;  3H4S E;  2L4I A;  3VRN A;  2CTN A;  5I2Q A;  1MR8 A;  5FI2 A;  5JOL A;  2M1U A;  2LVI A;  2PRU A;  3AKA A;  2FCE A;  1JFJ A;  1M45 A;  3O4X A;  1S6I A;  3BFA A;  3I5H B;  4N5X A;  3D77 A;  3WHT B;  1J1D A;  3OBV A;  1FF1 A;  1YX7 A;  3TDZ A;  1WDC B;  1A29 A;  2PMY A;  1SBJ A;  1B9A A;  2B1U A;  1KQM B;  2KGB C;  3L4A A;  2K7C A;  2V53 A;  1LIN A;  1QTX A;  1G33 A;  1NX2 A;  2WCE A;  5DKQ A;  3NGV A;  1J1E A;  3JTD C;  1T14 A;  2M97 A;  1Z4H A;  4C0J A;  5K89 A;  2KDH A;  1LXF C;  1Y1U A;  1MF8 B;  1EL4 A;  1OSA A;  1HT9 A;  3RZS A;  4WQ3 A;  3S0E A;  1DJW A;  1SPY A;  1YUU A;  1B7T Y;  4PAL A;  2NCP A;  4CLN A;  1CNP A;  1KFX S;  3B6X A;  5ER4 X;  2L4H A;  5EL2 A;  2AMI A;  2HF5 A;  3S0B A;  1BG1 A;  1DEK A;  4PE4 A;  4ORC B;  5TNC A;  1J7O A;  1QVI Y;  1TUJ A;  3CZT X;  1AK8 A;  1OMD A;  1UP5 A;  1SL8 A;  5J3X A;  1UHN A;  1C7W A;  5PAL A;  1CLM A;  2JXL A;  4AQJ A;  1WRL A;  1SK6 D;  1F4O A;  1UUR A;  3CZ1 A;  1U5I B;  2Y4Q A;  3FWB A;  2WC8 A;  3CDN A;  1ZMZ A;  3I5F B;  1BJF A;  1JF2 A;  3PAT A;  2OTG C;  4XJK B;  2KLE A;  1C3Y A;  1YX8 A;  3JVT B;  1KFU L;  1R6P A; 
#chains in the Genus database with same CATH homology
 3DY9 A;  3CZ2 A;  2ERB A;  3D78 A;  2WC5 A;  1XFR A;  1OW4 A;  1P28 A;  4F7F A;  1LS8 A;  3S0D A;  1OOF A;  3FE8 A;  3L4L A;  3N7H A;  2GTE A;  4INW A;  3NHI A;  5DIC A;  3B88 A;  3FE6 A;  4FQT A;  3D73 A;  3QME A;  2WCJ A;  2QEH A;  2P70 A;  3R72 A;  3S0A A;  2KPH A;  3DZT A;  2PQL A;  3BFB A;  3R1O A;  3FE9 A;  3BJH A;  2WCH A;  3PJI A;  1DQE A;  3OGN A;  3NHT A;  1OOH A;  3V2L A;  2WC6 A;  4JD9 A;  2QDI A;  3D75 A;  3DYE A;  3R1V A;  3L47 A;  2QEV A;  3B87 A;  1GM0 A;  4PT1 A;  3S0F A;  3BFH A;  2FJY A;  2H8V A;  3CZ0 A;  3BFA A;  3B7A A;  3D77 A;  1C3Z A;  1QWV A;  4OZD A;  3L4A A;  1ORG A;  3K1E A;  2WCL A;  3S0G A;  3NGV A;  1T14 A;  3B86 A;  1OOI X;  2P71 A;  3VB1 A;  3RZS A;  3S0E A;  3D76 A;  2JPO A;  1TWO A;  3B6X A;  5EL2 A;  3S0B A;  3CAB A;  3R1P A;  2L2C A;  1TUJ A;  3D74 A;  3Q8I A;  2QEB A;  1OOG A;  2WCM A;  3CZ1 A;  3CYZ A;  3CDN A;  4INX A;  3DXL A;  1C3Y A;  2QEO A;  2WCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...