3S0FA

Apis mellifera obp14 native apo, crystal form 2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
119
structure length
119
Chain Sequence
MTIEELKTRLHTEQSVCKTETGIDQQKANDVIEGNIDVEDKKVQLYCECILKNFNILDKNNVFKPQGIKAVMELLIDENSVKQLVSDCSTISEENPHLKASKLVQCVSKYKTMKSVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Apis mellifera OBP14, a C-minus odorant-binding protein, and its complexes with odorant molecules.
pubmed doi rcsb
molecule keywords OBP14
molecule tags Transport protein
source organism Apis mellifera
total genus 46
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.20 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Pheromone/general odorant binding protein domain 3s0fA00
3BJHA 3D78A 3CZ1A 3DYEA 3QMEA 2QEVA 4F7FA 2ERBA 1OOFA 2QEOA 3DXLA 3Q8IA 3BFBA 1ORGA 3NHIA 3D76A 1C3ZA 3S0AA 1TUJA 3BFHA 2P71A 3NHTA 4INXA 4FQTA 3CDNA 1OOHA 3D75A 1T14A 1LS8A 1OOGA 3R1OA 3B86A 3BFAA 3CZ2A 2QDIA 3PJIA 3VB1A 2WC6A 1QWVA 2FJYA 2JPOA 2QEHA 1DQEA 1P28A 3D74A 3S0DA 3R1VA 2WCKA 3R72A 5EL2A 3FE8A 3L47A 3CZ0A 2WC5A 3CABA 3L4LA 1XFRA 2GTEA 4INWA 3R1PA 3FE9A 3B87A 3S0EA 2PQLA 3FE6A 3B7AA 3L4AA 1GM0A 4JD9A 2L2CA 3D77A 3V2LA 4OZDA 3RZSA 1OOIX 2P70A 3S0BA 2WCJA 1TWOA 2WCLA 2WCHA 3D73A 3OGNA 3NGVA 3B88A 4PT1A 2H8VA 3S0FA 5DICA 1OW4A 2QEBA 3K1EA 3S0GA 3DZTA 3CYZA 3DY9A 3N7HA 1C3YA 3B6XA 2KPHA 2WCMA
chains in the Genus database with same CATH superfamily
1MUXA 3I5GC 1QATA 1R6PA 2CBLA 5HLVA 1QX7A 3KO0A 3I5FB 4GGFA 2LMUA 1OOFA 4YGAA 1FF1A 2LV7A 1BR4B 2GGZA 3FIAA 1B47A 1QS7A 5JOLA 2FOTA 1ORGA 3NHIA 4MZKA 2RGIA 2BL0C 3F45A 4A4BA 2M7NA 4CLNA 1AJ5A 2ZNEA 1L2OC 1QVIZ 1DMOA 3UNWA 2WCEA 4PHKA 1C7VA 1KWOB 1WRKA 2MA2A 1K8UA 2JNFA 1DEKA 2JNXA 4OR9B 1M31A 3CR5X 1H4BA 1T14A 1Y1UA 5KTYA 2JZIA 2Y4QA 2K7OA 2B1UA 3AAKA 4HRGA 3DVJA 3VRPA 1LS8A 2BBMA 1OOGA 1SK6D 1DJWA 2I7AA 2WC8A 3SJSA 3BYAA 3SG5A 4NDCA 1G8IA 3BFAA 3IQOA 1B7TY 2JT8A 3NSKA 1OSAA 1CLBA 1S5GZ 4GAOA 2LC5A 1X02A 3BQ3A 4A4CA 3EVUA 1UUSA 2KFGA 4GFTA 1QIVA 1NX3A 2JXLA 1XFYO 3D74A 4M2PA 3S0DA 1EXRA 2L2EA 5HKWA 1JF0A 1SCMC 5AERA 1DGUA 5J3XA 3OBVA 3DVEA 1XFVO 2WCKA 3R72A 2MBXA 4AQJA 3FE8A 1ALVA 1B1GA 3TDIA 1K9PA 4GBAA 4BY4A 2QPTA 1GGWA 3WXAA 2I2RE 1DF0B 1LKJA 1MXLC 3CGAA 1M63B 3ZWHA 2KYFA 3B87A 4I5NB 1K95A 1YVHA 1KQMC 3S0EA 2M29A 4JKTA 3EK7A 1OE9B 3CWGA 1S26D 1E8AA 2M3WA 3KF9A 2ZKMX 2L4HA 3I5IC 4ORCB 1U5IA 1YR5A 2L5YA 3TDUA 2LAPA 3D77A 1NCZA 3TUYC 1FBVA 2GGMA 1OOIX 1BMOA 4TNCA 3AKBA 3CLNA 1GGZA 1DELA 2JWWA 1BT6A 1RJVA 2OPOA 3OGNA 4DRWA 1TCOB 2DOQA 1QV1A 2H61C 5DKRA 4DIRA 3NXAA 5FI6A 2KLEA 1CMGA 1JFKA 2H8VA 2L51A 1KSMA 4NDBA 1BODA 1TCFA 1MXEA 1AUIB 3VRRA 2K60A 4MZJA 5FYXA 3S0GA 1OW4A 4ETOA 3LCPC 3AAJA 5AEQA 1XFUO 3SG3A 2PSRA 2NCOA 5HL1A 1JFJA 1LINA 3FWCA 3I5GB 5HLOA 2K2FA 2G2BA 5CSIA 3PM2A 3EKHA 2WCMA 1J7QA 1BOCA 4WQ3A 3D78A 4N5XA 1OZOA 2M7LA 4CIDA 3KHEA 2EGDA 4MEWA 1UP5A 3CZ1A 1XA5A 1LA0A 1Z2CB 2JU0A 3BUOB 3QMEA 1ZUZA 2ZNDA 1DJZA 4HSZA 3D10A 1J1DA 1KFUS 2BCXA 2O5GA 3QRXA 2HQWA 3DVKA 4PCWA 4NQGA 1WY9A 2QEOA 3DXLA 3K21A 3WNXB 1L2OB 1PVBA 1CNPA 5D3OA 1FI6A 4C0KA 3D0YB 3D76A 2WNDA 3HX4A 1BU3A 2L5XB 2KSPA 1C3ZA 1A75A 3PN7C 4MBEA 2I94A 2K61A 1TUJA 2QACA 1WDCC 4INXA 3H4SE 4GGFC 1S36A 1OOHA 2KAXA 2IS9A 1CKKA 1RTP1 2LM5A 2JTZA 4UPGA 1KK8C 1Y1AA 4L9MA 2NXQA 1WRLA 4YI8A 2PVBA 3SG6A 1ZMZA 3VGOA 1CFCA 1IG5A 4P5OE 1JUOA 1OMDA 3LLEA 2BBNA 2QDIA 3EVRA 3M0WA 1CB1A 1W9ZA 1QWVA 1IJ5A 2FCDA 4PHNA 1IQ3A 1OMVA 1SRAA 1FW4A 1SCMB 2JC2A 4IJ7A 1B7TZ 1DQEA 1CDMA 1NCXA 1SL7A 4YGBB 3O6BA 1Y6WA 1K93D 5ER4X 3SIAA 3TS5C 5HKYA 4JQ0D 1ZOTB 3BXKA 3R1VA 1CFDA 3GK1A 1ODBA 3CZ0A 1EG4A 2FJUB 2KLDA 2LANA 4INWA 2MLFC 1KQMB 1SR6C 3FE9A 3IQQA 1NCYA 2SASA 2MLEC 2M8UA 1QLSA 2LE9B 2LVJA 2L98A 3I5IB 1B8CA 4GPLB 4R1EA 2LVVA 3JVTC 2K7DA 1MHOA 1QJTA 4KYNA 1GQMA 3L4AA 4YI9A 2KGBC 3BOWA 1GM0A 1EG3A 1NPQA 4DS7A 4CPVA 2F3ZA 2L2CA 5I2OA 3BUXB 1CDNA 1UHNA 3V2LA 1BLQA 1AVSA 1C7WA 1YX7A 2JT0A 2WCJA 1TWOA 4OV2A 1PVAA 2BKHB 2WCLA 4XJKB 2WORA 5BPJA 2M0RA 4C0JA 1BG1A 3NGVA 1SYMA 4QJ4B 2KI4C 1JWDA 4PT1A 2LP3A 1KQVA 3S0FA 3BUNB 2KOTA 1YUSA 1JSAA 2K8MB 2TN4A 2OTGC 1MWNA 5CSFA 3SS5A 1J7RA 5F6TA 2HETA 1YUTA 2QEBA 5B8IB 1AP4A 1QX5B 2M1KB 1CDLA 2BECA 2NLNA 1NYAA 3EVVA 1Y1XA 4I5LB 5AANA 2JT3A 2P6BB 3A4UB 2FCEA 2WCFA 2Q91A 3O2PA 1ALWA 1S6JA 3DY9A 4DCKA 1C3YA 3LL8B 2GV5A 2BE6A 2KPHA 3SG2A 4PE1A 1PULA 1GJYA 3PATA 1CM4A 3DF0B 1UURA 2AUCA 5IBWA 1V1GA 1TN4A 1OZSA 1QASA 5JJGA 1S6CA 2PRUA 1TNXA 3DYEA 3PSRA 1AK8A 3BUMB 2QEVA 3I5HC 1RFJA 1SY9A 4GGNA 1TNQA 4GNKB 1L7ZA 1KK7Y 2BE4A 2EC6C 2ERBA 4CFRA 4JPZB 4PE7A 4QJ3B 4U8DA 2CXJA 3Q8IA 1TIZA 2LLUA 3PFVA 3PN7B 3NSOA 1S6IA 2BKIB 2E30A 2ZFDA 2ZRSA 3PALA 3HCMA 4MRYA 5G08A 5PALA 4ZCVA 4AOMA 1KCYA 1XFWO 1ZACA 3VRQA 1F55A 4MLWA 1M45A 1J7OA 1DGVA 1M46A 2CNPA 3S0AA 1BF5A 4USLA 2KFHA 2JRFA 3BFHA 1NSHA 2P71A 1KK8B 2PMYA 4FQTA 2KBMA 2JOJA 1XYDA 2K7BA 4JWQA 1N2DA 3UO9A 2HF5A 4XYNA 5KSZA 2H2KA 2WOSA 4QJ5B 1QX2A 2CTNA 2PALA 4MN0A 1F54A 4YGCB 2LMVA 2F2PA 1W7JB 1WLMA 3R1OA 3LK1A 1Y0VH 4I5JA 4MZLA 4OVNF 4YGEB 2KI6C 3B86A 1K90D 2KGRA 3O4YA 1NUBA 2BL0B 1CLLA 3FS7A 3PJIA 4N1FA 1NIWA 3VB1A 3CZTX 2FJYA 4Q04A 1W7IB 1R2UA 1CDPA 1PSBA 3TS5B 5CSJA 3PLFB 2I18A 1DF0A 3DD4A 4HREE 5AFPA 1F71A 4N1GA 4WRIA 5HKZA 1SL8A 2ZN8A 1VRKA 1JF2A 1SPYA 1AJ4A 1J7PA 1JBAA 1SR6B 3GOFA 2WC5A 1QLKA 1MF8B 1DVIA 1XFRA 2GTEA 5I94A 1D1OA 1KSOA 5AXIA 1MR8A 2KBIA 3OX5A 1K9UA 3R1PA 1OOJA 1K96A 1RECA 1WRZA 3ICBA 5GQQC 3OB2B 4C0LA 4HRHA 2LLSA 2M1UA 2LHLA 4M2OA 3JVTB 1XFXO 1TNWA 1YTZC 1J55A 1Q80A 2PASA 3SG7A 1B4CA 3FE6A 5HYDA 1S1EA 2ISDA 4CFQA 3B7AA 5CPVA 1B8RA 1RWYA 2L4IA 2F33A 2KAYA 1DJIA 2AAOA 4PALA 3CS1A 2CCMA 2KHNA 2Q4UA 4OCIA 4DUQA 2K7CA 3RZSA 4OZDA 1NWDA 2AMIA 3SS3A 1IJ6A 1CMFA 5TNCA 1IGVA 2WCHA 2KI4B 1QXPA 2F3YA 2LVIA 3D73A 1F4OA 1YRTB 1DJYA 3GK4X 3LK0A 4F0ZB 1U5IB 2Y1NA 3B88A 3C1VA 1SNLA 2OTGB 1NX1A 1IRJA 2G9BA 2M49B 4NDDA 2L0PA 5DICA 1RK9A 2L50A 4FQOA 1SCVA 2V53A 1H8BA 1NX0A 3TUYB 3K1EA 2PYQA 1HQVA 2F8PA 2F2OA 1IKUA 3B6XA 1TRFA 1TUZA 3JTDC 4IL1A 4ORAB 2OS8C 1V1FA 3GK2A 3I5HB 2NCPA 3BJHA 3O4XA 1M39A 1S3PA 2EC6B 3D0YA 3SIBA 1A2XA 2CT9A 1IH0A 2VRGA 1KFXL 4PHJA 1SL9A 4F7FA 1TTXA 2ZRTA 1TNPA 2MJWB 1XFZO 3AKAA 3I5FC 1QVIY 1UHKA 4I5KA 5KU1A 1BJFA 3OP0A 1SMGA 3BFBA 4AQIA 3PM8A 1DJGA 1G33A 1UHHA 1XO5A 1CTRA 2MAZA 1EJ3A 1KK7Z 1TOPA 1WLZA 2WCBA 2YGUA 5CSNA 3EKJA 2JXCA 4D1EA 1PALA 4WQ2A 3IF7A 2HPSA 1OMRA 2BCBA 1XVJA 4MVFA 3NHTA 2LLTA 3WHTB 1YX8A 3CDNA 3RM1A 1G4YR 3WHUB 3D75A 1DJHA 4M2QA 2JQ6A 1C07A 4FTGA 1KWOC 1DTLA 4MRXA 1QTXA 1A75B 2LMTA 3ZNIA 2Y1MA 1YRUB 1S5GY 1LXFC 1MQ1A 2LCPA 1N65A 2KFFA 2M9GA 4OKHA 5DKNA 1FI5A 4BY5A 4YGDB 3CZ2A 2KQ6A 3RLZA 2EHBA 1KFXS 2WC6A 1CFFA 1F4QA 2JPOA 2QEHA 3A8RA 1UHJA 1DJXA 1SBJA 1J1EA 2KYCA 2BAPA 1WDCB 1NP8A 1P28A 4PDZA 1K94A 5FI2A 4ZCUA 1SSEB 2KAVA 1F8HA 1F70A 2BCAA 1KFUL 1PRWA 5EL2A 4E68A 2ZN9A 3DVMA 3L47A 3CABA 3OX6A 3L4LA 1YVLA 3TZ1A 1CFPA 5FI7A 1CLMA 3O78A 2HQ8A 3VROA 2LNKA 5K89A 1QIWA 1Z4HA 2MRDA 1OQPA 1UHIA 1SW8A 3FWBA 4PE4A 3NSIA 1UWOA 1A29A 2MHHA 1N0YA 5D69A 1K9KA 1LA3A 1PSRA 1DC1A 2E6WA 2PQLA 2R2IA 1XK4C 1SKTA 2H61A 1NX2A 4MSPA 1ZFSA 1QV0A 2LP2A 1AHRA 2M97A 2JTTA 4PHMA 1YUUA 3EG5B 4XJKA 1IQ5A 1HT9A 2KI6D 4JD9A 3SG4A 4PE0A 3NSLA 3EK8A 2JPTA 2LUXA 1BR1B 5D7FA 4YRUA 1XK4A 5I2LA 3TDZA 2Y5IA 1EH2A 3IVTA 1IWQA 2P70A 3S0BA 3KPXA 3SS4A 2D8NA 1PK0D 3CR4X 4ICBA 3BOWB 1A03A 3CTNA 1B8LA 1CM1A 3VRNA 2O60A 1IIOA 5I2QA 2KNEA 1FPWA 5DKQA 1A4PA 2SCPA 2K2AA 4GUKA 1RROA 2COLB 3KEVA 2KDHA 1B9AA 2NZ0A 3OB1B 1K2HA 3DF0A 3E3RA 4P2YB 1EL4A 1LVCD 3OHMB 5I8NA 1DT7B 2JULA 2KQYA 2BNXA 1YURA 2OS8B 3EK4A 3JTDB 2LHIA 4YBHB 2LVKA 3BUWB 3DZTA 3CYZA 5ER5A 1JC2A 3N7HA 2A4JA 2K0JA 3MSEB 3CR2A 4ORBB 2LUCA
chains in the Genus database with same CATH topology
3BJHA 3D78A 3CZ1A 3DYEA 3QMEA 2QEVA 4F7FA 2ERBA 1OOFA 2QEOA 3DXLA 3Q8IA 3BFBA 1ORGA 3NHIA 3D76A 1C3ZA 3S0AA 1TUJA 3BFHA 2P71A 3NHTA 4INXA 4FQTA 3CDNA 1OOHA 3D75A 1T14A 1LS8A 1OOGA 3R1OA 3B86A 3BFAA 3CZ2A 2QDIA 3PJIA 3VB1A 2WC6A 1QWVA 2FJYA 2JPOA 2QEHA 1DQEA 1P28A 3D74A 3S0DA 3R1VA 2WCKA 3R72A 5EL2A 3FE8A 3L47A 3CZ0A 2WC5A 3CABA 3L4LA 1XFRA 2GTEA 4INWA 3R1PA 3FE9A 3B87A 3S0EA 2PQLA 3FE6A 3B7AA 3L4AA 1GM0A 4JD9A 2L2CA 3D77A 3V2LA 4OZDA 3RZSA 1OOIX 2P70A 3S0BA 2WCJA 1TWOA 2WCLA 2WCHA 3D73A 3OGNA 3NGVA 3B88A 4PT1A 2H8VA 3S0FA 5DICA 1OW4A 2QEBA 3K1EA 3S0GA 3DZTA 3CYZA 3DY9A 3N7HA 1C3YA 3B6XA 2KPHA 2WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJH A;  3D78 A;  3CZ1 A;  3DYE A;  3QME A;  2QEV A;  4F7F A;  2ERB A;  1OOF A;  2QEO A;  3DXL A;  3Q8I A;  3BFB A;  1ORG A;  3NHI A;  3D76 A;  1C3Z A;  3S0A A;  1TUJ A;  3BFH A;  2P71 A;  3NHT A;  4INX A;  4FQT A;  3CDN A;  1OOH A;  3D75 A;  1T14 A;  1LS8 A;  1OOG A;  3R1O A;  3B86 A;  3BFA A;  3CZ2 A;  2QDI A;  3PJI A;  3VB1 A;  2WC6 A;  1QWV A;  2FJY A;  2JPO A;  2QEH A;  1DQE A;  1P28 A;  3D74 A;  3S0D A;  3R1V A;  2WCK A;  3R72 A;  5EL2 A;  3FE8 A;  3L47 A;  3CZ0 A;  2WC5 A;  3CAB A;  3L4L A;  1XFR A;  2GTE A;  4INW A;  3R1P A;  3FE9 A;  3B87 A;  3S0E A;  2PQL A;  3FE6 A;  3B7A A;  3L4A A;  1GM0 A;  4JD9 A;  2L2C A;  3D77 A;  3V2L A;  4OZD A;  3RZS A;  1OOI X;  2P70 A;  3S0B A;  2WCJ A;  1TWO A;  2WCL A;  2WCH A;  3D73 A;  3OGN A;  3NGV A;  3B88 A;  4PT1 A;  2H8V A;  3S0F A;  5DIC A;  1OW4 A;  2QEB A;  3K1E A;  3S0G A;  3DZT A;  3CYZ A;  3DY9 A;  3N7H A;  1C3Y A;  3B6X A;  2KPH A;  2WCM A; 
#chains in the Genus database with same CATH topology
 1MUX A;  3I5G C;  1QAT A;  1R6P A;  2CBL A;  5HLV A;  1QX7 A;  3KO0 A;  3I5F B;  4GGF A;  2LMU A;  1OOF A;  4YGA A;  1FF1 A;  2LV7 A;  1BR4 B;  2GGZ A;  3FIA A;  1B47 A;  1QS7 A;  5JOL A;  2FOT A;  1ORG A;  3NHI A;  4MZK A;  2RGI A;  2BL0 C;  3F45 A;  4A4B A;  2M7N A;  4CLN A;  1AJ5 A;  2ZNE A;  1L2O C;  1QVI Z;  1DMO A;  3UNW A;  2WCE A;  4PHK A;  1C7V A;  1KWO B;  1WRK A;  2MA2 A;  1K8U A;  2JNF A;  1DEK A;  2JNX A;  4OR9 B;  1M31 A;  3CR5 X;  1H4B A;  1T14 A;  1Y1U A;  5KTY A;  2JZI A;  2Y4Q A;  2K7O A;  2B1U A;  3AAK A;  4HRG A;  3DVJ A;  3VRP A;  1LS8 A;  2BBM A;  1OOG A;  1SK6 D;  1DJW A;  2I7A A;  2WC8 A;  3SJS A;  3BYA A;  3SG5 A;  4NDC A;  1G8I A;  3BFA A;  3IQO A;  1B7T Y;  2JT8 A;  3NSK A;  1OSA A;  1CLB A;  1S5G Z;  4GAO A;  2LC5 A;  1X02 A;  3BQ3 A;  4A4C A;  3EVU A;  1UUS A;  2KFG A;  4GFT A;  1QIV A;  1NX3 A;  2JXL A;  1XFY O;  3D74 A;  4M2P A;  3S0D A;  1EXR A;  2L2E A;  5HKW A;  1JF0 A;  1SCM C;  5AER A;  1DGU A;  5J3X A;  3OBV A;  3DVE A;  1XFV O;  2WCK A;  3R72 A;  2MBX A;  4AQJ A;  3FE8 A;  1ALV A;  1B1G A;  3TDI A;  1K9P A;  4GBA A;  4BY4 A;  2QPT A;  1GGW A;  3WXA A;  2I2R E;  1DF0 B;  1LKJ A;  1MXL C;  3CGA A;  1M63 B;  3ZWH A;  2KYF A;  3B87 A;  4I5N B;  1K95 A;  1YVH A;  1KQM C;  3S0E A;  2M29 A;  4JKT A;  3EK7 A;  1OE9 B;  3CWG A;  1S26 D;  1E8A A;  2M3W A;  3KF9 A;  2ZKM X;  2L4H A;  3I5I C;  4ORC B;  1U5I A;  1YR5 A;  2L5Y A;  3TDU A;  2LAP A;  3D77 A;  1NCZ A;  3TUY C;  1FBV A;  2GGM A;  1OOI X;  1BMO A;  4TNC A;  3AKB A;  3CLN A;  1GGZ A;  1DEL A;  2JWW A;  1BT6 A;  1RJV A;  2OPO A;  3OGN A;  4DRW A;  1TCO B;  2DOQ A;  1QV1 A;  2H61 C;  5DKR A;  4DIR A;  3NXA A;  5FI6 A;  2KLE A;  1CMG A;  1JFK A;  2H8V A;  2L51 A;  1KSM A;  4NDB A;  1BOD A;  1TCF A;  1MXE A;  1AUI B;  3VRR A;  2K60 A;  4MZJ A;  5FYX A;  3S0G A;  1OW4 A;  4ETO A;  3LCP C;  3AAJ A;  5AEQ A;  1XFU O;  3SG3 A;  2PSR A;  2NCO A;  5HL1 A;  1JFJ A;  1LIN A;  3FWC A;  3I5G B;  5HLO A;  2K2F A;  2G2B A;  5CSI A;  3PM2 A;  3EKH A;  2WCM A;  1J7Q A;  1BOC A;  4WQ3 A;  3D78 A;  4N5X A;  1OZO A;  2M7L A;  4CID A;  3KHE A;  2EGD A;  4MEW A;  1UP5 A;  3CZ1 A;  1XA5 A;  1LA0 A;  1Z2C B;  2JU0 A;  3BUO B;  3QME A;  1ZUZ A;  2ZND A;  1DJZ A;  4HSZ A;  3D10 A;  1J1D A;  1KFU S;  2BCX A;  2O5G A;  3QRX A;  2HQW A;  3DVK A;  4PCW A;  4NQG A;  1WY9 A;  2QEO A;  3DXL A;  3K21 A;  3WNX B;  1L2O B;  1PVB A;  1CNP A;  5D3O A;  1FI6 A;  4C0K A;  3D0Y B;  3D76 A;  2WND A;  3HX4 A;  1BU3 A;  2L5X B;  2KSP A;  1C3Z A;  1A75 A;  3PN7 C;  4MBE A;  2I94 A;  2K61 A;  1TUJ A;  2QAC A;  1WDC C;  4INX A;  3H4S E;  4GGF C;  1S36 A;  1OOH A;  2KAX A;  2IS9 A;  1CKK A;  1RTP 1;  2LM5 A;  2JTZ A;  4UPG A;  1KK8 C;  1Y1A A;  4L9M A;  2NXQ A;  1WRL A;  4YI8 A;  2PVB A;  3SG6 A;  1ZMZ A;  3VGO A;  1CFC A;  1IG5 A;  4P5O E;  1JUO A;  1OMD A;  3LLE A;  2BBN A;  2QDI A;  3EVR A;  3M0W A;  1CB1 A;  1W9Z A;  1QWV A;  1IJ5 A;  2FCD A;  4PHN A;  1IQ3 A;  1OMV A;  1SRA A;  1FW4 A;  1SCM B;  2JC2 A;  4IJ7 A;  1B7T Z;  1DQE A;  1CDM A;  1NCX A;  1SL7 A;  4YGB B;  3O6B A;  1Y6W A;  1K93 D;  5ER4 X;  3SIA A;  3TS5 C;  5HKY A;  4JQ0 D;  1ZOT B;  3BXK A;  3R1V A;  1CFD A;  3GK1 A;  1ODB A;  3CZ0 A;  1EG4 A;  2FJU B;  2KLD A;  2LAN A;  4INW A;  2MLF C;  1KQM B;  1SR6 C;  3FE9 A;  3IQQ A;  1NCY A;  2SAS A;  2MLE C;  2M8U A;  1QLS A;  2LE9 B;  2LVJ A;  2L98 A;  3I5I B;  1B8C A;  4GPL B;  4R1E A;  2LVV A;  3JVT C;  2K7D A;  1MHO A;  1QJT A;  4KYN A;  1GQM A;  3L4A A;  4YI9 A;  2KGB C;  3BOW A;  1GM0 A;  1EG3 A;  1NPQ A;  4DS7 A;  4CPV A;  2F3Z A;  2L2C A;  5I2O A;  3BUX B;  1CDN A;  1UHN A;  3V2L A;  1BLQ A;  1AVS A;  1C7W A;  1YX7 A;  2JT0 A;  2WCJ A;  1TWO A;  4OV2 A;  1PVA A;  2BKH B;  2WCL A;  4XJK B;  2WOR A;  5BPJ A;  2M0R A;  4C0J A;  1BG1 A;  3NGV A;  1SYM A;  4QJ4 B;  2KI4 C;  1JWD A;  4PT1 A;  2LP3 A;  1KQV A;  3S0F A;  3BUN B;  2KOT A;  1YUS A;  1JSA A;  2K8M B;  2TN4 A;  2OTG C;  1MWN A;  5CSF A;  3SS5 A;  1J7R A;  5F6T A;  2HET A;  1YUT A;  2QEB A;  5B8I B;  1AP4 A;  1QX5 B;  2M1K B;  1CDL A;  2BEC A;  2NLN A;  1NYA A;  3EVV A;  1Y1X A;  4I5L B;  5AAN A;  2JT3 A;  2P6B B;  3A4U B;  2FCE A;  2WCF A;  2Q91 A;  3O2P A;  1ALW A;  1S6J A;  3DY9 A;  4DCK A;  1C3Y A;  3LL8 B;  2GV5 A;  2BE6 A;  2KPH A;  3SG2 A;  4PE1 A;  1PUL A;  1GJY A;  3PAT A;  1CM4 A;  3DF0 B;  1UUR A;  2AUC A;  5IBW A;  1V1G A;  1TN4 A;  1OZS A;  1QAS A;  5JJG A;  1S6C A;  2PRU A;  1TNX A;  3DYE A;  3PSR A;  1AK8 A;  3BUM B;  2QEV A;  3I5H C;  1RFJ A;  1SY9 A;  4GGN A;  1TNQ A;  4GNK B;  1L7Z A;  1KK7 Y;  2BE4 A;  2EC6 C;  2ERB A;  4CFR A;  4JPZ B;  4PE7 A;  4QJ3 B;  4U8D A;  2CXJ A;  3Q8I A;  1TIZ A;  2LLU A;  3PFV A;  3PN7 B;  3NSO A;  1S6I A;  2BKI B;  2E30 A;  2ZFD A;  2ZRS A;  3PAL A;  3HCM A;  4MRY A;  5G08 A;  5PAL A;  4ZCV A;  4AOM A;  1KCY A;  1XFW O;  1ZAC A;  3VRQ A;  1F55 A;  4MLW A;  1M45 A;  1J7O A;  1DGV A;  1M46 A;  2CNP A;  3S0A A;  1BF5 A;  4USL A;  2KFH A;  2JRF A;  3BFH A;  1NSH A;  2P71 A;  1KK8 B;  2PMY A;  4FQT A;  2KBM A;  2JOJ A;  1XYD A;  2K7B A;  4JWQ A;  1N2D A;  3UO9 A;  2HF5 A;  4XYN A;  5KSZ A;  2H2K A;  2WOS A;  4QJ5 B;  1QX2 A;  2CTN A;  2PAL A;  4MN0 A;  1F54 A;  4YGC B;  2LMV A;  2F2P A;  1W7J B;  1WLM A;  3R1O A;  3LK1 A;  1Y0V H;  4I5J A;  4MZL A;  4OVN F;  4YGE B;  2KI6 C;  3B86 A;  1K90 D;  2KGR A;  3O4Y A;  1NUB A;  2BL0 B;  1CLL A;  3FS7 A;  3PJI A;  4N1F A;  1NIW A;  3VB1 A;  3CZT X;  2FJY A;  4Q04 A;  1W7I B;  1R2U A;  1CDP A;  1PSB A;  3TS5 B;  5CSJ A;  3PLF B;  2I18 A;  1DF0 A;  3DD4 A;  4HRE E;  5AFP A;  1F71 A;  4N1G A;  4WRI A;  5HKZ A;  1SL8 A;  2ZN8 A;  1VRK A;  1JF2 A;  1SPY A;  1AJ4 A;  1J7P A;  1JBA A;  1SR6 B;  3GOF A;  2WC5 A;  1QLK A;  1MF8 B;  1DVI A;  1XFR A;  2GTE A;  5I94 A;  1D1O A;  1KSO A;  5AXI A;  1MR8 A;  2KBI A;  3OX5 A;  1K9U A;  3R1P A;  1OOJ A;  1K96 A;  1REC A;  1WRZ A;  3ICB A;  5GQQ C;  3OB2 B;  4C0L A;  4HRH A;  2LLS A;  2M1U A;  2LHL A;  4M2O A;  3JVT B;  1XFX O;  1TNW A;  1YTZ C;  1J55 A;  1Q80 A;  2PAS A;  3SG7 A;  1B4C A;  3FE6 A;  5HYD A;  1S1E A;  2ISD A;  4CFQ A;  3B7A A;  5CPV A;  1B8R A;  1RWY A;  2L4I A;  2F33 A;  2KAY A;  1DJI A;  2AAO A;  4PAL A;  3CS1 A;  2CCM A;  2KHN A;  2Q4U A;  4OCI A;  4DUQ A;  2K7C A;  3RZS A;  4OZD A;  1NWD A;  2AMI A;  3SS3 A;  1IJ6 A;  1CMF A;  5TNC A;  1IGV A;  2WCH A;  2KI4 B;  1QXP A;  2F3Y A;  2LVI A;  3D73 A;  1F4O A;  1YRT B;  1DJY A;  3GK4 X;  3LK0 A;  4F0Z B;  1U5I B;  2Y1N A;  3B88 A;  3C1V A;  1SNL A;  2OTG B;  1NX1 A;  1IRJ A;  2G9B A;  2M49 B;  4NDD A;  2L0P A;  5DIC A;  1RK9 A;  2L50 A;  4FQO A;  1SCV A;  2V53 A;  1H8B A;  1NX0 A;  3TUY B;  3K1E A;  2PYQ A;  1HQV A;  2F8P A;  2F2O A;  1IKU A;  3B6X A;  1TRF A;  1TUZ A;  3JTD C;  4IL1 A;  4ORA B;  2OS8 C;  1V1F A;  3GK2 A;  3I5H B;  2NCP A;  3BJH A;  3O4X A;  1M39 A;  1S3P A;  2EC6 B;  3D0Y A;  3SIB A;  1A2X A;  2CT9 A;  1IH0 A;  2VRG A;  1KFX L;  4PHJ A;  1SL9 A;  4F7F A;  1TTX A;  2ZRT A;  1TNP A;  2MJW B;  1XFZ O;  3AKA A;  3I5F C;  1QVI Y;  1UHK A;  4I5K A;  5KU1 A;  1BJF A;  3OP0 A;  1SMG A;  3BFB A;  4AQI A;  3PM8 A;  1DJG A;  1G33 A;  1UHH A;  1XO5 A;  1CTR A;  2MAZ A;  1EJ3 A;  1KK7 Z;  1TOP A;  1WLZ A;  2WCB A;  2YGU A;  5CSN A;  3EKJ A;  2JXC A;  4D1E A;  1PAL A;  4WQ2 A;  3IF7 A;  2HPS A;  1OMR A;  2BCB A;  1XVJ A;  4MVF A;  3NHT A;  2LLT A;  3WHT B;  1YX8 A;  3CDN A;  3RM1 A;  1G4Y R;  3WHU B;  3D75 A;  1DJH A;  4M2Q A;  2JQ6 A;  1C07 A;  4FTG A;  1KWO C;  1DTL A;  4MRX A;  1QTX A;  1A75 B;  2LMT A;  3ZNI A;  2Y1M A;  1YRU B;  1S5G Y;  1LXF C;  1MQ1 A;  2LCP A;  1N65 A;  2KFF A;  2M9G A;  4OKH A;  5DKN A;  1FI5 A;  4BY5 A;  4YGD B;  3CZ2 A;  2KQ6 A;  3RLZ A;  2EHB A;  1KFX S;  2WC6 A;  1CFF A;  1F4Q A;  2JPO A;  2QEH A;  3A8R A;  1UHJ A;  1DJX A;  1SBJ A;  1J1E A;  2KYC A;  2BAP A;  1WDC B;  1NP8 A;  1P28 A;  4PDZ A;  1K94 A;  5FI2 A;  4ZCU A;  1SSE B;  2KAV A;  1F8H A;  1F70 A;  2BCA A;  1KFU L;  1PRW A;  5EL2 A;  4E68 A;  2ZN9 A;  3DVM A;  3L47 A;  3CAB A;  3OX6 A;  3L4L A;  1YVL A;  3TZ1 A;  1CFP A;  5FI7 A;  1CLM A;  3O78 A;  2HQ8 A;  3VRO A;  2LNK A;  5K89 A;  1QIW A;  1Z4H A;  2MRD A;  1OQP A;  1UHI A;  1SW8 A;  3FWB A;  4PE4 A;  3NSI A;  1UWO A;  1A29 A;  2MHH A;  1N0Y A;  5D69 A;  1K9K A;  1LA3 A;  1PSR A;  1DC1 A;  2E6W A;  2PQL A;  2R2I A;  1XK4 C;  1SKT A;  2H61 A;  1NX2 A;  4MSP A;  1ZFS A;  1QV0 A;  2LP2 A;  1AHR A;  2M97 A;  2JTT A;  4PHM A;  1YUU A;  3EG5 B;  4XJK A;  1IQ5 A;  1HT9 A;  2KI6 D;  4JD9 A;  3SG4 A;  4PE0 A;  3NSL A;  3EK8 A;  2JPT A;  2LUX A;  1BR1 B;  5D7F A;  4YRU A;  1XK4 A;  5I2L A;  3TDZ A;  2Y5I A;  1EH2 A;  3IVT A;  1IWQ A;  2P70 A;  3S0B A;  3KPX A;  3SS4 A;  2D8N A;  1PK0 D;  3CR4 X;  4ICB A;  3BOW B;  1A03 A;  3CTN A;  1B8L A;  1CM1 A;  3VRN A;  2O60 A;  1IIO A;  5I2Q A;  2KNE A;  1FPW A;  5DKQ A;  1A4P A;  2SCP A;  2K2A A;  4GUK A;  1RRO A;  2COL B;  3KEV A;  2KDH A;  1B9A A;  2NZ0 A;  3OB1 B;  1K2H A;  3DF0 A;  3E3R A;  4P2Y B;  1EL4 A;  1LVC D;  3OHM B;  5I8N A;  1DT7 B;  2JUL A;  2KQY A;  2BNX A;  1YUR A;  2OS8 B;  3EK4 A;  3JTD B;  2LHI A;  4YBH B;  2LVK A;  3BUW B;  3DZT A;  3CYZ A;  5ER5 A;  1JC2 A;  3N7H A;  2A4J A;  2K0J A;  3MSE B;  3CR2 A;  4ORB B;  2LUC A; 
#chains in the Genus database with same CATH homology
 3BJH A;  3D78 A;  3CZ1 A;  3DYE A;  3QME A;  2QEV A;  4F7F A;  2ERB A;  1OOF A;  2QEO A;  3DXL A;  3Q8I A;  3BFB A;  1ORG A;  3NHI A;  3D76 A;  1C3Z A;  3S0A A;  1TUJ A;  3BFH A;  2P71 A;  3NHT A;  4INX A;  4FQT A;  3CDN A;  1OOH A;  3D75 A;  1T14 A;  1LS8 A;  1OOG A;  3R1O A;  3B86 A;  3BFA A;  3CZ2 A;  2QDI A;  3PJI A;  3VB1 A;  2WC6 A;  1QWV A;  2FJY A;  2JPO A;  2QEH A;  1DQE A;  1P28 A;  3D74 A;  3S0D A;  3R1V A;  2WCK A;  3R72 A;  5EL2 A;  3FE8 A;  3L47 A;  3CZ0 A;  2WC5 A;  3CAB A;  3L4L A;  1XFR A;  2GTE A;  4INW A;  3R1P A;  3FE9 A;  3B87 A;  3S0E A;  2PQL A;  3FE6 A;  3B7A A;  3L4A A;  1GM0 A;  4JD9 A;  2L2C A;  3D77 A;  3V2L A;  4OZD A;  3RZS A;  1OOI X;  2P70 A;  3S0B A;  2WCJ A;  1TWO A;  2WCL A;  2WCH A;  3D73 A;  3OGN A;  3NGV A;  3B88 A;  4PT1 A;  2H8V A;  3S0F A;  5DIC A;  1OW4 A;  2QEB A;  3K1E A;  3S0G A;  3DZT A;  3CYZ A;  3DY9 A;  3N7H A;  1C3Y A;  3B6X A;  2KPH A;  2WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...